F434508

General Info

Members Datasets Scaffolds Average Seq Length
400 216 800 154

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10260997|Ga0070709_102609972
Length 180
Sequence MLRPREGLNYAQMRLYVGVYAPLSSPEFLMSLVDDQNAPLCNCLAIRQASRHVTQFYDQLLAPSGLRTTQFAILGRLQRSGPMPINALAAALVMDRTTLGRNILPLERDGLIEIGASPKDRRRREVRLTSAGAARMRAARQGWKEAQQRFDQVFGAERAAALRDLLREVTASEFTASPGS

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
56 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
75 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
76 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
77 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
78 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
79 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
80 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
122 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
127 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
128 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
129 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
130 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
131 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
132 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
133 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
134 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
135 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
136 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
137 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
138 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
139 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
140 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
142 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
146 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
147 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
148 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
149 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
150 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
151 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
152 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
153 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
156 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
157 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
158 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
159 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
160 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
161 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
162 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
163 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
164 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
165 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
166 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
167 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
168 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
169 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
170 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
171 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
172 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
173 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
174 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
175 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
176 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
177 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
178 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
179 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
180 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
181 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
182 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
183 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
184 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
185 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
186 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
194 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
195 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
196 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
198 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
199 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
200 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
201 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
202 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
203 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
204 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
205 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
206 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
207 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
208 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
209 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
210 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
211 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
212 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
213 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
214 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
215 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
216 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0
Isolates 0.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.5
Nodule 0
Rhizoplane 3.75
Rhizosphere 81.75
Stem 0
Stem Tuber 0
Unclassified 17.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_10260997 3300005434 Bacteria 1251
2 rootH1_10312643 3300003323 Bacteria 1435
3 Ga0070683_101270048 3300005329 Bacteria 708
4 Ga0070682_100223353 3300005337 Bacteria 1342
5 Ga0070689_100649001 3300005340 Bacteria 918
6 Ga0070668_100549575 3300005347 Bacteria 1005
7 Ga0070671_100231256 3300005355 Bacteria 1569
8 Ga0070673_100978916 3300005364 Bacteria 787
9 Ga0070659_100807833 3300005366 Bacteria 816
10 Ga0070709_10097317 3300005434 Bacteria 1953
11 Ga0070709_10223151 3300005434 Bacteria 1345
12 Ga0070709_10263804 3300005434 Bacteria 1245
13 Ga0070709_10663126 3300005434 Bacteria 809
14 Ga0070714_100026541 3300005435 Bacteria 4788
15 Ga0070714_100063633 3300005435 Bacteria 3173
16 Ga0070714_100125215 3300005435 Bacteria 2290
17 Ga0070714_100814645 3300005435 Bacteria 905
18 Ga0070714_100919776 3300005435 Bacteria 850
19 Ga0070714_101213476 3300005435 Unclassified 736
20 Ga0070714_101471397 3300005435 Bacteria 665
21 Ga0070713_100026389 3300005436 Bacteria 4559
22 Ga0070713_100090506 3300005436 Bacteria 2630
23 Ga0070713_100199140 3300005436 Bacteria 1808
24 Ga0070713_100723034 3300005436 Unclassified 951
25 Ga0070710_10202697 3300005437 Bacteria 1253
26 Ga0070710_10282365 3300005437 Unclassified 1078
27 Ga0070710_10448026 3300005437 Bacteria 874
28 Ga0070711_100303757 3300005439 Bacteria 1270
29 Ga0070711_100643358 3300005439 Bacteria 888
30 Ga0070711_101221997 3300005439 Unclassified 650
31 Ga0070708_100873233 3300005445 Unclassified 845
32 Ga0070678_100975190 3300005456 Bacteria 778
33 Ga0070662_100225464 3300005457 Unclassified 1497
34 Ga0070681_10124538 3300005458 Bacteria 2510
35 Ga0070681_11407726 3300005458 Unclassified 621
36 Ga0070685_10671425 3300005466 Unclassified 753
37 Ga0070685_11027425 3300005466 Unclassified 620
38 Ga0070706_100107792 3300005467 Plasmid 2591
39 Ga0070706_100763845 3300005467 Unclassified 895
40 Ga0070707_100010901 3300005468 Bacteria 8465
41 Ga0070707_100224806 3300005468 Bacteria 1827
42 Ga0070707_100271930 3300005468 Bacteria 1647
43 Ga0070698_100197381 3300005471 Bacteria 1949
44 Ga0070698_100374966 3300005471 Bacteria 1355
45 Ga0070699_100633709 3300005518 Unclassified 975
46 Ga0070699_100803377 3300005518 Unclassified 861
47 Ga0070679_100741332 3300005530 Unclassified 925
48 Ga0070679_100941719 3300005530 Unclassified 807
49 Ga0070684_101487624 3300005535 Bacteria 638
50 Ga0070697_100419764 3300005536 Bacteria 1162
51 Ga0070686_100250149 3300005544 Bacteria 1294
52 Ga0070696_100652193 3300005546 Bacteria 853
53 Ga0070693_100361677 3300005547 Bacteria 996
54 Ga0068855_100290091 3300005563 Bacteria 1814
55 Ga0070664_100289966 3300005564 Bacteria 1477
56 Ga0070664_101022837 3300005564 Unclassified 777
57 Ga0068857_101296966 3300005577 Unclassified 707
58 Ga0068856_100705560 3300005614 Bacteria 1029
59 Ga0068856_102247443 3300005614 Bacteria 554
60 Ga0070702_101653807 3300005615 Unclassified 531
61 Ga0068858_100282682 3300005842 Bacteria 1580
62 Ga0068858_102106885 3300005842 Bacteria 558
63 Ga0068860_100472002 3300005843 Bacteria 1250
64 Ga0081455_10073110 3300005937 Bacteria 2835
65 Ga0081455_10184899 3300005937 Bacteria 1575
66 Ga0081455_10205376 3300005937 Bacteria 1472
67 Ga0081540_1028687 3300005983 Bacteria 3119
68 Ga0070717_10060311 3300006028 Bacteria 3141
69 Ga0070717_10123844 3300006028 Bacteria 2217
70 Ga0070717_10172657 3300006028 Bacteria 1881
71 Ga0070717_10217569 3300006028 Bacteria 1678
72 Ga0070717_10334161 3300006028 Bacteria 1352
73 Ga0070717_10367062 3300006028 Bacteria 1289
74 Ga0070717_10551217 3300006028 Bacteria 1044
75 Ga0075365_10133365 3300006038 Bacteria 1720
76 Ga0075368_10065667 3300006042 Bacteria 1458
77 Ga0070716_100191487 3300006173 Bacteria 1352
78 Ga0070716_100668631 3300006173 Bacteria 790
79 Ga0070716_100861958 3300006173 Unclassified 706
80 Ga0070716_101136437 3300006173 Bacteria 624
81 Ga0070712_100073185 3300006175 Unclassified 2457
82 Ga0070712_100085621 3300006175 Bacteria 2295
83 Ga0070712_100151459 3300006175 Bacteria 1781
84 Ga0070712_100299707 3300006175 Bacteria 1301
85 Ga0070712_100318638 3300006175 Bacteria 1264
86 Ga0070712_100406388 3300006175 Bacteria 1126
87 Ga0070712_100439041 3300006175 Unclassified 1085
88 Ga0070712_100508059 3300006175 Bacteria 1011
89 Ga0070712_100694923 3300006175 Bacteria 867
90 Ga0075362_10278847 3300006177 Bacteria 826
91 Ga0075367_10056540 3300006178 Bacteria 2331
92 Ga0075369_10005637 3300006186 Bacteria 4691
93 Ga0075369_10034035 3300006186 Bacteria 2161
94 Ga0075366_10029828 3300006195 Bacteria 3205
95 Ga0075366_10256551 3300006195 Bacteria 1067
96 Ga0075430_100036232 3300006846 Bacteria 4183
97 Ga0075430_100849138 3300006846 Bacteria 752
98 Ga0075431_100120240 3300006847 Bacteria 2710
99 Ga0075431_100304716 3300006847 Bacteria 1609
100 Ga0075433_10069258 3300006852 Bacteria 3098
101 Ga0075433_10310106 3300006852 Bacteria 1397
102 Ga0075434_100063081 3300006871 Bacteria 3689
103 Ga0075434_100196802 3300006871 Bacteria 2035
104 Ga0075434_100212234 3300006871 Bacteria 1956
105 Ga0075434_100917787 3300006871 Bacteria 890
106 Ga0075429_100040776 3300006880 Bacteria 4042
107 Ga0068865_100584364 3300006881 Unclassified 942
108 Ga0075436_100950043 3300006914 Unclassified 644
109 Ga0075435_100047591 3300007076 Bacteria 3443
110 Ga0075435_100054467 3300007076 Bacteria 3228
111 Ga0075435_100077169 3300007076 Bacteria 2731
112 Ga0075435_100849144 3300007076 Bacteria 795
113 Ga0099794_10128214 3300007265 Bacteria 1280
114 Ga0099794_10229845 3300007265 Unclassified 954
115 Ga0099795_10041507 3300007788 Bacteria 1638
116 Ga0099795_10074526 3300007788 Bacteria 1287
117 Ga0099795_10257517 3300007788 Bacteria 755
118 Ga0099795_10382721 3300007788 Unclassified 635
119 Ga0111539_10134794 3300009094 Bacteria 2892
120 Ga0111539_10189217 3300009094 Bacteria 2402
121 Ga0111539_10205623 3300009094 Unclassified 2295
122 Ga0111539_10281366 3300009094 Bacteria 1936
123 Ga0105245_11298195 3300009098 Bacteria 777
124 Ga0114129_10335770 3300009147 Bacteria 2006
125 Ga0105243_10819019 3300009148 Bacteria 919
126 Ga0105242_10359919 3300009176 Unclassified 1346
127 Ga0105248_10973988 3300009177 Bacteria 958
128 Ga0105248_11441352 3300009177 Unclassified 779
129 Ga0105238_10777078 3300009551 Bacteria 972
130 Ga0099796_10098014 3300010159 Bacteria 1099
131 Ga0105239_12202225 3300010375 Unclassified 641
132 Ga0105239_12867252 3300010375 Unclassified 563
133 Ga0157370_11117454 3300013104 Bacteria 712
134 Ga0157378_10344957 3300013297 Bacteria 1453
135 Ga0163162_10350824 3300013306 Bacteria 1608
136 Ga0163162_11276425 3300013306 Unclassified 834
137 Ga0157375_10395293 3300013308 Bacteria 1549
138 Ga0157375_10540749 3300013308 Bacteria 1327
139 Ga0157375_12287174 3300013308 Bacteria 644
140 Ga0157375_12645727 3300013308 Bacteria 600
141 Ga0157380_11605899 3300014326 Unclassified 706
142 Ga0182008_10037555 3300014497 Bacteria 2423
143 Ga0157377_10636276 3300014745 Bacteria 766
144 Ga0157379_10265066 3300014968 Bacteria 1562
145 Ga0157379_10801981 3300014968 Unclassified 889
146 Ga0182007_10054864 3300015262 Bacteria 1310
147 Ga0213874_10090749 3300021377 Bacteria 1003
148 Ga0213876_10011611 3300021384 Bacteria 4702
149 Ga0213876_10141080 3300021384 Bacteria 1281
150 Ga0213876_10152052 3300021384 Bacteria 1231
151 Ga0213876_10288396 3300021384 Bacteria 872
152 Ga0213876_10293190 3300021384 Bacteria 864
153 Ga0213875_10000206 3300021388 Bacteria 60326
154 Ga0213875_10000863 3300021388 Bacteria 22384
155 Ga0213875_10002256 3300021388 Bacteria 11691
156 Ga0213875_10005454 3300021388 Bacteria 6826
157 Ga0213875_10039185 3300021388 Bacteria 2233
158 Ga0213875_10201732 3300021388 Unclassified 936
159 Ga0213875_10378648 3300021388 Bacteria 674
160 Ga0213871_10147828 3300021441 Unclassified 713
161 Ga0228598_1039961 3300024227 Bacteria 926
162 Ga0207692_10103987 3300025898 Bacteria 1564
163 Ga0207692_10172721 3300025898 Bacteria 1253
164 Ga0207692_10211538 3300025898 Bacteria 1145
165 Ga0207692_10212335 3300025898 Bacteria 1143
166 Ga0207642_10594051 3300025899 Bacteria 688
167 Ga0207688_10020240 3300025901 Bacteria 3632
168 Ga0207680_10487654 3300025903 Bacteria 877
169 Ga0207685_10002938 3300025905 Bacteria 4033
170 Ga0207699_10023764 3300025906 Bacteria 3340
171 Ga0207699_10042915 3300025906 Bacteria 2624
172 Ga0207699_10091740 3300025906 Bacteria 1908
173 Ga0207699_10278086 3300025906 Bacteria 1162
174 Ga0207699_10341162 3300025906 Unclassified 1055
175 Ga0207684_10021638 3300025910 Bacteria 5490
176 Ga0207684_10165836 3300025910 Bacteria 1903
177 Ga0207684_10475318 3300025910 Bacteria 1072
178 Ga0207695_10218484 3300025913 Bacteria 1814
179 Ga0207671_10150008 3300025914 Bacteria 1801
180 Ga0207693_10018645 3300025915 Bacteria 5525
181 Ga0207693_10034518 3300025915 Bacteria 3990
182 Ga0207693_10044184 3300025915 Bacteria 3502
183 Ga0207693_10052910 3300025915 Bacteria 3185
184 Ga0207693_10355027 3300025915 Bacteria 1147
185 Ga0207693_10867990 3300025915 Unclassified 693
186 Ga0207663_10124240 3300025916 Bacteria 1772
187 Ga0207663_10229798 3300025916 Bacteria 1355
188 Ga0207652_10412137 3300025921 Bacteria 1219
189 Ga0207646_10024085 3300025922 Bacteria 5580
190 Ga0207646_10143888 3300025922 Bacteria 2148
191 Ga0207646_10222002 3300025922 Bacteria 1707
192 Ga0207646_10714185 3300025922 Bacteria 896
193 Ga0207681_10464061 3300025923 Bacteria 1032
194 Ga0207694_10530780 3300025924 Bacteria 987
195 Ga0207700_10007928 3300025928 Bacteria 6538
196 Ga0207700_10055029 3300025928 Bacteria 2989
197 Ga0207700_10109176 3300025928 Bacteria 2223
198 Ga0207700_10174513 3300025928 Bacteria 1795
199 Ga0207700_10184603 3300025928 Bacteria 1749
200 Ga0207664_10070791 3300025929 Bacteria 2807
201 Ga0207664_10074725 3300025929 Bacteria 2739
202 Ga0207664_10213749 3300025929 Bacteria 1669
203 Ga0207644_10227097 3300025931 Bacteria 1482
204 Ga0207644_11044654 3300025931 Bacteria 686
205 Ga0207706_10394967 3300025933 Unclassified 1199
206 Ga0207670_11189662 3300025936 Bacteria 645
207 Ga0207704_10116407 3300025938 Bacteria 1819
208 Ga0207665_10159027 3300025939 Bacteria 1624
209 Ga0207665_10710431 3300025939 Unclassified 791
210 Ga0207689_10703206 3300025942 Bacteria 852
211 Ga0207661_10122807 3300025944 Bacteria 2214
212 Ga0207679_10596022 3300025945 Unclassified 995
213 Ga0207667_11050967 3300025949 Bacteria 799
214 Ga0207668_10662160 3300025972 Bacteria 915
215 Ga0207640_10276951 3300025981 Unclassified 1316
216 Ga0207677_10638391 3300026023 Bacteria 938
217 Ga0207708_10253745 3300026075 Unclassified 1418
218 Ga0207648_10052358 3300026089 Bacteria 3569
219 Ga0207676_10371355 3300026095 Bacteria 1329
220 Ga0207674_10666935 3300026116 Bacteria 1004
221 Ga0207674_10840321 3300026116 Bacteria 886
222 Ga0207675_100030571 3300026118 Bacteria 5017
223 Ga0207675_100716730 3300026118 Unclassified 1010
224 Ga0207698_11188761 3300026142 Unclassified 776
225 Ga0209179_1023538 3300027512 Bacteria 1216
226 Ga0209588_1066156 3300027671 Bacteria 1168
227 Ga0209813_10014960 3300027866 Bacteria 2095
228 Ga0207428_10106028 3300027907 Bacteria 2167
229 Ga0265357_1001222 3300028023 Bacteria 1821
230 Ga0265357_1002800 3300028023 Bacteria 1459
231 Ga0268265_10989343 3300028380 Bacteria 830
232 Ga0268265_11282256 3300028380 Bacteria 732
233 Ga0268265_11455958 3300028380 Unclassified 688
234 Ga0265325_10131726 3300031241 Bacteria 1196
235 Ga0307509_10453449 3300031507 Unclassified 976
236 Ga0307408_100922100 3300031548 Bacteria 801
237 Ga0307408_101071275 3300031548 Unclassified 746
238 Ga0307407_10831054 3300031903 Unclassified 705
239 Ga0307412_10609369 3300031911 Unclassified 926
240 Ga0307411_10891794 3300032005 Unclassified 789
241 Ga0373926_0177972 3300035083 Unclassified 815
242 Ga0373923_0122425 3300035111 Bacteria 1163
243 Ga0373923_0234229 3300035111 Unclassified 856
244 Ga0373936_0224322 3300035113 Unclassified 834
245 Ga0373945_0038335 3300035116 Bacteria 1724
246 Ga0373953_0062915 3300035117 Bacteria 1520
247 Ga0373954_0189994 3300035118 Bacteria 1008
248 Ga0373956_0049639 3300035119 Bacteria 1882
249 Ga0373957_0114552 3300035120 Bacteria 1088
250 Ga0373957_0150615 3300035120 Bacteria 955
251 Ga0373943_0014271 3300035170 Bacteria 3594
252 Ga0373943_0283391 3300035170 Unclassified 937
253 Ga0373946_0312738 3300035171 Bacteria 779
254 Ga0373955_0044043 3300035172 Bacteria 2402
255 Ga0373924_0243451 3300035410 Bacteria 796
256 Ga0373931_0080015 3300035691 Bacteria 1801
257 Ga0373931_0535143 3300035691 Unclassified 760
258 Ga0373935_0020486 3300035692 Bacteria 4042
259 Ga0373927_0403882 3300035695 Bacteria 901
260 Ga0373927_0653606 3300035695 Unclassified 695
261 Ga0373927_0725915 3300035695 Unclassified 656
262 Ga0373947_0005121 3300035725 Bacteria 7677
263 Ga0373947_0441201 3300035725 Bacteria 881
264 Ga0373937_0026847 3300036401 Bacteria 5206
265 Ga0373937_0156912 3300036401 Bacteria 2133
266 Ga0373925_0056916 3300037068 Bacteria 2929
267 Ga0373925_0140259 3300037068 Bacteria 1891
268 Ga0373925_0345406 3300037068 Unclassified 1207
269 Ga0395905_0708113 3300037471 Bacteria 909
270 Ga0436364_0004067 3300037853 Unclassified 1028
271 Ga0436364_0045510 3300037853 Bacteria 16396
272 Ga0436364_0113620 3300037853 Bacteria 848
273 Ga0436364_0323946 3300037853 Bacteria 960
274 Ga0436364_0517726 3300037853 Bacteria 2156
275 Ga0436364_0607465 3300037853 Bacteria 39411
276 Ga0436364_0935620 3300037853 Bacteria 17749
277 Ga0436364_0940234 3300037853 Bacteria 3306
278 Ga0436364_1310776 3300037853 Bacteria 1677
279 Ga0436364_1336668 3300037853 Bacteria 16008
280 Ga0436365_0110577 3300039437 Bacteria 22612
281 Ga0436365_0347443 3300039437 Bacteria 2004
282 Ga0436365_0348905 3300039437 Bacteria 1656
283 Ga0436365_0414675 3300039437 Bacteria 1105
284 Ga0436365_0545145 3300039437 Bacteria 1718
285 Ga0436365_0753793 3300039437 Bacteria 1284
286 Ga0436365_0975732 3300039437 Bacteria 5320
287 Ga0436365_1353345 3300039437 Bacteria 11442
288 Ga0436365_1587337 3300039437 Bacteria 623
289 Ga0436360_0177542 3300039438 Bacteria 616
290 Ga0436360_0457460 3300039438 Bacteria 1498
291 Ga0436360_0958774 3300039438 Bacteria 5005
292 Ga0436361_0334357 3300039447 Bacteria 3151
293 Ga0436361_0528170 3300039447 Bacteria 3159
294 Ga0436361_0783815 3300039447 Bacteria 1024
295 Ga0436363_0295539 3300039450 Bacteria 2017
296 Ga0436363_0341835 3300039450 Bacteria 764
297 Ga0436363_1446016 3300039450 Bacteria 30031
298 Ga0436363_1679020 3300039450 Unclassified 678
299 Ga0436362_0032733 3300039453 Bacteria 849
300 Ga0436362_0166111 3300039453 Bacteria 10615
301 Ga0436362_0915299 3300039453 Bacteria 5694
302 Ga0466966_0213420 3300044684 Bacteria 1166
303 Ga0466963_0864118 3300044694 Unclassified 638
304 Ga0466967_0600954 3300045976 Unclassified 1086
305 Ga0466967_1557023 3300045976 Unclassified 658
306 Ga0466967_1883765 3300045976 Bacteria 595
307 Ga0495592_0027392 3300046454 Bacteria 4321
308 Ga0495592_0196310 3300046454 Bacteria 1365
309 Ga0495629_0006077 3300046459 Bacteria 8970
310 Ga0495651_0554093 3300046462 Bacteria 730
311 Ga0495653_0127143 3300046463 Bacteria 1808
312 Ga0495580_0083316 3300046472 Bacteria 2228
313 Ga0495639_0027670 3300046475 Bacteria 2511
314 Ga0495662_0006051 3300046476 Bacteria 6045
315 Ga0495662_0074666 3300046476 Bacteria 1645
316 Ga0495664_0000144 3300046477 Bacteria 35748
317 Ga0495594_0326827 3300046499 Bacteria 873
318 Ga0495618_0003392 3300046514 Bacteria 9914
319 Ga0495618_0022266 3300046514 Bacteria 3914
320 Ga0495628_0274571 3300046516 Bacteria 1253
321 Ga0495630_0035283 3300046517 Bacteria 3737
322 Ga0495652_0042897 3300046529 Bacteria 3899
323 Ga0495665_0042361 3300046531 Bacteria 2423
324 Ga0495640_0003832 3300046533 Bacteria 12071
325 Ga0495587_0512124 3300046536 Bacteria 663
326 Ga0495645_0002881 3300046543 Bacteria 11681
327 Ga0495645_0467324 3300046543 Unclassified 793
328 Ga0495667_0020550 3300046559 Bacteria 4454
329 Ga0495667_0131243 3300046559 Bacteria 1616
330 Ga0495634_0002694 3300046642 Bacteria 14601
331 Ga0495634_0093406 3300046642 Bacteria 1951
332 Ga0495635_0001658 3300046663 Bacteria 14993
333 Ga0495635_0014150 3300046663 Bacteria 5583
334 Ga0495599_0151494 3300046678 Bacteria 1436
335 Ga0495599_0376138 3300046678 Bacteria 848
336 Ga0495646_0028324 3300046680 Bacteria 3509
337 Ga0495647_0465486 3300046681 Bacteria 586
338 Ga0495613_0482965 3300046689 Bacteria 836
339 Ga0495624_0163452 3300046690 Bacteria 1359
340 Ga0495600_0046510 3300046809 Bacteria 2831
341 Ga0495581_0152240 3300047315 Bacteria 1351
342 Ga0495604_0278971 3300047317 Bacteria 1130
343 Ga0495674_0000899 3300047319 Bacteria 28421
344 Ga0495680_0184216 3300047322 Bacteria 1505
345 Ga0495684_0003351 3300047471 Bacteria 12580
346 Ga0496100_0173499 3300048903 Bacteria 1555
347 Ga0496104_0448938 3300048907 Bacteria 1201
348 Ga0496105_0533787 3300048908 Unclassified 918
349 Ga0496106_0043834 3300048909 Bacteria 3358
350 Ga0496106_0322499 3300048909 Bacteria 1240
351 Ga0496108_0846911 3300048911 Unclassified 787
352 Ga0496109_0470681 3300048912 Unclassified 1187
353 Ga0496110_0157160 3300048913 Bacteria 2060
354 Ga0496110_0594711 3300048913 Bacteria 1004
355 Ga0496110_0597600 3300048913 Bacteria 1001
356 Ga0496110_0927028 3300048913 Unclassified 777
357 Ga0496112_0091282 3300048915 Bacteria 3015
358 Ga0496112_1005731 3300048915 Bacteria 753
359 Ga0496115_0039955 3300048918 Bacteria 3728
360 Ga0496115_0302961 3300048918 Bacteria 1309
361 Ga0496119_0004337 3300048922 Bacteria 14160
362 Ga0501047_0245012 3300049581 Bacteria 1642
363 Ga0501083_0060224 3300049744 Bacteria 2537
364 nmdc:mga0yw44_153179_c1 3300050492 Bacteria 1505
365 nmdc:mga0yw44_310611_c1 3300050492 Bacteria 1058
366 nmdc:mga0k408_450866_c1 3300050493 Bacteria 764
367 nmdc:mga0k408_64674_c1 3300050493 Bacteria 2129
368 nmdc:mga0k408_892584_c1 3300050493 Bacteria 516
369 nmdc:mga07m45_208224_c1 3300050496 Bacteria 1138
370 nmdc:mga05p37_1231234_c1 3300050507 Bacteria 770
371 nmdc:mga05p37_1811805_c1 3300050507 Bacteria 588
372 nmdc:mga05p37_329649_c1 3300050507 Bacteria 1804
373 nmdc:mga05p37_408540_c1 3300050507 Bacteria 1583
374 nmdc:mga05p37_579831_c1 3300050507 Bacteria 1270
375 nmdc:mga05p37_671455_c1 3300050507 Unclassified 1157
376 nmdc:mga09592_347111_c1 3300050508 Bacteria 1285
377 nmdc:mga06r32_141924_c1 3300050510 Bacteria 2379
378 nmdc:mga08y16_174983_c1 3300050511 Bacteria 2229
379 nmdc:mga08y16_341494_c1 3300050511 Bacteria 1539
380 nmdc:mga08y16_396813_c1 3300050511 Bacteria 1412
381 nmdc:mga08y16_61989_c1 3300050511 Bacteria 3905
382 nmdc:mga0n895_1132713_c1 3300050512 Unclassified 759
383 nmdc:mga0n895_274219_c1 3300050512 Bacteria 1711
384 nmdc:mga0n895_38860_c1 3300050512 Bacteria 4613
385 nmdc:mga0n895_860343_c1 3300050512 Unclassified 894
386 nmdc:mga0n895_9197_c1 3300050512 Bacteria 8631
387 nmdc:mga0rr50_12844_c1 3300050513 Bacteria 5428
388 nmdc:mga08x19_28023_c1 3300050514 Bacteria 3526
389 nmdc:mga0a205_105893_c1 3300050515 Bacteria 2711
390 nmdc:mga0sz30_213881_c1 3300050516 Bacteria 857
391 Ga0495601_0001757 3300053077 Bacteria 11999
392 Ga0495601_0005299 3300053077 Bacteria 7505
393 Ga0495595_0013615 3300053084 Bacteria 3438
394 Ga0495619_0000587 3300053085 Bacteria 24241
395 Ga0495619_0012948 3300053085 Bacteria 5254
396 Ga0495619_0344692 3300053085 Bacteria 1031
397 Ga0500594_0023594 3300053118 Bacteria 1561
398 Ga0500642_0003725 3300053130 Bacteria 4659
399 Ga0501082_0344730 3300060353 Bacteria 1298
400 2882461786 2882456835 Bacteria 6863978
401 Ga0070709_10260997
402 rootH1_10312643
403 Ga0070683_101270048
404 Ga0070682_100223353
405 Ga0070689_100649001
406 Ga0070668_100549575
407 Ga0070671_100231256
408 Ga0070673_100978916
409 Ga0070659_100807833
410 Ga0070709_10097317
411 Ga0070709_10223151
412 Ga0070709_10263804
413 Ga0070709_10663126
414 Ga0070714_100026541
415 Ga0070714_100063633
416 Ga0070714_100125215
417 Ga0070714_100814645
418 Ga0070714_100919776
419 Ga0070714_101213476
420 Ga0070714_101471397
421 Ga0070713_100026389
422 Ga0070713_100090506
423 Ga0070713_100199140
424 Ga0070713_100723034
425 Ga0070710_10202697
426 Ga0070710_10282365
427 Ga0070710_10448026
428 Ga0070711_100303757
429 Ga0070711_100643358
430 Ga0070711_101221997
431 Ga0070708_100873233
432 Ga0070678_100975190
433 Ga0070662_100225464
434 Ga0070681_10124538
435 Ga0070681_11407726
436 Ga0070685_10671425
437 Ga0070685_11027425
438 Ga0070706_100107792
439 Ga0070706_100763845
440 Ga0070707_100010901
441 Ga0070707_100224806
442 Ga0070707_100271930
443 Ga0070698_100197381
444 Ga0070698_100374966
445 Ga0070699_100633709
446 Ga0070699_100803377
447 Ga0070679_100741332
448 Ga0070679_100941719
449 Ga0070684_101487624
450 Ga0070697_100419764
451 Ga0070686_100250149
452 Ga0070696_100652193
453 Ga0070693_100361677
454 Ga0068855_100290091
455 Ga0070664_100289966
456 Ga0070664_101022837
457 Ga0068857_101296966
458 Ga0068856_100705560
459 Ga0068856_102247443
460 Ga0070702_101653807
461 Ga0068858_100282682
462 Ga0068858_102106885
463 Ga0068860_100472002
464 Ga0081455_10073110
465 Ga0081455_10184899
466 Ga0081455_10205376
467 Ga0081540_1028687
468 Ga0070717_10060311
469 Ga0070717_10123844
470 Ga0070717_10172657
471 Ga0070717_10217569
472 Ga0070717_10334161
473 Ga0070717_10367062
474 Ga0070717_10551217
475 Ga0075365_10133365
476 Ga0075368_10065667
477 Ga0070716_100191487
478 Ga0070716_100668631
479 Ga0070716_100861958
480 Ga0070716_101136437
481 Ga0070712_100073185
482 Ga0070712_100085621
483 Ga0070712_100151459
484 Ga0070712_100299707
485 Ga0070712_100318638
486 Ga0070712_100406388
487 Ga0070712_100439041
488 Ga0070712_100508059
489 Ga0070712_100694923
490 Ga0075362_10278847
491 Ga0075367_10056540
492 Ga0075369_10005637
493 Ga0075369_10034035
494 Ga0075366_10029828
495 Ga0075366_10256551
496 Ga0075430_100036232
497 Ga0075430_100849138
498 Ga0075431_100120240
499 Ga0075431_100304716
500 Ga0075433_10069258
501 Ga0075433_10310106
502 Ga0075434_100063081
503 Ga0075434_100196802
504 Ga0075434_100212234
505 Ga0075434_100917787
506 Ga0075429_100040776
507 Ga0068865_100584364
508 Ga0075436_100950043
509 Ga0075435_100047591
510 Ga0075435_100054467
511 Ga0075435_100077169
512 Ga0075435_100849144
513 Ga0099794_10128214
514 Ga0099794_10229845
515 Ga0099795_10041507
516 Ga0099795_10074526
517 Ga0099795_10257517
518 Ga0099795_10382721
519 Ga0111539_10134794
520 Ga0111539_10189217
521 Ga0111539_10205623
522 Ga0111539_10281366
523 Ga0105245_11298195
524 Ga0114129_10335770
525 Ga0105243_10819019
526 Ga0105242_10359919
527 Ga0105248_10973988
528 Ga0105248_11441352
529 Ga0105238_10777078
530 Ga0099796_10098014
531 Ga0105239_12202225
532 Ga0105239_12867252
533 Ga0157370_11117454
534 Ga0157378_10344957
535 Ga0163162_10350824
536 Ga0163162_11276425
537 Ga0157375_10395293
538 Ga0157375_10540749
539 Ga0157375_12287174
540 Ga0157375_12645727
541 Ga0157380_11605899
542 Ga0182008_10037555
543 Ga0157377_10636276
544 Ga0157379_10265066
545 Ga0157379_10801981
546 Ga0182007_10054864
547 Ga0213874_10090749
548 Ga0213876_10011611
549 Ga0213876_10141080
550 Ga0213876_10152052
551 Ga0213876_10288396
552 Ga0213876_10293190
553 Ga0213875_10000206
554 Ga0213875_10000863
555 Ga0213875_10002256
556 Ga0213875_10005454
557 Ga0213875_10039185
558 Ga0213875_10201732
559 Ga0213875_10378648
560 Ga0213871_10147828
561 Ga0228598_1039961
562 Ga0207692_10103987
563 Ga0207692_10172721
564 Ga0207692_10211538
565 Ga0207692_10212335
566 Ga0207642_10594051
567 Ga0207688_10020240
568 Ga0207680_10487654
569 Ga0207685_10002938
570 Ga0207699_10023764
571 Ga0207699_10042915
572 Ga0207699_10091740
573 Ga0207699_10278086
574 Ga0207699_10341162
575 Ga0207684_10021638
576 Ga0207684_10165836
577 Ga0207684_10475318
578 Ga0207695_10218484
579 Ga0207671_10150008
580 Ga0207693_10018645
581 Ga0207693_10034518
582 Ga0207693_10044184
583 Ga0207693_10052910
584 Ga0207693_10355027
585 Ga0207693_10867990
586 Ga0207663_10124240
587 Ga0207663_10229798
588 Ga0207652_10412137
589 Ga0207646_10024085
590 Ga0207646_10143888
591 Ga0207646_10222002
592 Ga0207646_10714185
593 Ga0207681_10464061
594 Ga0207694_10530780
595 Ga0207700_10007928
596 Ga0207700_10055029
597 Ga0207700_10109176
598 Ga0207700_10174513
599 Ga0207700_10184603
600 Ga0207664_10070791
601 Ga0207664_10074725
602 Ga0207664_10213749
603 Ga0207644_10227097
604 Ga0207644_11044654
605 Ga0207706_10394967
606 Ga0207670_11189662
607 Ga0207704_10116407
608 Ga0207665_10159027
609 Ga0207665_10710431
610 Ga0207689_10703206
611 Ga0207661_10122807
612 Ga0207679_10596022
613 Ga0207667_11050967
614 Ga0207668_10662160
615 Ga0207640_10276951
616 Ga0207677_10638391
617 Ga0207708_10253745
618 Ga0207648_10052358
619 Ga0207676_10371355
620 Ga0207674_10666935
621 Ga0207674_10840321
622 Ga0207675_100030571
623 Ga0207675_100716730
624 Ga0207698_11188761
625 Ga0209179_1023538
626 Ga0209588_1066156
627 Ga0209813_10014960
628 Ga0207428_10106028
629 Ga0265357_1001222
630 Ga0265357_1002800
631 Ga0268265_10989343
632 Ga0268265_11282256
633 Ga0268265_11455958
634 Ga0265325_10131726
635 Ga0307509_10453449
636 Ga0307408_100922100
637 Ga0307408_101071275
638 Ga0307407_10831054
639 Ga0307412_10609369
640 Ga0307411_10891794
641 Ga0373926_0177972
642 Ga0373923_0122425
643 Ga0373923_0234229
644 Ga0373936_0224322
645 Ga0373945_0038335
646 Ga0373953_0062915
647 Ga0373954_0189994
648 Ga0373956_0049639
649 Ga0373957_0114552
650 Ga0373957_0150615
651 Ga0373943_0014271
652 Ga0373943_0283391
653 Ga0373946_0312738
654 Ga0373955_0044043
655 Ga0373924_0243451
656 Ga0373931_0080015
657 Ga0373931_0535143
658 Ga0373935_0020486
659 Ga0373927_0403882
660 Ga0373927_0653606
661 Ga0373927_0725915
662 Ga0373947_0005121
663 Ga0373947_0441201
664 Ga0373937_0026847
665 Ga0373937_0156912
666 Ga0373925_0056916
667 Ga0373925_0140259
668 Ga0373925_0345406
669 Ga0395905_0708113
670 Ga0436364_0004067
671 Ga0436364_0045510
672 Ga0436364_0113620
673 Ga0436364_0323946
674 Ga0436364_0517726
675 Ga0436364_0607465
676 Ga0436364_0935620
677 Ga0436364_0940234
678 Ga0436364_1310776
679 Ga0436364_1336668
680 Ga0436365_0110577
681 Ga0436365_0347443
682 Ga0436365_0348905
683 Ga0436365_0414675
684 Ga0436365_0545145
685 Ga0436365_0753793
686 Ga0436365_0975732
687 Ga0436365_1353345
688 Ga0436365_1587337
689 Ga0436360_0177542
690 Ga0436360_0457460
691 Ga0436360_0958774
692 Ga0436361_0334357
693 Ga0436361_0528170
694 Ga0436361_0783815
695 Ga0436363_0295539
696 Ga0436363_0341835
697 Ga0436363_1446016
698 Ga0436363_1679020
699 Ga0436362_0032733
700 Ga0436362_0166111
701 Ga0436362_0915299
702 Ga0466966_0213420
703 Ga0466963_0864118
704 Ga0466967_0600954
705 Ga0466967_1557023
706 Ga0466967_1883765
707 Ga0495592_0027392
708 Ga0495592_0196310
709 Ga0495629_0006077
710 Ga0495651_0554093
711 Ga0495653_0127143
712 Ga0495580_0083316
713 Ga0495639_0027670
714 Ga0495662_0006051
715 Ga0495662_0074666
716 Ga0495664_0000144
717 Ga0495594_0326827
718 Ga0495618_0003392
719 Ga0495618_0022266
720 Ga0495628_0274571
721 Ga0495630_0035283
722 Ga0495652_0042897
723 Ga0495665_0042361
724 Ga0495640_0003832
725 Ga0495587_0512124
726 Ga0495645_0002881
727 Ga0495645_0467324
728 Ga0495667_0020550
729 Ga0495667_0131243
730 Ga0495634_0002694
731 Ga0495634_0093406
732 Ga0495635_0001658
733 Ga0495635_0014150
734 Ga0495599_0151494
735 Ga0495599_0376138
736 Ga0495646_0028324
737 Ga0495647_0465486
738 Ga0495613_0482965
739 Ga0495624_0163452
740 Ga0495600_0046510
741 Ga0495581_0152240
742 Ga0495604_0278971
743 Ga0495674_0000899
744 Ga0495680_0184216
745 Ga0495684_0003351
746 Ga0496100_0173499
747 Ga0496104_0448938
748 Ga0496105_0533787
749 Ga0496106_0043834
750 Ga0496106_0322499
751 Ga0496108_0846911
752 Ga0496109_0470681
753 Ga0496110_0157160
754 Ga0496110_0594711
755 Ga0496110_0597600
756 Ga0496110_0927028
757 Ga0496112_0091282
758 Ga0496112_1005731
759 Ga0496115_0039955
760 Ga0496115_0302961
761 Ga0496119_0004337
762 Ga0501047_0245012
763 Ga0501083_0060224
764 nmdc:mga0yw44_153179_c1
765 nmdc:mga0yw44_310611_c1
766 nmdc:mga0k408_450866_c1
767 nmdc:mga0k408_64674_c1
768 nmdc:mga0k408_892584_c1
769 nmdc:mga07m45_208224_c1
770 nmdc:mga05p37_1231234_c1
771 nmdc:mga05p37_1811805_c1
772 nmdc:mga05p37_329649_c1
773 nmdc:mga05p37_408540_c1
774 nmdc:mga05p37_579831_c1
775 nmdc:mga05p37_671455_c1
776 nmdc:mga09592_347111_c1
777 nmdc:mga06r32_141924_c1
778 nmdc:mga08y16_174983_c1
779 nmdc:mga08y16_341494_c1
780 nmdc:mga08y16_396813_c1
781 nmdc:mga08y16_61989_c1
782 nmdc:mga0n895_1132713_c1
783 nmdc:mga0n895_274219_c1
784 nmdc:mga0n895_38860_c1
785 nmdc:mga0n895_860343_c1
786 nmdc:mga0n895_9197_c1
787 nmdc:mga0rr50_12844_c1
788 nmdc:mga08x19_28023_c1
789 nmdc:mga0a205_105893_c1
790 nmdc:mga0sz30_213881_c1
791 Ga0495601_0001757
792 Ga0495601_0005299
793 Ga0495595_0013615
794 Ga0495619_0000587
795 Ga0495619_0012948
796 Ga0495619_0344692
797 Ga0500594_0023594
798 Ga0500642_0003725
799 Ga0501082_0344730
800 2882461786

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12802

MarR_2

MarR family

64

123

0.98

PF01047

MarR

MarR family

66

123

0.97

PF13412

HTH_24

Winged helix-turn-helix DNA-binding

66

113

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6c28-assembly2.cif.gz_B transcriptional repressor, cour, bound to p-coumaroyl-coa 0.9199 10 141
6c28-assembly3.cif.gz_A transcriptional repressor, cour, bound to p-coumaroyl-coa 0.9196 10 141
5duk-assembly1.cif.gz_A n-terminal structure of putative dna binding transcription factor from thermoplasmatales archaeon scgc ab-539-n05 0.9195 39 90
4kmf-assembly1.cif.gz_A-2 crystal structure of zalpha domain from carassius auratus pkz in complex with z-dna 0.9183 41 100
6c2s-assembly2.cif.gz_C transcriptional repressor, cour, bound to a 23-mer dna duplex 0.9155 10 141
ID Description Score Start End Superfamily
af_Q58948_3_81_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9394 37 109 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9356 37 98 1.10.10.10
4kmfA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9183 41 100 1.10.10.10
4lb5A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9126 39 100 1.10.10.10
af_Q57693_7_69_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9112 42 108 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1N7S3I9-F1-model_v4 Transcriptional regulator, MarR family 0.9769 7 140 GO:0003700
AF-A0A0G9HIS4-F1-model_v4 Uncharacterized protein 0.9754 8 140 GO:0003700
GO:0006950
AF-A0A317HNL8-F1-model_v4 deleted 0.9744 8 147
AF-A0A1H0N707-F1-model_v4 Transcriptional regulator, MarR family 0.9709 10 140 GO:0003700
GO:0006950
AF-A0A2A4WX90-F1-model_v4 MarR family transcriptional regulator 0.9685 10 141 GO:0003700
GO:0006950

Map