F434317

General Info

Members Datasets Scaffolds Average Seq Length
399 221 798 784

Family's Representative Sequence

Representative Sequence 3300026078|Ga0207702_10016770|Ga0207702_100167702
Length 829
Sequence MGAAAAGMTAHAPDLLEVPAPERVLGRPVLRSEDRALLTGAARYLDDVACEGALHGVFVRSPMAHALVRSVDADEARAMPGVVGVFAAGDLGGLRMPPVEDSPEVFARPLLAIDRVRFVGEPVAVVVAQTRAQAVDAADAVAVDYEPLAPVIDPEKALXXXXPVLFPAHGSNLAIRVDDVAEDPSALEGAEIVMRARFVNQRVAPVPMEPNGALAIAGAGASQSSVTLWASVQAPHDTRRVVAQVLGLDPGQVRVRTAAVGGGFGGKIPTYPEHVVIAWLARHMGSAVRWSETRNENMLAMTHGRAQVQHVELGATLDGRMLGLRVFVIQDIGAYASEAATLPPLTGLMASGPYRIPRIDFHAVSVVTTTTPVGAYRGAGRPEATWLLERALDMLAAELGIDPAEIRRRNFIPPEAFPYRTPSGANYDSGDPGRALDIALHAAGYAELRQEQAARIGRGETCQLGIGICSYVEVTGWGSEFASVDADDQGTFTVLTGTSPQGQGHETAWAQIVADTLGVSFDAVTVRHSDTLLVPRGEGTMGSRSLQVGGSAVLRASLALLDKARRLAAHLLGTSESDIRRLDGRIGVGGAPELSLSWAELAAAAADPSSLPRGMETGLRAQNDFEMEDSTYPFGAHIAVVEVDTETGKVKLVRHVAVDDCGRRINPMLVDGQIHGGIAQGAAQALFESFVYDELGNPLTSSLATYAMPSAAELPSFVTVPLATPTARNPLGAKGVGEGGTIGAGPAVHNAVIDALSHLGIRHIDMPMSPDRVWLAISDAQRGGPGGXXXDSEKGEAHGAAGPEWFDRGDRHTHVERHVDRRGVPPRIR

Samples

Sample ID Description Type Environment
1 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
64 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
94 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
95 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
96 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
97 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
98 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
99 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
100 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
101 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
102 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
103 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
104 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
105 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
106 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
107 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
108 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
109 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
110 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
111 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
112 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
113 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
120 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
121 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
122 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
123 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
124 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
125 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
126 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
127 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
128 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
129 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
130 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
131 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
132 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
133 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
134 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
135 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
136 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
137 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
138 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
139 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
140 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
141 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
142 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
143 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
144 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
145 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
146 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
147 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
148 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
149 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
150 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
151 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
152 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
153 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
154 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
155 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
156 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
157 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
158 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
159 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
160 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
161 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
162 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
163 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
164 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
178 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
179 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
180 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
190 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
191 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
192 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
193 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
194 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
195 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
196 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
197 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
198 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
199 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
200 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
201 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
202 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
203 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
205 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
206 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
207 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
208 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
209 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
210 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
211 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
212 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
213 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
214 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
215 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
216 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
217 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
218 2582580736 Prauserella sp. Am3 Isolate Unclassified
219 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
220 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
221 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber

Type Distribution

Type Percentage (%)
Metagenomes 97.74
Metatranscriptomes 1.25
Isolates 1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.51
Nodule 0
Rhizoplane 14.04
Rhizosphere 82.46
Stem 0
Stem Tuber 0.25
Unclassified 0.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207702_10016770 3300026078 Bacteria 6064
2 JGI25407J50210_10002830 3300003373 Bacteria 4130
3 Ga0070658_10032587 3300005327 Bacteria 4190
4 Ga0070683_100016967 3300005329 Bacteria 6426
5 Ga0068869_100040458 3300005334 Bacteria 3333
6 Ga0070680_100008438 3300005336 Bacteria 7888
7 Ga0070680_100067542 3300005336 Bacteria 2933
8 Ga0070682_100043562 3300005337 Bacteria 2776
9 Ga0068868_100030010 3300005338 Bacteria 4168
10 Ga0070660_100048942 3300005339 Bacteria 3248
11 Ga0070689_100001758 3300005340 Bacteria 13878
12 Ga0070661_100036510 3300005344 Bacteria 3572
13 Ga0070671_100003857 3300005355 Bacteria 11786
14 Ga0070688_100000549 3300005365 Bacteria 18957
15 Ga0070659_100001980 3300005366 Bacteria 14632
16 Ga0070667_100021381 3300005367 Bacteria 5373
17 Ga0070709_10000191 3300005434 Bacteria 39021
18 Ga0070714_100017995 3300005435 Bacteria 5731
19 Ga0070714_100029410 3300005435 Bacteria 4568
20 Ga0070713_100022344 3300005436 Bacteria 4888
21 Ga0070710_10010727 3300005437 Bacteria 4504
22 Ga0070708_100006731 3300005445 Bacteria 9154
23 Ga0070707_100014995 3300005468 Bacteria 7273
24 Ga0070707_100075978 3300005468 Bacteria 3241
25 Ga0070699_100060301 3300005518 Bacteria 3288
26 Ga0070672_100029636 3300005543 Bacteria 4105
27 Ga0070665_100024809 3300005548 Bacteria 6041
28 Ga0068856_100010986 3300005614 Bacteria 8793
29 Ga0068856_100067453 3300005614 Bacteria 3535
30 Ga0068864_100071803 3300005618 Bacteria 3015
31 Ga0068861_100027357 3300005719 Bacteria 4152
32 Ga0068858_100038660 3300005842 Bacteria 4426
33 Ga0081455_10001786 3300005937 Bacteria 25985
34 Ga0081455_10003399 3300005937 Bacteria 18319
35 Ga0081455_10005039 3300005937 Bacteria 14596
36 Ga0081455_10023415 3300005937 Bacteria 5746
37 Ga0081455_10036836 3300005937 Bacteria 4350
38 Ga0081455_10041242 3300005937 Bacteria 4061
39 Ga0081538_10003381 3300005981 Bacteria 15101
40 Ga0081540_1003034 3300005983 Bacteria 13457
41 Ga0081539_10005118 3300005985 Bacteria 13704
42 Ga0070717_10026388 3300006028 Bacteria 4633
43 Ga0075365_10003436 3300006038 Bacteria 8156
44 Ga0075365_10010181 3300006038 Bacteria 5461
45 Ga0075368_10000469 3300006042 Bacteria 11968
46 Ga0075363_100004552 3300006048 Bacteria 6081
47 Ga0075364_10014425 3300006051 Bacteria 4883
48 Ga0070715_10002105 3300006163 Bacteria 6018
49 Ga0070716_100013707 3300006173 Bacteria 4137
50 Ga0070712_100005214 3300006175 Bacteria 8037
51 Ga0070712_100007929 3300006175 Bacteria 6656
52 Ga0075367_10030029 3300006178 Bacteria 3113
53 Ga0097621_100025407 3300006237 Bacteria 4635
54 Ga0075428_100028606 3300006844 Bacteria 6166
55 Ga0075428_100068321 3300006844 Bacteria 3887
56 Ga0075433_10019810 3300006852 Bacteria 5614
57 Ga0075434_100014605 3300006871 Bacteria 7512
58 Ga0075434_100015801 3300006871 Bacteria 7246
59 Ga0075434_100117402 3300006871 Bacteria 2674
60 Ga0075436_100028194 3300006914 Bacteria 3863
61 Ga0075435_100007941 3300007076 Bacteria 7593
62 Ga0075435_100009999 3300007076 Bacteria 6916
63 Ga0105245_10036631 3300009098 Bacteria 4359
64 Ga0114129_10010887 3300009147 Bacteria 12956
65 Ga0114129_10036563 3300009147 Bacteria 6933
66 Ga0105248_10012248 3300009177 Bacteria 9458
67 Ga0105239_10038818 3300010375 Bacteria 5217
68 Ga0157370_10047415 3300013104 Bacteria 4119
69 Ga0157370_10079208 3300013104 Bacteria 3094
70 Ga0157369_10088189 3300013105 Bacteria 3311
71 Ga0157374_10005657 3300013296 Bacteria 10539
72 Ga0163162_10005964 3300013306 Bacteria 11799
73 Ga0157372_10005705 3300013307 Bacteria 13249
74 Ga0157375_10093144 3300013308 Bacteria 3078
75 Ga0163163_10003649 3300014325 Bacteria 13086
76 Ga0163163_10008170 3300014325 Bacteria 9282
77 Ga0163163_10038785 3300014325 Bacteria 4644
78 Ga0157380_10066758 3300014326 Bacteria 2894
79 Ga0182008_10006843 3300014497 Bacteria 6344
80 Ga0157379_10032715 3300014968 Bacteria 4637
81 Ga0157376_10014405 3300014969 Bacteria 5936
82 Ga0182007_10007092 3300015262 Bacteria 4742
83 Ga0197907_10249437 3300020069 Bacteria 4300
84 Ga0206353_10277694 3300020082 Bacteria 4990
85 Ga0206353_11360495 3300020082 Bacteria 2872
86 Ga0224712_10000920 3300022467 Bacteria 6328
87 Ga0224712_10001265 3300022467 Bacteria 5720
88 Ga0207653_10014129 3300025885 Bacteria 2504
89 Ga0207692_10004908 3300025898 Bacteria 5325
90 Ga0207699_10000074 3300025906 Bacteria 80162
91 Ga0207699_10030681 3300025906 Bacteria 3011
92 Ga0207684_10045495 3300025910 Bacteria 3722
93 Ga0207693_10003962 3300025915 Bacteria 12583
94 Ga0207693_10004792 3300025915 Bacteria 11378
95 Ga0207693_10006807 3300025915 Bacteria 9440
96 Ga0207663_10013169 3300025916 Bacteria 4489
97 Ga0207662_10002708 3300025918 Bacteria 8943
98 Ga0207657_10031699 3300025919 Bacteria 4783
99 Ga0207649_10019848 3300025920 Bacteria 3847
100 Ga0207652_10078767 3300025921 Bacteria 2878
101 Ga0207646_10002271 3300025922 Bacteria 22863
102 Ga0207646_10018823 3300025922 Bacteria 6432
103 Ga0207700_10007134 3300025928 Bacteria 6810
104 Ga0207700_10017640 3300025928 Bacteria 4773
105 Ga0207664_10003154 3300025929 Bacteria 10948
106 Ga0207664_10010612 3300025929 Bacteria 6511
107 Ga0207664_10015969 3300025929 Bacteria 5468
108 Ga0207664_10042141 3300025929 Bacteria 3562
109 Ga0207670_10000441 3300025936 Bacteria 23238
110 Ga0207670_10005279 3300025936 Bacteria 7072
111 Ga0207669_10008295 3300025937 Bacteria 4867
112 Ga0207665_10008325 3300025939 Bacteria 6843
113 Ga0207691_10078828 3300025940 Bacteria 2965
114 Ga0207661_10024174 3300025944 Bacteria 4601
115 Ga0207712_10019025 3300025961 Bacteria 4480
116 Ga0207703_10031990 3300026035 Bacteria 4161
117 Ga0207708_10006560 3300026075 Bacteria 8610
118 Ga0207708_10020122 3300026075 Bacteria 5032
119 Ga0207708_10081383 3300026075 Bacteria 2489
120 Ga0207702_10013127 3300026078 Bacteria 6888
121 Ga0207702_10087844 3300026078 Bacteria 2715
122 Ga0207641_10048896 3300026088 Bacteria 3572
123 Ga0207648_10003621 3300026089 Bacteria 16155
124 Ga0207648_10004306 3300026089 Bacteria 14661
125 Ga0207675_100030336 3300026118 Bacteria 5036
126 Ga0207675_100039789 3300026118 Bacteria 4388
127 Ga0207675_100042729 3300026118 Bacteria 4232
128 Ga0207675_100080174 3300026118 Bacteria 3060
129 Ga0207683_10010309 3300026121 Bacteria 7968
130 Ga0268265_10021564 3300028380 Bacteria 4516
131 Ga0265337_1002255 3300028556 Bacteria 8962
132 Ga0265338_10060769 3300028800 Bacteria 3317
133 Ga0265325_10000945 3300031241 Bacteria 20995
134 Ga0316576_10012597 3300031727 Bacteria 5594
135 Ga0316578_10011327 3300031728 Bacteria 4661
136 Ga0373948_0000561 3300034817 Bacteria 4709
137 Ga0373934_0000043 3300035086 Bacteria 41885
138 Ga0373934_0005064 3300035086 Bacteria 4882
139 Ga0373936_0006008 3300035113 Bacteria 4576
140 Ga0373953_0001795 3300035117 Bacteria 6340
141 Ga0373954_0002717 3300035118 Bacteria 7450
142 Ga0373956_0000321 3300035119 Bacteria 19382
143 Ga0373956_0003485 3300035119 Bacteria 6326
144 Ga0373957_0001885 3300035120 Bacteria 5825
145 Ga0373957_0002038 3300035120 Bacteria 5657
146 Ga0373955_0000089 3300035172 Bacteria 36959
147 Ga0373962_0001298 3300035242 Bacteria 5872
148 Ga0316574_0010069 3300035398 Bacteria 5323
149 Ga0316574_0014641 3300035398 Bacteria 4536
150 Ga0316574_0018003 3300035398 Bacteria 4144
151 Ga0373924_0000287 3300035410 Bacteria 15508
152 Ga0373927_0013851 3300035695 Bacteria 5352
153 Ga0373927_0031123 3300035695 Bacteria 3480
154 Ga0373933_0002445 3300035724 Bacteria 10466
155 Ga0373947_0017758 3300035725 Bacteria 4092
156 Ga0373947_0025258 3300035725 Bacteria 3464
157 Ga0373947_0039601 3300035725 Bacteria 2804
158 Ga0373937_0000021 3300036401 Bacteria 128447
159 Ga0373937_0011401 3300036401 Bacteria 7801
160 Ga0373937_0032928 3300036401 Bacteria 4703
161 Ga0373937_0036058 3300036401 Bacteria 4505
162 Ga0373937_0038350 3300036401 Bacteria 4365
163 Ga0316584_0008524 3300036712 Bacteria 7064
164 Ga0395899_0041070 3300037312 Bacteria 3457
165 Ga0395900_0003196 3300037418 Bacteria 17745
166 Ga0395900_0012174 3300037418 Bacteria 8794
167 Ga0395898_0002580 3300037466 Bacteria 21219
168 Ga0395905_0015909 3300037471 Bacteria 7147
169 Ga0395901_0003343 3300038443 Bacteria 16162
170 Ga0395901_0045674 3300038443 Bacteria 4547
171 Ga0395901_0053079 3300038443 Bacteria 4212
172 Ga0436365_0591272 3300039437 Bacteria 7227
173 Ga0436361_0904007 3300039447 Bacteria 10927
174 Ga0439463_004136 3300042016 Bacteria 3645
175 Ga0451577_0069489 3300042876 Bacteria 3141
176 Ga0466965_0011997 3300044683 Bacteria 4067
177 Ga0466971_0012845 3300044719 Bacteria 3672
178 Ga0466960_0001828 3300044901 Bacteria 7822
179 Ga0466960_0015574 3300044901 Bacteria 3280
180 Ga0466959_0004387 3300045049 Bacteria 9438
181 Ga0451576_0007953 3300045051 Bacteria 12545
182 Ga0466958_0018956 3300045836 Bacteria 4000
183 Ga0466967_0042674 3300045976 Bacteria 3921
184 Ga0466967_0074897 3300045976 Bacteria 3041
185 Ga0495592_0000013 3300046454 Bacteria 151780
186 Ga0495592_0000455 3300046454 Bacteria 30633
187 Ga0495641_0013214 3300046461 Bacteria 4554
188 Ga0495641_0017620 3300046461 Bacteria 3714
189 Ga0495651_0000022 3300046462 Bacteria 118601
190 Ga0495651_0000174 3300046462 Bacteria 47579
191 Ga0495651_0003527 3300046462 Bacteria 11990
192 Ga0495653_0011576 3300046463 Bacteria 7201
193 Ga0495653_0026138 3300046463 Bacteria 4685
194 Ga0495639_0018712 3300046475 Bacteria 3017
195 Ga0495662_0005693 3300046476 Bacteria 6228
196 Ga0495664_0016520 3300046477 Bacteria 4206
197 Ga0495584_0016589 3300046491 Bacteria 3756
198 Ga0495608_0000029 3300046511 Bacteria 151790
199 Ga0495608_0000410 3300046511 Bacteria 29942
200 Ga0495608_0010310 3300046511 Bacteria 6520
201 Ga0495608_0011293 3300046511 Bacteria 6218
202 Ga0495618_0006528 3300046514 Bacteria 7075
203 Ga0495618_0008040 3300046514 Bacteria 6385
204 Ga0495618_0028890 3300046514 Bacteria 3457
205 Ga0495628_0000444 3300046516 Bacteria 37801
206 Ga0495628_0014220 3300046516 Bacteria 6680
207 Ga0495630_0009791 3300046517 Bacteria 6899
208 Ga0495630_0015967 3300046517 Bacteria 5485
209 Ga0495652_0000412 3300046529 Bacteria 49856
210 Ga0495652_0000665 3300046529 Bacteria 39849
211 Ga0495652_0086781 3300046529 Unclassified 2568
212 Ga0495587_0000022 3300046536 Bacteria 151790
213 Ga0495587_0002570 3300046536 Bacteria 12130
214 Ga0495587_0002878 3300046536 Bacteria 11528
215 Ga0495645_0040777 3300046543 Bacteria 3385
216 Ga0495667_0000028 3300046559 Bacteria 151705
217 Ga0495667_0000117 3300046559 Bacteria 57725
218 Ga0495634_0001586 3300046642 Bacteria 19947
219 Ga0495634_0010383 3300046642 Bacteria 6823
220 Ga0495634_0015756 3300046642 Bacteria 5419
221 Ga0495635_0012324 3300046663 Bacteria 5990
222 Ga0495657_0000036 3300046675 Bacteria 118645
223 Ga0495657_0005088 3300046675 Bacteria 10445
224 Ga0495657_0010892 3300046675 Bacteria 6821
225 Ga0495657_0016770 3300046675 Bacteria 5327
226 Ga0495657_0064688 3300046675 Bacteria 2407
227 Ga0495599_0000131 3300046678 Bacteria 48587
228 Ga0495599_0000185 3300046678 Bacteria 40953
229 Ga0495623_0000084 3300046679 Bacteria 55932
230 Ga0495646_0000628 3300046680 Bacteria 19227
231 Ga0495646_0011748 3300046680 Bacteria 5567
232 Ga0495613_0033827 3300046689 Bacteria 3796
233 Ga0495624_0009475 3300046690 Bacteria 6745
234 Ga0495589_0009445 3300046794 Bacteria 5073
235 Ga0495600_0003721 3300046809 Bacteria 9017
236 Ga0495600_0007129 3300046809 Bacteria 6830
237 Ga0495600_0011309 3300046809 Bacteria 5560
238 Ga0495600_0033554 3300046809 Bacteria 3333
239 Ga0495581_0001882 3300047315 Bacteria 11739
240 Ga0495604_0000023 3300047317 Bacteria 151689
241 Ga0495604_0007397 3300047317 Bacteria 8703
242 Ga0495604_0009164 3300047317 Bacteria 7833
243 Ga0495604_0011340 3300047317 Bacteria 7073
244 Ga0495604_0037022 3300047317 Bacteria 3844
245 Ga0495674_0000984 3300047319 Bacteria 27406
246 Ga0495674_0011524 3300047319 Bacteria 8343
247 Ga0495674_0072858 3300047319 Bacteria 2962
248 Ga0495680_0000232 3300047322 Bacteria 60902
249 Ga0495680_0000401 3300047322 Bacteria 48480
250 Ga0495680_0015796 3300047322 Bacteria 6499
251 Ga0495680_0016951 3300047322 Bacteria 6239
252 Ga0495680_0032415 3300047322 Bacteria 4241
253 Ga0495675_0004505 3300047444 Bacteria 8442
254 Ga0495675_0007357 3300047444 Bacteria 6783
255 Ga0495675_0015400 3300047444 Bacteria 4836
256 Ga0495675_0019250 3300047444 Bacteria 4337
257 Ga0495684_0000598 3300047471 Bacteria 29035
258 Ga0495593_0009964 3300047673 Bacteria 5508
259 Ga0495593_0014576 3300047673 Bacteria 4467
260 Ga0495602_0000653 3300048088 Bacteria 32538
261 Ga0495602_0002949 3300048088 Bacteria 17454
262 Ga0495602_0022429 3300048088 Bacteria 6179
263 Ga0495602_0024323 3300048088 Bacteria 5877
264 Ga0496100_0011233 3300048903 Bacteria 5093
265 Ga0496100_0015360 3300048903 Bacteria 4470
266 Ga0496100_0016658 3300048903 Bacteria 4321
267 Ga0496100_0051546 3300048903 Bacteria 2672
268 Ga0496101_0003732 3300048904 Bacteria 9503
269 Ga0496101_0017613 3300048904 Bacteria 4846
270 Ga0496101_0046696 3300048904 Bacteria 3107
271 Ga0496102_0007511 3300048905 Bacteria 9320
272 Ga0496103_0018602 3300048906 Bacteria 4168
273 Ga0496104_0000538 3300048907 Bacteria 32550
274 Ga0496104_0000758 3300048907 Bacteria 27632
275 Ga0496104_0002501 3300048907 Bacteria 15818
276 Ga0496104_0003961 3300048907 Bacteria 12815
277 Ga0496104_0010918 3300048907 Bacteria 8124
278 Ga0496105_0002720 3300048908 Bacteria 12895
279 Ga0496105_0008861 3300048908 Bacteria 7839
280 Ga0496105_0018857 3300048908 Bacteria 5556
281 Ga0496105_0085510 3300048908 Bacteria 2606
282 Ga0496106_0018933 3300048909 Bacteria 5100
283 Ga0496106_0039631 3300048909 Bacteria 3528
284 Ga0496107_0013000 3300048910 Bacteria 5815
285 Ga0496107_0014339 3300048910 Bacteria 5549
286 Ga0496107_0036323 3300048910 Bacteria 3534
287 Ga0496108_0011503 3300048911 Bacteria 7192
288 Ga0496108_0016759 3300048911 Bacteria 5986
289 Ga0496108_0020404 3300048911 Bacteria 5447
290 Ga0496108_0048536 3300048911 Bacteria 3549
291 Ga0496108_0092938 3300048911 Bacteria 2565
292 Ga0496109_0006109 3300048912 Bacteria 10117
293 Ga0496109_0061978 3300048912 Bacteria 3420
294 Ga0496110_0002173 3300048913 Bacteria 14645
295 Ga0496110_0003248 3300048913 Bacteria 12392
296 Ga0496110_0004696 3300048913 Bacteria 10625
297 Ga0496111_0005195 3300048914 Bacteria 8303
298 Ga0496111_0008463 3300048914 Bacteria 6812
299 Ga0496111_0009228 3300048914 Bacteria 6573
300 Ga0496111_0033451 3300048914 Bacteria 3667
301 Ga0496111_0036634 3300048914 Bacteria 3508
302 Ga0496111_0041792 3300048914 Bacteria 3291
303 Ga0496112_0004951 3300048915 Bacteria 11408
304 Ga0496112_0008631 3300048915 Bacteria 9136
305 Ga0496112_0009733 3300048915 Bacteria 8677
306 Ga0496112_0015184 3300048915 Bacteria 7177
307 Ga0496112_0016859 3300048915 Bacteria 6855
308 Ga0496112_0033727 3300048915 Bacteria 4977
309 Ga0496112_0057112 3300048915 Bacteria 3842
310 Ga0496113_0013744 3300048916 Bacteria 5497
311 Ga0496113_0029994 3300048916 Bacteria 3933
312 Ga0496113_0055332 3300048916 Bacteria 2974
313 Ga0496114_0011132 3300048917 Bacteria 7181
314 Ga0496114_0011894 3300048917 Bacteria 6965
315 Ga0496114_0018534 3300048917 Bacteria 5629
316 Ga0496114_0028359 3300048917 Bacteria 4593
317 Ga0496115_0004379 3300048918 Bacteria 10227
318 Ga0496115_0018305 3300048918 Bacteria 5375
319 Ga0496115_0022111 3300048918 Bacteria 4921
320 Ga0501031_0008667 3300049568 Bacteria 6614
321 Ga0501031_0015216 3300049568 Bacteria 4996
322 Ga0501031_0044743 3300049568 Bacteria 2889
323 Ga0501033_0024486 3300049570 Bacteria 4553
324 Ga0501036_0005685 3300049572 Bacteria 10116
325 Ga0501036_0020581 3300049572 Bacteria 5541
326 Ga0501038_0022357 3300049574 Bacteria 5669
327 Ga0501039_0011637 3300049575 Bacteria 6700
328 Ga0501040_0004257 3300049576 Bacteria 9313
329 Ga0501040_0007486 3300049576 Bacteria 7068
330 Ga0501040_0013761 3300049576 Bacteria 5323
331 Ga0501042_0000110 3300049578 Bacteria 34194
332 Ga0501042_0016601 3300049578 Bacteria 5058
333 Ga0501042_0020258 3300049578 Bacteria 4628
334 Ga0501047_0023269 3300049581 Bacteria 5949
335 Ga0501048_0020746 3300049582 Bacteria 4816
336 Ga0501067_0008462 3300049583 Bacteria 5705
337 Ga0501068_0025126 3300049584 Bacteria 3503
338 Ga0501068_0038428 3300049584 Bacteria 2868
339 Ga0501069_0009645 3300049585 Bacteria 5100
340 Ga0501070_0014986 3300049586 Bacteria 6522
341 Ga0501071_0024384 3300049587 Bacteria 4232
342 Ga0501071_0028328 3300049587 Bacteria 3947
343 Ga0501072_0001265 3300049588 Bacteria 18877
344 Ga0501072_0024931 3300049588 Bacteria 4656
345 Ga0501074_0003252 3300049590 Bacteria 11478
346 Ga0501075_0005580 3300049591 Bacteria 8608
347 Ga0501075_0023350 3300049591 Bacteria 4527
348 Ga0501075_0027907 3300049591 Bacteria 4163
349 Ga0501075_0044111 3300049591 Bacteria 3345
350 Ga0501076_0018016 3300049592 Bacteria 5374
351 Ga0501076_0028591 3300049592 Bacteria 4329
352 Ga0501077_0001395 3300049593 Bacteria 14558
353 Ga0501079_0019951 3300049741 Bacteria 5121
354 Ga0501079_0024294 3300049741 Bacteria 4649
355 Ga0501080_0016433 3300049742 Bacteria 6833
356 Ga0501081_0006059 3300049743 Bacteria 7834
357 Ga0501081_0007981 3300049743 Bacteria 6869
358 Ga0501081_0013944 3300049743 Bacteria 5291
359 Ga0501083_0031434 3300049744 Bacteria 3644
360 Ga0501044_0008071 3300049823 Bacteria 11563
361 Ga0501045_0003320 3300049824 Bacteria 11003
362 Ga0501045_0011729 3300049824 Bacteria 6158
363 Ga0501045_0024430 3300049824 Bacteria 4338
364 nmdc:mga00v17_23202_c1 3300050491 Bacteria 3587
365 nmdc:mga00v17_26243_c1 3300050491 Bacteria 3393
366 nmdc:mga09592_27592_c1 3300050508 Bacteria 4713
367 nmdc:mga0n895_119798_c1 3300050512 Bacteria 2653
368 nmdc:mga0n895_34183_c1 3300050512 Bacteria 4892
369 nmdc:mga0n895_46115_c1 3300050512 Bacteria 4256
370 nmdc:mga0n895_67846_c1 3300050512 Bacteria 3533
371 nmdc:mga0rr50_14200_c1 3300050513 Bacteria 5216
372 nmdc:mga0rr50_29648_c1 3300050513 Unclassified 3863
373 nmdc:mga0a205_8249_c1 3300050515 Bacteria 9468
374 Ga0495601_0001504 3300053077 Bacteria 12850
375 Ga0495601_0047888 3300053077 Bacteria 2692
376 Ga0495595_0004210 3300053084 Bacteria 5786
377 Ga0495595_0005609 3300053084 Bacteria 5081
378 Ga0495619_0000941 3300053085 Bacteria 19078
379 Ga0495619_0006271 3300053085 Bacteria 7542
380 Ga0495619_0011941 3300053085 Bacteria 5471
381 Ga0495619_0015432 3300053085 Bacteria 4833
382 Ga0495619_0030337 3300053085 Bacteria 3500
383 Ga0500566_0001288 3300053094 Bacteria 14638
384 Ga0500616_0001120 3300053153 Bacteria 27623
385 Ga0501084_0000053 3300054114 Bacteria 91174
386 Ga0501084_0021429 3300054114 Bacteria 5385
387 Ga0501084_0026301 3300054114 Bacteria 4854
388 Ga0501082_0008990 3300060353 Bacteria 8620
389 Ga0501082_0026323 3300060353 Bacteria 5011
390 Ga0501082_0066113 3300060353 Bacteria 3113
391 Ga0530510_0002361 3300061734 Bacteria 12961
392 Ga0530510_0004930 3300061734 Bacteria 9217
393 Ga0530510_0008565 3300061734 Bacteria 7142
394 Ga0530510_0012302 3300061734 Bacteria 6010
395 Ga0530510_0027013 3300061734 Bacteria 4111
396 2583149248 2582580736 Bacteria 5325865
397 2795785361 2795385470 Bacteria 8317180
398 2867307298 2867302475 Bacteria 7087181
399 2899374838 2899370129 Bacteria 6781179
400 Ga0207702_10016770
401 JGI25407J50210_10002830
402 Ga0070658_10032587
403 Ga0070683_100016967
404 Ga0068869_100040458
405 Ga0070680_100008438
406 Ga0070680_100067542
407 Ga0070682_100043562
408 Ga0068868_100030010
409 Ga0070660_100048942
410 Ga0070689_100001758
411 Ga0070661_100036510
412 Ga0070671_100003857
413 Ga0070688_100000549
414 Ga0070659_100001980
415 Ga0070667_100021381
416 Ga0070709_10000191
417 Ga0070714_100017995
418 Ga0070714_100029410
419 Ga0070713_100022344
420 Ga0070710_10010727
421 Ga0070708_100006731
422 Ga0070707_100014995
423 Ga0070707_100075978
424 Ga0070699_100060301
425 Ga0070672_100029636
426 Ga0070665_100024809
427 Ga0068856_100010986
428 Ga0068856_100067453
429 Ga0068864_100071803
430 Ga0068861_100027357
431 Ga0068858_100038660
432 Ga0081455_10001786
433 Ga0081455_10003399
434 Ga0081455_10005039
435 Ga0081455_10023415
436 Ga0081455_10036836
437 Ga0081455_10041242
438 Ga0081538_10003381
439 Ga0081540_1003034
440 Ga0081539_10005118
441 Ga0070717_10026388
442 Ga0075365_10003436
443 Ga0075365_10010181
444 Ga0075368_10000469
445 Ga0075363_100004552
446 Ga0075364_10014425
447 Ga0070715_10002105
448 Ga0070716_100013707
449 Ga0070712_100005214
450 Ga0070712_100007929
451 Ga0075367_10030029
452 Ga0097621_100025407
453 Ga0075428_100028606
454 Ga0075428_100068321
455 Ga0075433_10019810
456 Ga0075434_100014605
457 Ga0075434_100015801
458 Ga0075434_100117402
459 Ga0075436_100028194
460 Ga0075435_100007941
461 Ga0075435_100009999
462 Ga0105245_10036631
463 Ga0114129_10010887
464 Ga0114129_10036563
465 Ga0105248_10012248
466 Ga0105239_10038818
467 Ga0157370_10047415
468 Ga0157370_10079208
469 Ga0157369_10088189
470 Ga0157374_10005657
471 Ga0163162_10005964
472 Ga0157372_10005705
473 Ga0157375_10093144
474 Ga0163163_10003649
475 Ga0163163_10008170
476 Ga0163163_10038785
477 Ga0157380_10066758
478 Ga0182008_10006843
479 Ga0157379_10032715
480 Ga0157376_10014405
481 Ga0182007_10007092
482 Ga0197907_10249437
483 Ga0206353_10277694
484 Ga0206353_11360495
485 Ga0224712_10000920
486 Ga0224712_10001265
487 Ga0207653_10014129
488 Ga0207692_10004908
489 Ga0207699_10000074
490 Ga0207699_10030681
491 Ga0207684_10045495
492 Ga0207693_10003962
493 Ga0207693_10004792
494 Ga0207693_10006807
495 Ga0207663_10013169
496 Ga0207662_10002708
497 Ga0207657_10031699
498 Ga0207649_10019848
499 Ga0207652_10078767
500 Ga0207646_10002271
501 Ga0207646_10018823
502 Ga0207700_10007134
503 Ga0207700_10017640
504 Ga0207664_10003154
505 Ga0207664_10010612
506 Ga0207664_10015969
507 Ga0207664_10042141
508 Ga0207670_10000441
509 Ga0207670_10005279
510 Ga0207669_10008295
511 Ga0207665_10008325
512 Ga0207691_10078828
513 Ga0207661_10024174
514 Ga0207712_10019025
515 Ga0207703_10031990
516 Ga0207708_10006560
517 Ga0207708_10020122
518 Ga0207708_10081383
519 Ga0207702_10013127
520 Ga0207702_10087844
521 Ga0207641_10048896
522 Ga0207648_10003621
523 Ga0207648_10004306
524 Ga0207675_100030336
525 Ga0207675_100039789
526 Ga0207675_100042729
527 Ga0207675_100080174
528 Ga0207683_10010309
529 Ga0268265_10021564
530 Ga0265337_1002255
531 Ga0265338_10060769
532 Ga0265325_10000945
533 Ga0316576_10012597
534 Ga0316578_10011327
535 Ga0373948_0000561
536 Ga0373934_0000043
537 Ga0373934_0005064
538 Ga0373936_0006008
539 Ga0373953_0001795
540 Ga0373954_0002717
541 Ga0373956_0000321
542 Ga0373956_0003485
543 Ga0373957_0001885
544 Ga0373957_0002038
545 Ga0373955_0000089
546 Ga0373962_0001298
547 Ga0316574_0010069
548 Ga0316574_0014641
549 Ga0316574_0018003
550 Ga0373924_0000287
551 Ga0373927_0013851
552 Ga0373927_0031123
553 Ga0373933_0002445
554 Ga0373947_0017758
555 Ga0373947_0025258
556 Ga0373947_0039601
557 Ga0373937_0000021
558 Ga0373937_0011401
559 Ga0373937_0032928
560 Ga0373937_0036058
561 Ga0373937_0038350
562 Ga0316584_0008524
563 Ga0395899_0041070
564 Ga0395900_0003196
565 Ga0395900_0012174
566 Ga0395898_0002580
567 Ga0395905_0015909
568 Ga0395901_0003343
569 Ga0395901_0045674
570 Ga0395901_0053079
571 Ga0436365_0591272
572 Ga0436361_0904007
573 Ga0439463_004136
574 Ga0451577_0069489
575 Ga0466965_0011997
576 Ga0466971_0012845
577 Ga0466960_0001828
578 Ga0466960_0015574
579 Ga0466959_0004387
580 Ga0451576_0007953
581 Ga0466958_0018956
582 Ga0466967_0042674
583 Ga0466967_0074897
584 Ga0495592_0000013
585 Ga0495592_0000455
586 Ga0495641_0013214
587 Ga0495641_0017620
588 Ga0495651_0000022
589 Ga0495651_0000174
590 Ga0495651_0003527
591 Ga0495653_0011576
592 Ga0495653_0026138
593 Ga0495639_0018712
594 Ga0495662_0005693
595 Ga0495664_0016520
596 Ga0495584_0016589
597 Ga0495608_0000029
598 Ga0495608_0000410
599 Ga0495608_0010310
600 Ga0495608_0011293
601 Ga0495618_0006528
602 Ga0495618_0008040
603 Ga0495618_0028890
604 Ga0495628_0000444
605 Ga0495628_0014220
606 Ga0495630_0009791
607 Ga0495630_0015967
608 Ga0495652_0000412
609 Ga0495652_0000665
610 Ga0495652_0086781
611 Ga0495587_0000022
612 Ga0495587_0002570
613 Ga0495587_0002878
614 Ga0495645_0040777
615 Ga0495667_0000028
616 Ga0495667_0000117
617 Ga0495634_0001586
618 Ga0495634_0010383
619 Ga0495634_0015756
620 Ga0495635_0012324
621 Ga0495657_0000036
622 Ga0495657_0005088
623 Ga0495657_0010892
624 Ga0495657_0016770
625 Ga0495657_0064688
626 Ga0495599_0000131
627 Ga0495599_0000185
628 Ga0495623_0000084
629 Ga0495646_0000628
630 Ga0495646_0011748
631 Ga0495613_0033827
632 Ga0495624_0009475
633 Ga0495589_0009445
634 Ga0495600_0003721
635 Ga0495600_0007129
636 Ga0495600_0011309
637 Ga0495600_0033554
638 Ga0495581_0001882
639 Ga0495604_0000023
640 Ga0495604_0007397
641 Ga0495604_0009164
642 Ga0495604_0011340
643 Ga0495604_0037022
644 Ga0495674_0000984
645 Ga0495674_0011524
646 Ga0495674_0072858
647 Ga0495680_0000232
648 Ga0495680_0000401
649 Ga0495680_0015796
650 Ga0495680_0016951
651 Ga0495680_0032415
652 Ga0495675_0004505
653 Ga0495675_0007357
654 Ga0495675_0015400
655 Ga0495675_0019250
656 Ga0495684_0000598
657 Ga0495593_0009964
658 Ga0495593_0014576
659 Ga0495602_0000653
660 Ga0495602_0002949
661 Ga0495602_0022429
662 Ga0495602_0024323
663 Ga0496100_0011233
664 Ga0496100_0015360
665 Ga0496100_0016658
666 Ga0496100_0051546
667 Ga0496101_0003732
668 Ga0496101_0017613
669 Ga0496101_0046696
670 Ga0496102_0007511
671 Ga0496103_0018602
672 Ga0496104_0000538
673 Ga0496104_0000758
674 Ga0496104_0002501
675 Ga0496104_0003961
676 Ga0496104_0010918
677 Ga0496105_0002720
678 Ga0496105_0008861
679 Ga0496105_0018857
680 Ga0496105_0085510
681 Ga0496106_0018933
682 Ga0496106_0039631
683 Ga0496107_0013000
684 Ga0496107_0014339
685 Ga0496107_0036323
686 Ga0496108_0011503
687 Ga0496108_0016759
688 Ga0496108_0020404
689 Ga0496108_0048536
690 Ga0496108_0092938
691 Ga0496109_0006109
692 Ga0496109_0061978
693 Ga0496110_0002173
694 Ga0496110_0003248
695 Ga0496110_0004696
696 Ga0496111_0005195
697 Ga0496111_0008463
698 Ga0496111_0009228
699 Ga0496111_0033451
700 Ga0496111_0036634
701 Ga0496111_0041792
702 Ga0496112_0004951
703 Ga0496112_0008631
704 Ga0496112_0009733
705 Ga0496112_0015184
706 Ga0496112_0016859
707 Ga0496112_0033727
708 Ga0496112_0057112
709 Ga0496113_0013744
710 Ga0496113_0029994
711 Ga0496113_0055332
712 Ga0496114_0011132
713 Ga0496114_0011894
714 Ga0496114_0018534
715 Ga0496114_0028359
716 Ga0496115_0004379
717 Ga0496115_0018305
718 Ga0496115_0022111
719 Ga0501031_0008667
720 Ga0501031_0015216
721 Ga0501031_0044743
722 Ga0501033_0024486
723 Ga0501036_0005685
724 Ga0501036_0020581
725 Ga0501038_0022357
726 Ga0501039_0011637
727 Ga0501040_0004257
728 Ga0501040_0007486
729 Ga0501040_0013761
730 Ga0501042_0000110
731 Ga0501042_0016601
732 Ga0501042_0020258
733 Ga0501047_0023269
734 Ga0501048_0020746
735 Ga0501067_0008462
736 Ga0501068_0025126
737 Ga0501068_0038428
738 Ga0501069_0009645
739 Ga0501070_0014986
740 Ga0501071_0024384
741 Ga0501071_0028328
742 Ga0501072_0001265
743 Ga0501072_0024931
744 Ga0501074_0003252
745 Ga0501075_0005580
746 Ga0501075_0023350
747 Ga0501075_0027907
748 Ga0501075_0044111
749 Ga0501076_0018016
750 Ga0501076_0028591
751 Ga0501077_0001395
752 Ga0501079_0019951
753 Ga0501079_0024294
754 Ga0501080_0016433
755 Ga0501081_0006059
756 Ga0501081_0007981
757 Ga0501081_0013944
758 Ga0501083_0031434
759 Ga0501044_0008071
760 Ga0501045_0003320
761 Ga0501045_0011729
762 Ga0501045_0024430
763 nmdc:mga00v17_23202_c1
764 nmdc:mga00v17_26243_c1
765 nmdc:mga09592_27592_c1
766 nmdc:mga0n895_119798_c1
767 nmdc:mga0n895_34183_c1
768 nmdc:mga0n895_46115_c1
769 nmdc:mga0n895_67846_c1
770 nmdc:mga0rr50_14200_c1
771 nmdc:mga0rr50_29648_c1
772 nmdc:mga0a205_8249_c1
773 Ga0495601_0001504
774 Ga0495601_0047888
775 Ga0495595_0004210
776 Ga0495595_0005609
777 Ga0495619_0000941
778 Ga0495619_0006271
779 Ga0495619_0011941
780 Ga0495619_0015432
781 Ga0495619_0030337
782 Ga0500566_0001288
783 Ga0500616_0001120
784 Ga0501084_0000053
785 Ga0501084_0021429
786 Ga0501084_0026301
787 Ga0501082_0008990
788 Ga0501082_0026323
789 Ga0501082_0066113
790 Ga0530510_0002361
791 Ga0530510_0004930
792 Ga0530510_0008565
793 Ga0530510_0012302
794 Ga0530510_0027013
795 2583149248
796 2795785361
797 2867307298
798 2899374838

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02738

MoCoBD_1

Molybdopterin cofactor-binding domain

166

411

0.94

PF20256

MoCoBD_2

Molybdopterin cofactor-binding domain

438

715

0.94

PF01315

Ald_Xan_dh_C

Aldehyde oxidase and xanthine dehydrogenase, a/b hammerhead domain

39

149

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zxi-assembly1.cif.gz_B reconstituted co dehydrogenase from oligotropha carboxidovorans 0.9426 5 747
1n5w-assembly1.cif.gz_B crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.9398 5 747
1t3q-assembly1.cif.gz_E crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 0.9387 1 752
1ffv-assembly1.cif.gz_E carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.9381 5 751
1t3q-assembly1.cif.gz_E crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 0.9375 1 752
ID Description Score Start End Superfamily
1t3qB04 Alpha Beta;2-Layer Sandwich;Aldehyde Oxidoreductase; domain 4;Aldehyde oxidase/xanthine dehydrogenase, molybdopterin binding domain 0.9728 605 752 3.30.365.10
1n5wB04 Alpha Beta;2-Layer Sandwich;Aldehyde Oxidoreductase; domain 4;Aldehyde oxidase/xanthine dehydrogenase, molybdopterin binding domain 0.9491 358 747 3.30.365.10
1t3qB03 Alpha Beta;2-Layer Sandwich;Aldehyde Oxidoreductase; domain 4;Aldehyde oxidase/xanthine dehydrogenase, molybdopterin binding domain 0.9399 183 273 3.30.365.10
1ffuB04 Alpha Beta;2-Layer Sandwich;Aldehyde Oxidoreductase; domain 4;Aldehyde oxidase/xanthine dehydrogenase, molybdopterin binding domain 0.935 408 751 3.30.365.10
1n5wB01 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Aldehyde oxidase/xanthine dehydrogenase, a/b hammerhead 0.9333 6 131 3.90.1170.50
ID Description Score Start End GO Terms
AF-A0A7C1Y873-F1-model_v4 Xanthine dehydrogenase family protein molybdopterin-binding subunit 0.985 2 571 GO:0005506
GO:0016491
AF-A0A7X9KLC9-F1-model_v4 Molybdopterin-dependent oxidoreductase 0.9818 604 750 GO:0005506
GO:0016491
AF-A0A7C1Y873-F1-model_v4 Xanthine dehydrogenase family protein molybdopterin-binding subunit 0.9799 2 571 GO:0005506
GO:0016491
AF-A0A6B0ZBA1-F1-model_v4 Xanthine dehydrogenase family protein molybdopterin-binding subunit 0.9791 2 751 GO:0005506
GO:0016491
AF-A0A381YQ69-F1-model_v4 Aldehyde oxidase/xanthine dehydrogenase a/b hammerhead domain-containing protein 0.9779 22 752 GO:0005506
GO:0016491

Map