F434258

General Info

Members Datasets Scaffolds Average Seq Length
399 218 798 72

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10086755|Ga0081455_100867553
Length 85
Sequence VAVLTDTIQVTGVRCERCVGRLAVALRGHEGIESANANLMGEVTLSWESELTSRDAIVATLSRAGFYEATTSSVGNTAPGAVVRP

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
54 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
92 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
93 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
94 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
95 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
96 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
97 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
100 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
101 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
102 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
103 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
104 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
105 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
106 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
111 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
112 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
113 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
114 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
115 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
116 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
117 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
118 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
119 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
120 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
121 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
122 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
123 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
124 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
125 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
126 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
127 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
128 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
129 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
130 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
131 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
132 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
133 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
134 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
135 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
136 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
137 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
138 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
139 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
140 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
141 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
142 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
143 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
144 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
145 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
146 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
147 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
148 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
149 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
150 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
151 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
152 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
153 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
154 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
155 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
156 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
157 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
158 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
159 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
160 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
161 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
176 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
189 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
190 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
191 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
192 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
193 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
194 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
195 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
196 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
197 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
198 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
199 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
200 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
201 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
202 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
205 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
206 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
207 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
208 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
209 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
210 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
211 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
212 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
213 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
214 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
215 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
216 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
217 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
218 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.77
Rhizosphere 90.23
Stem 0
Stem Tuber 0
Unclassified 22.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10086755 3300005937 Bacteria 2549
2 JGI25406J46586_10055789 3300003203 Unclassified 1300
3 Ga0070670_100948306 3300005331 Bacteria 781
4 Ga0068869_102149643 3300005334 Bacteria 502
5 Ga0070680_100845528 3300005336 Unclassified 789
6 Ga0068868_100750183 3300005338 Bacteria 877
7 Ga0070675_100013674 3300005354 Bacteria 6385
8 Ga0070674_101420840 3300005356 Unclassified 622
9 Ga0070673_100530937 3300005364 Unclassified 1067
10 Ga0070688_101202407 3300005365 Bacteria 609
11 Ga0070688_101331239 3300005365 Unclassified 580
12 Ga0070659_100340212 3300005366 Bacteria 1257
13 Ga0070709_10609776 3300005434 Bacteria 841
14 Ga0070714_100011050 3300005435 Bacteria 7153
15 Ga0070714_100390370 3300005435 Bacteria 1314
16 Ga0070714_100556608 3300005435 Bacteria 1098
17 Ga0070714_101585809 3300005435 Unclassified 639
18 Ga0070713_100054867 3300005436 Bacteria 3308
19 Ga0070713_100114582 3300005436 Bacteria 2355
20 Ga0070713_101327395 3300005436 Unclassified 697
21 Ga0070701_10250086 3300005438 Bacteria 1070
22 Ga0070711_100844736 3300005439 Bacteria 779
23 Ga0070711_101378423 3300005439 Unclassified 613
24 Ga0070694_100828664 3300005444 Unclassified 760
25 Ga0070708_100926089 3300005445 Unclassified 818
26 Ga0070708_101162724 3300005445 Unclassified 722
27 Ga0070663_101768263 3300005455 Unclassified 554
28 Ga0070678_100881756 3300005456 Bacteria 817
29 Ga0070678_101052290 3300005456 Bacteria 750
30 Ga0068867_100206501 3300005459 Bacteria 1575
31 Ga0068867_102075578 3300005459 Bacteria 538
32 Ga0070685_10462698 3300005466 Bacteria 891
33 Ga0070685_10624441 3300005466 Bacteria 778
34 Ga0070698_100089050 3300005471 Bacteria 3070
35 Ga0070699_100119505 3300005518 Bacteria 2317
36 Ga0070684_100558368 3300005535 Bacteria 1063
37 Ga0070684_101175971 3300005535 Bacteria 721
38 Ga0070684_101218065 3300005535 Bacteria 708
39 Ga0070684_102235006 3300005535 Bacteria 516
40 Ga0070672_100328041 3300005543 Bacteria 1302
41 Ga0070672_100734443 3300005543 Unclassified 866
42 Ga0070672_101531895 3300005543 Unclassified 598
43 Ga0070704_100839472 3300005549 Unclassified 823
44 Ga0068856_100463483 3300005614 Bacteria 1288
45 Ga0070702_100393772 3300005615 Bacteria 989
46 Ga0070702_100653456 3300005615 Bacteria 795
47 Ga0070702_101002928 3300005615 Unclassified 661
48 Ga0068864_101312171 3300005618 Unclassified 724
49 Ga0068870_10812328 3300005840 Bacteria 654
50 Ga0081455_10472239 3300005937 Bacteria 851
51 Ga0081538_10268321 3300005981 Bacteria 640
52 Ga0081539_10003293 3300005985 Bacteria 20218
53 Ga0070717_10014733 3300006028 Bacteria 6015
54 Ga0070717_10094775 3300006028 Bacteria 2525
55 Ga0070712_100093129 3300006175 Bacteria 2211
56 Ga0070712_100526929 3300006175 Bacteria 993
57 Ga0070712_100554462 3300006175 Unclassified 968
58 Ga0097621_102184977 3300006237 Bacteria 529
59 Ga0075428_101164980 3300006844 Bacteria 813
60 Ga0068865_100171940 3300006881 Unclassified 1662
61 Ga0075436_100063763 3300006914 Bacteria 2547
62 Ga0105240_10121240 3300009093 Bacteria 3148
63 Ga0105240_10902772 3300009093 Bacteria 950
64 Ga0105245_10156219 3300009098 Bacteria 2161
65 Ga0105245_11117792 3300009098 Unclassified 834
66 Ga0105245_11318343 3300009098 Bacteria 771
67 Ga0105245_11981587 3300009098 Bacteria 636
68 Ga0114129_12672612 3300009147 Unclassified 595
69 Ga0114129_13381877 3300009147 Unclassified 514
70 Ga0105243_11170980 3300009148 Unclassified 780
71 Ga0105243_11905778 3300009148 Unclassified 627
72 Ga0105242_12544387 3300009176 Unclassified 560
73 Ga0105246_11085663 3300011119 Bacteria 730
74 Ga0105246_11471357 3300011119 Bacteria 638
75 Ga0157378_10432007 3300013297 Archaea 1303
76 Ga0157372_10775336 3300013307 Unclassified 1115
77 Ga0157372_13037815 3300013307 Unclassified 536
78 Ga0157375_11821628 3300013308 Unclassified 722
79 Ga0163163_10442661 3300014325 Bacteria 1359
80 Ga0157377_10065016 3300014745 Bacteria 2094
81 Ga0157377_10201757 3300014745 Bacteria 1263
82 Ga0157379_11034522 3300014968 Unclassified 784
83 Ga0157376_10502062 3300014969 Bacteria 1192
84 Ga0163161_11192160 3300017792 Unclassified 658
85 Ga0207713_1190172 3300025735 Bacteria 635
86 Ga0207682_10130780 3300025893 Bacteria 1120
87 Ga0207692_10029445 3300025898 Bacteria 2610
88 Ga0207642_10762676 3300025899 Bacteria 613
89 Ga0207685_10079708 3300025905 Unclassified 1352
90 Ga0207699_10007837 3300025906 Bacteria 5235
91 Ga0207699_10194473 3300025906 Bacteria 1371
92 Ga0207699_10665829 3300025906 Unclassified 761
93 Ga0207645_10867328 3300025907 Bacteria 613
94 Ga0207643_10601736 3300025908 Bacteria 708
95 Ga0207695_10430885 3300025913 Bacteria 1203
96 Ga0207693_10045089 3300025915 Bacteria 3465
97 Ga0207693_10050552 3300025915 Bacteria 3264
98 Ga0207693_10739747 3300025915 Bacteria 760
99 Ga0207663_10002700 3300025916 Bacteria 8557
100 Ga0207663_11653344 3300025916 Unclassified 515
101 Ga0207662_10147493 3300025918 Bacteria 1494
102 Ga0207649_11404568 3300025920 Bacteria 552
103 Ga0207646_10054364 3300025922 Bacteria 3582
104 Ga0207659_10119868 3300025926 Bacteria 2015
105 Ga0207659_10548032 3300025926 Bacteria 983
106 Ga0207687_10190967 3300025927 Bacteria 1594
107 Ga0207687_10305600 3300025927 Bacteria 1282
108 Ga0207687_10443989 3300025927 Bacteria 1075
109 Ga0207700_10098274 3300025928 Unclassified 2328
110 Ga0207700_10104711 3300025928 Unclassified 2264
111 Ga0207700_10158484 3300025928 Bacteria 1878
112 Ga0207664_10005607 3300025929 Bacteria 8591
113 Ga0207664_10012259 3300025929 Bacteria 6127
114 Ga0207664_10029376 3300025929 Bacteria 4186
115 Ga0207664_10033418 3300025929 Bacteria 3951
116 Ga0207644_10138772 3300025931 Bacteria 1870
117 Ga0207690_11253151 3300025932 Unclassified 619
118 Ga0207706_10394982 3300025933 Bacteria 1199
119 Ga0207686_10282224 3300025934 Bacteria 1226
120 Ga0207686_11518574 3300025934 Unclassified 552
121 Ga0207709_10518341 3300025935 Bacteria 933
122 Ga0207669_10511546 3300025937 Bacteria 963
123 Ga0207704_10224341 3300025938 Bacteria 1393
124 Ga0207704_10396894 3300025938 Unclassified 1087
125 Ga0207704_10554588 3300025938 Bacteria 934
126 Ga0207704_10562787 3300025938 Bacteria 928
127 Ga0207665_10002480 3300025939 Bacteria 12442
128 Ga0207691_10657424 3300025940 Unclassified 885
129 Ga0207691_10763581 3300025940 Unclassified 813
130 Ga0207691_11244176 3300025940 Bacteria 616
131 Ga0207689_10318475 3300025942 Unclassified 1290
132 Ga0207679_10977055 3300025945 Bacteria 776
133 Ga0207651_10364484 3300025960 Bacteria 1221
134 Ga0207651_11928066 3300025960 Bacteria 531
135 Ga0207658_10405132 3300025986 Bacteria 1200
136 Ga0207677_10827966 3300026023 Unclassified 830
137 Ga0207677_11477215 3300026023 Bacteria 627
138 Ga0207702_10455650 3300026078 Bacteria 1242
139 Ga0207648_11972307 3300026089 Unclassified 545
140 Ga0207648_12077961 3300026089 Unclassified 529
141 Ga0207675_101198583 3300026118 Unclassified 779
142 Ga0207675_101418758 3300026118 Bacteria 715
143 Ga0207683_10115188 3300026121 Bacteria 2410
144 Ga0207683_10294870 3300026121 Bacteria 1483
145 Ga0207683_10411227 3300026121 Bacteria 1245
146 Ga0207683_11975393 3300026121 Bacteria 532
147 Ga0268266_10429012 3300028379 Bacteria 1254
148 Ga0268266_10615111 3300028379 Bacteria 1044
149 Ga0265338_10024966 3300028800 Bacteria 6085
150 Ga0307408_100185813 3300031548 Bacteria 1671
151 Ga0265313_10004294 3300031595 Bacteria 11035
152 Ga0307413_10578520 3300031824 Unclassified 916
153 Ga0307410_11666265 3300031852 Bacteria 564
154 Ga0307407_11206420 3300031903 Bacteria 591
155 Ga0307409_101400803 3300031995 Bacteria 725
156 Ga0307409_101625689 3300031995 Bacteria 674
157 Ga0307416_100283032 3300032002 Bacteria 1636
158 Ga0307416_101351816 3300032002 Bacteria 818
159 Ga0307415_100443420 3300032126 Bacteria 1120
160 Ga0316583_10023634 3300032133 Bacteria 2195
161 Ga0316583_10297566 3300032133 Bacteria 558
162 Ga0373948_0078721 3300034817 Bacteria 749
163 Ga0373929_0058312 3300035085 Bacteria 898
164 Ga0373960_0222847 3300035121 Bacteria 675
165 Ga0373962_0039778 3300035242 Unclassified 1321
166 Ga0373947_1083455 3300035725 Bacteria 546
167 Ga0395899_0293727 3300037312 Unclassified 1102
168 Ga0395898_0337135 3300037466 Unclassified 1438
169 Ga0395898_0626449 3300037466 Unclassified 1018
170 Ga0395905_1071917 3300037471 Bacteria 709
171 Ga0395901_0141940 3300038443 Bacteria 2524
172 Ga0395901_0641532 3300038443 Bacteria 1066
173 Ga0395901_0759992 3300038443 Bacteria 962
174 Ga0439439_0090328 3300041406 Bacteria 836
175 Ga0439461_0001225 3300041410 Bacteria 3913
176 Ga0451800_0429875 3300041459 Bacteria 728
177 Ga0451837_1502815 3300041494 Bacteria 524
178 Ga0451847_0868714 3300041503 Unclassified 1189
179 Ga0451853_0880568 3300041512 Bacteria 562
180 Ga0451853_3451540 3300041512 Bacteria 1308
181 Ga0439432_110610 3300042006 Bacteria 817
182 Ga0439452_049703 3300042010 Bacteria 964
183 Ga0450920_021914 3300042122 Bacteria 1236
184 Ga0450900_053602 3300042136 Bacteria 621
185 Ga0450907_032460 3300042146 Bacteria 889
186 Ga0450910_006339 3300042147 Bacteria 1631
187 Ga0439446_0007477 3300042156 Bacteria 2873
188 Ga0439446_0211069 3300042156 Bacteria 658
189 Ga0439434_0004397 3300042435 Bacteria 4122
190 Ga0439460_0239137 3300042461 Bacteria 626
191 Ga0466966_0001849 3300044684 Bacteria 13724
192 Ga0466961_0005843 3300044693 Bacteria 7796
193 Ga0466961_0019364 3300044693 Bacteria 4377
194 Ga0466961_0114995 3300044693 Unclassified 1691
195 Ga0466961_0553969 3300044693 Bacteria 692
196 Ga0466963_0001677 3300044694 Bacteria 12065
197 Ga0466963_0021168 3300044694 Bacteria 4098
198 Ga0466963_0025224 3300044694 Archaea 3789
199 Ga0466963_0048828 3300044694 Bacteria 2798
200 Ga0466963_0511637 3300044694 Bacteria 848
201 Ga0466964_0206364 3300044706 Unclassified 946
202 Ga0466964_0326315 3300044706 Bacteria 781
203 Ga0466971_0004404 3300044719 Bacteria 6077
204 Ga0466971_0564826 3300044719 Bacteria 565
205 Ga0466968_0117937 3300044735 Bacteria 1199
206 Ga0466970_0080403 3300044765 Bacteria 1761
207 Ga0466957_0007794 3300044842 Bacteria 6064
208 Ga0466957_0017566 3300044842 Bacteria 4192
209 Ga0466959_0020054 3300045049 Bacteria 4921
210 Ga0466959_0027231 3300045049 Bacteria 4239
211 Ga0466959_0346026 3300045049 Unclassified 1014
212 Ga0466959_0437108 3300045049 Bacteria 887
213 Ga0451576_1475972 3300045051 Bacteria 707
214 Ga0451576_1648958 3300045051 Bacteria 665
215 Ga0466958_0001480 3300045836 Bacteria 11201
216 Ga0466958_0005710 3300045836 Bacteria 6720
217 Ga0466967_0004404 3300045976 Bacteria 9489
218 Ga0466967_0005380 3300045976 Bacteria 8862
219 Ga0466967_0010274 3300045976 Bacteria 7007
220 Ga0466967_0132749 3300045976 Bacteria 2313
221 Ga0466967_0173397 3300045976 Bacteria 2030
222 Ga0495603_0008076 3300046455 Bacteria 6359
223 Ga0495603_0567387 3300046455 Bacteria 650
224 Ga0495641_0042686 3300046461 Bacteria 2100
225 Ga0495582_0028215 3300046473 Bacteria 3080
226 Ga0495664_0263861 3300046477 Bacteria 1041
227 Ga0495585_0390969 3300046492 Bacteria 671
228 Ga0495596_0049845 3300046500 Bacteria 1641
229 Ga0495596_0121301 3300046500 Bacteria 1015
230 Ga0495628_0542625 3300046516 Bacteria 836
231 Ga0495631_0233354 3300046518 Bacteria 785
232 Ga0495631_0354859 3300046518 Bacteria 624
233 Ga0495643_0405013 3300046522 Bacteria 601
234 Ga0495644_0107841 3300046523 Bacteria 1056
235 Ga0495663_0232989 3300046525 Bacteria 650
236 Ga0495652_0830601 3300046529 Bacteria 613
237 Ga0495598_0145712 3300046537 Unclassified 823
238 Ga0495621_0396827 3300046539 Unclassified 585
239 Ga0495645_0678693 3300046543 Bacteria 627
240 Ga0495645_0777048 3300046543 Unclassified 576
241 Ga0495622_0427388 3300046557 Bacteria 569
242 Ga0495656_0025600 3300046615 Bacteria 2341
243 Ga0495656_0104925 3300046615 Bacteria 1313
244 Ga0495656_0240333 3300046615 Unclassified 912
245 Ga0495659_0163231 3300046664 Unclassified 900
246 Ga0495588_0266926 3300046674 Bacteria 902
247 Ga0495658_0307116 3300046683 Bacteria 1004
248 Ga0495658_0640636 3300046683 Bacteria 681
249 Ga0495589_0319983 3300046794 Unclassified 717
250 Ga0495589_0562698 3300046794 Unclassified 520
251 Ga0495674_0395165 3300047319 Bacteria 1117
252 Ga0495602_0573372 3300048088 Unclassified 779
253 Ga0495615_0132355 3300048090 Bacteria 730
254 Ga0496100_0036846 3300048903 Bacteria 3088
255 Ga0496101_0078331 3300048904 Bacteria 2437
256 Ga0496101_1195755 3300048904 Bacteria 596
257 Ga0496102_0035747 3300048905 Bacteria 4473
258 Ga0496103_0022071 3300048906 Bacteria 3831
259 Ga0496104_0230746 3300048907 Bacteria 1763
260 Ga0496104_0512650 3300048907 Bacteria 1110
261 Ga0496105_0142120 3300048908 Bacteria 1975
262 Ga0496105_0264548 3300048908 Bacteria 1390
263 Ga0496105_0547850 3300048908 Unclassified 903
264 Ga0496105_0648134 3300048908 Unclassified 815
265 Ga0496105_1000864 3300048908 Unclassified 625
266 Ga0496106_0001780 3300048909 Bacteria 16082
267 Ga0496108_0531067 3300048911 Bacteria 1027
268 Ga0496108_0693074 3300048911 Bacteria 884
269 Ga0496108_1059354 3300048911 Bacteria 690
270 Ga0496109_0050303 3300048912 Bacteria 3795
271 Ga0496109_0401637 3300048912 Bacteria 1295
272 Ga0496109_0762057 3300048912 Unclassified 906
273 Ga0496110_0007895 3300048913 Bacteria 8522
274 Ga0496110_0267060 3300048913 Unclassified 1558
275 Ga0496110_0564143 3300048913 Bacteria 1034
276 Ga0496111_0037728 3300048914 Bacteria 3459
277 Ga0496111_0249424 3300048914 Bacteria 1318
278 Ga0496111_1330268 3300048914 Bacteria 505
279 Ga0496112_0239451 3300048915 Bacteria 1767
280 Ga0496112_0554808 3300048915 Bacteria 1083
281 Ga0496112_0920379 3300048915 Bacteria 796
282 Ga0496113_0016018 3300048916 Bacteria 5171
283 Ga0496114_0029756 3300048917 Bacteria 4489
284 Ga0496114_0069113 3300048917 Bacteria 2966
285 Ga0496114_0217280 3300048917 Unclassified 1678
286 Ga0496115_0050995 3300048918 Bacteria 3317
287 Ga0496115_0718221 3300048918 Bacteria 784
288 Ga0501031_0219883 3300049568 Unclassified 1237
289 Ga0501031_0359679 3300049568 Bacteria 942
290 Ga0501032_0036522 3300049569 Bacteria 3353
291 Ga0501032_0107006 3300049569 Bacteria 1852
292 Ga0501033_0019229 3300049570 Bacteria 5164
293 Ga0501033_0352975 3300049570 Bacteria 1030
294 Ga0501036_0421636 3300049572 Bacteria 1112
295 Ga0501036_0595684 3300049572 Unclassified 917
296 Ga0501038_0039708 3300049574 Bacteria 4116
297 Ga0501038_0432171 3300049574 Bacteria 1014
298 Ga0501038_0690766 3300049574 Unclassified 765
299 Ga0501039_0037923 3300049575 Bacteria 3722
300 Ga0501039_0269755 3300049575 Bacteria 1338
301 Ga0501039_0590004 3300049575 Unclassified 871
302 Ga0501039_1444100 3300049575 Unclassified 529
303 Ga0501040_0011123 3300049576 Bacteria 5882
304 Ga0501040_0025092 3300049576 Bacteria 4005
305 Ga0501040_0122370 3300049576 Unclassified 1826
306 Ga0501040_1363206 3300049576 Unclassified 515
307 Ga0501041_0004358 3300049577 Bacteria 8190
308 Ga0501041_0093688 3300049577 Bacteria 1855
309 Ga0501041_1124768 3300049577 Unclassified 506
310 Ga0501042_0005349 3300049578 Bacteria 8255
311 Ga0501042_0025482 3300049578 Bacteria 4154
312 Ga0501042_0124128 3300049578 Bacteria 1859
313 Ga0501042_0731859 3300049578 Bacteria 719
314 Ga0501043_0108481 3300049579 Bacteria 2180
315 Ga0501046_0031932 3300049580 Bacteria 4266
316 Ga0501046_0370412 3300049580 Bacteria 1038
317 Ga0501046_0411681 3300049580 Bacteria 975
318 Ga0501046_0862547 3300049580 Bacteria 633
319 Ga0501048_0019871 3300049582 Bacteria 4925
320 Ga0501048_0261381 3300049582 Bacteria 1230
321 Ga0501048_1410956 3300049582 Unclassified 501
322 Ga0501068_0017170 3300049584 Bacteria 4182
323 Ga0501068_1120247 3300049584 Unclassified 521
324 Ga0501069_0147945 3300049585 Bacteria 1349
325 Ga0501070_0161017 3300049586 Bacteria 1850
326 Ga0501070_0214579 3300049586 Bacteria 1579
327 Ga0501071_0017473 3300049587 Bacteria 4947
328 Ga0501071_0043322 3300049587 Bacteria 3226
329 Ga0501071_0355959 3300049587 Bacteria 1114
330 Ga0501071_0784595 3300049587 Bacteria 734
331 Ga0501071_0878556 3300049587 Bacteria 692
332 Ga0501071_1172145 3300049587 Bacteria 594
333 Ga0501072_0001074 3300049588 Bacteria 20312
334 Ga0501072_0273398 3300049588 Bacteria 1344
335 Ga0501072_0553897 3300049588 Bacteria 908
336 Ga0501072_1375957 3300049588 Unclassified 546
337 Ga0501073_0112194 3300049589 Bacteria 1891
338 Ga0501073_0216151 3300049589 Unclassified 1325
339 Ga0501074_0059226 3300049590 Bacteria 2759
340 Ga0501074_0283116 3300049590 Bacteria 1179
341 Ga0501075_0044272 3300049591 Bacteria 3339
342 Ga0501075_0048575 3300049591 Bacteria 3188
343 Ga0501075_0171649 3300049591 Unclassified 1655
344 Ga0501075_0288597 3300049591 Bacteria 1250
345 Ga0501075_1087968 3300049591 Unclassified 607
346 Ga0501076_0002037 3300049592 Bacteria 13834
347 Ga0501076_0048628 3300049592 Bacteria 3352
348 Ga0501076_0154388 3300049592 Bacteria 1868
349 Ga0501076_0699896 3300049592 Bacteria 836
350 Ga0501077_0006981 3300049593 Bacteria 6957
351 Ga0501077_0028471 3300049593 Bacteria 3550
352 Ga0501077_0126236 3300049593 Bacteria 1622
353 Ga0501077_0166648 3300049593 Bacteria 1400
354 Ga0501077_0178335 3300049593 Bacteria 1350
355 Ga0501077_0523816 3300049593 Bacteria 760
356 Ga0501079_0001804 3300049741 Bacteria 15292
357 Ga0501079_0023108 3300049741 Bacteria 4773
358 Ga0501079_0146077 3300049741 Unclassified 1843
359 Ga0501080_0103453 3300049742 Bacteria 2641
360 Ga0501080_0225945 3300049742 Bacteria 1712
361 Ga0501080_0735711 3300049742 Unclassified 868
362 Ga0501080_1105164 3300049742 Unclassified 684
363 Ga0501081_0002825 3300049743 Bacteria 11013
364 Ga0501081_0143009 3300049743 Bacteria 1715
365 Ga0501081_0434649 3300049743 Bacteria 974
366 Ga0501081_0514447 3300049743 Bacteria 893
367 Ga0501083_0042582 3300049744 Bacteria 3078
368 Ga0501035_0036705 3300049822 Bacteria 4441
369 Ga0501035_1227229 3300049822 Bacteria 581
370 Ga0501044_0390856 3300049823 Bacteria 1305
371 Ga0501044_0569002 3300049823 Bacteria 1029
372 Ga0501045_0000404 3300049824 Bacteria 26259
373 Ga0501045_0001212 3300049824 Bacteria 17175
374 Ga0501045_0128433 3300049824 Bacteria 1884
375 Ga0501045_0304713 3300049824 Bacteria 1186
376 nmdc:mga05p37_2218116_c1 3300050507 Unclassified 509
377 nmdc:mga0n895_1643876_c1 3300050512 Bacteria 606
378 nmdc:mga08x19_57177_c1 3300050514 Bacteria 2519
379 Ga0495601_0102996 3300053077 Bacteria 1845
380 Ga0495595_0069365 3300053084 Bacteria 1664
381 Ga0495619_0089945 3300053085 Unclassified 2078
382 Ga0501084_0026068 3300054114 Bacteria 4877
383 Ga0501084_0269475 3300054114 Bacteria 1437
384 Ga0501084_0282869 3300054114 Bacteria 1401
385 Ga0501084_0472851 3300054114 Bacteria 1059
386 Ga0501084_1100146 3300054114 Bacteria 667
387 Ga0501084_1604736 3300054114 Bacteria 544
388 Ga0590071_048654 3300059421 Bacteria 1026
389 Ga0590074_100807 3300059423 Bacteria 564
390 Ga0590075_008580 3300059424 Bacteria 2442
391 Ga0590075_013182 3300059424 Bacteria 2012
392 Ga0590077_013046 3300059426 Bacteria 1726
393 Ga0501082_0006028 3300060353 Bacteria 10514
394 Ga0501082_0429356 3300060353 Bacteria 1154
395 Ga0466962_0005019 3300061719 Bacteria 6364
396 Ga0530510_0029090 3300061734 Bacteria 3964
397 Ga0530510_0526202 3300061734 Bacteria 897
398 Ga0530510_0634948 3300061734 Bacteria 813
399 Ga0530510_1204997 3300061734 Unclassified 580
400 Ga0081455_10086755
401 JGI25406J46586_10055789
402 Ga0070670_100948306
403 Ga0068869_102149643
404 Ga0070680_100845528
405 Ga0068868_100750183
406 Ga0070675_100013674
407 Ga0070674_101420840
408 Ga0070673_100530937
409 Ga0070688_101202407
410 Ga0070688_101331239
411 Ga0070659_100340212
412 Ga0070709_10609776
413 Ga0070714_100011050
414 Ga0070714_100390370
415 Ga0070714_100556608
416 Ga0070714_101585809
417 Ga0070713_100054867
418 Ga0070713_100114582
419 Ga0070713_101327395
420 Ga0070701_10250086
421 Ga0070711_100844736
422 Ga0070711_101378423
423 Ga0070694_100828664
424 Ga0070708_100926089
425 Ga0070708_101162724
426 Ga0070663_101768263
427 Ga0070678_100881756
428 Ga0070678_101052290
429 Ga0068867_100206501
430 Ga0068867_102075578
431 Ga0070685_10462698
432 Ga0070685_10624441
433 Ga0070698_100089050
434 Ga0070699_100119505
435 Ga0070684_100558368
436 Ga0070684_101175971
437 Ga0070684_101218065
438 Ga0070684_102235006
439 Ga0070672_100328041
440 Ga0070672_100734443
441 Ga0070672_101531895
442 Ga0070704_100839472
443 Ga0068856_100463483
444 Ga0070702_100393772
445 Ga0070702_100653456
446 Ga0070702_101002928
447 Ga0068864_101312171
448 Ga0068870_10812328
449 Ga0081455_10472239
450 Ga0081538_10268321
451 Ga0081539_10003293
452 Ga0070717_10014733
453 Ga0070717_10094775
454 Ga0070712_100093129
455 Ga0070712_100526929
456 Ga0070712_100554462
457 Ga0097621_102184977
458 Ga0075428_101164980
459 Ga0068865_100171940
460 Ga0075436_100063763
461 Ga0105240_10121240
462 Ga0105240_10902772
463 Ga0105245_10156219
464 Ga0105245_11117792
465 Ga0105245_11318343
466 Ga0105245_11981587
467 Ga0114129_12672612
468 Ga0114129_13381877
469 Ga0105243_11170980
470 Ga0105243_11905778
471 Ga0105242_12544387
472 Ga0105246_11085663
473 Ga0105246_11471357
474 Ga0157378_10432007
475 Ga0157372_10775336
476 Ga0157372_13037815
477 Ga0157375_11821628
478 Ga0163163_10442661
479 Ga0157377_10065016
480 Ga0157377_10201757
481 Ga0157379_11034522
482 Ga0157376_10502062
483 Ga0163161_11192160
484 Ga0207713_1190172
485 Ga0207682_10130780
486 Ga0207692_10029445
487 Ga0207642_10762676
488 Ga0207685_10079708
489 Ga0207699_10007837
490 Ga0207699_10194473
491 Ga0207699_10665829
492 Ga0207645_10867328
493 Ga0207643_10601736
494 Ga0207695_10430885
495 Ga0207693_10045089
496 Ga0207693_10050552
497 Ga0207693_10739747
498 Ga0207663_10002700
499 Ga0207663_11653344
500 Ga0207662_10147493
501 Ga0207649_11404568
502 Ga0207646_10054364
503 Ga0207659_10119868
504 Ga0207659_10548032
505 Ga0207687_10190967
506 Ga0207687_10305600
507 Ga0207687_10443989
508 Ga0207700_10098274
509 Ga0207700_10104711
510 Ga0207700_10158484
511 Ga0207664_10005607
512 Ga0207664_10012259
513 Ga0207664_10029376
514 Ga0207664_10033418
515 Ga0207644_10138772
516 Ga0207690_11253151
517 Ga0207706_10394982
518 Ga0207686_10282224
519 Ga0207686_11518574
520 Ga0207709_10518341
521 Ga0207669_10511546
522 Ga0207704_10224341
523 Ga0207704_10396894
524 Ga0207704_10554588
525 Ga0207704_10562787
526 Ga0207665_10002480
527 Ga0207691_10657424
528 Ga0207691_10763581
529 Ga0207691_11244176
530 Ga0207689_10318475
531 Ga0207679_10977055
532 Ga0207651_10364484
533 Ga0207651_11928066
534 Ga0207658_10405132
535 Ga0207677_10827966
536 Ga0207677_11477215
537 Ga0207702_10455650
538 Ga0207648_11972307
539 Ga0207648_12077961
540 Ga0207675_101198583
541 Ga0207675_101418758
542 Ga0207683_10115188
543 Ga0207683_10294870
544 Ga0207683_10411227
545 Ga0207683_11975393
546 Ga0268266_10429012
547 Ga0268266_10615111
548 Ga0265338_10024966
549 Ga0307408_100185813
550 Ga0265313_10004294
551 Ga0307413_10578520
552 Ga0307410_11666265
553 Ga0307407_11206420
554 Ga0307409_101400803
555 Ga0307409_101625689
556 Ga0307416_100283032
557 Ga0307416_101351816
558 Ga0307415_100443420
559 Ga0316583_10023634
560 Ga0316583_10297566
561 Ga0373948_0078721
562 Ga0373929_0058312
563 Ga0373960_0222847
564 Ga0373962_0039778
565 Ga0373947_1083455
566 Ga0395899_0293727
567 Ga0395898_0337135
568 Ga0395898_0626449
569 Ga0395905_1071917
570 Ga0395901_0141940
571 Ga0395901_0641532
572 Ga0395901_0759992
573 Ga0439439_0090328
574 Ga0439461_0001225
575 Ga0451800_0429875
576 Ga0451837_1502815
577 Ga0451847_0868714
578 Ga0451853_0880568
579 Ga0451853_3451540
580 Ga0439432_110610
581 Ga0439452_049703
582 Ga0450920_021914
583 Ga0450900_053602
584 Ga0450907_032460
585 Ga0450910_006339
586 Ga0439446_0007477
587 Ga0439446_0211069
588 Ga0439434_0004397
589 Ga0439460_0239137
590 Ga0466966_0001849
591 Ga0466961_0005843
592 Ga0466961_0019364
593 Ga0466961_0114995
594 Ga0466961_0553969
595 Ga0466963_0001677
596 Ga0466963_0021168
597 Ga0466963_0025224
598 Ga0466963_0048828
599 Ga0466963_0511637
600 Ga0466964_0206364
601 Ga0466964_0326315
602 Ga0466971_0004404
603 Ga0466971_0564826
604 Ga0466968_0117937
605 Ga0466970_0080403
606 Ga0466957_0007794
607 Ga0466957_0017566
608 Ga0466959_0020054
609 Ga0466959_0027231
610 Ga0466959_0346026
611 Ga0466959_0437108
612 Ga0451576_1475972
613 Ga0451576_1648958
614 Ga0466958_0001480
615 Ga0466958_0005710
616 Ga0466967_0004404
617 Ga0466967_0005380
618 Ga0466967_0010274
619 Ga0466967_0132749
620 Ga0466967_0173397
621 Ga0495603_0008076
622 Ga0495603_0567387
623 Ga0495641_0042686
624 Ga0495582_0028215
625 Ga0495664_0263861
626 Ga0495585_0390969
627 Ga0495596_0049845
628 Ga0495596_0121301
629 Ga0495628_0542625
630 Ga0495631_0233354
631 Ga0495631_0354859
632 Ga0495643_0405013
633 Ga0495644_0107841
634 Ga0495663_0232989
635 Ga0495652_0830601
636 Ga0495598_0145712
637 Ga0495621_0396827
638 Ga0495645_0678693
639 Ga0495645_0777048
640 Ga0495622_0427388
641 Ga0495656_0025600
642 Ga0495656_0104925
643 Ga0495656_0240333
644 Ga0495659_0163231
645 Ga0495588_0266926
646 Ga0495658_0307116
647 Ga0495658_0640636
648 Ga0495589_0319983
649 Ga0495589_0562698
650 Ga0495674_0395165
651 Ga0495602_0573372
652 Ga0495615_0132355
653 Ga0496100_0036846
654 Ga0496101_0078331
655 Ga0496101_1195755
656 Ga0496102_0035747
657 Ga0496103_0022071
658 Ga0496104_0230746
659 Ga0496104_0512650
660 Ga0496105_0142120
661 Ga0496105_0264548
662 Ga0496105_0547850
663 Ga0496105_0648134
664 Ga0496105_1000864
665 Ga0496106_0001780
666 Ga0496108_0531067
667 Ga0496108_0693074
668 Ga0496108_1059354
669 Ga0496109_0050303
670 Ga0496109_0401637
671 Ga0496109_0762057
672 Ga0496110_0007895
673 Ga0496110_0267060
674 Ga0496110_0564143
675 Ga0496111_0037728
676 Ga0496111_0249424
677 Ga0496111_1330268
678 Ga0496112_0239451
679 Ga0496112_0554808
680 Ga0496112_0920379
681 Ga0496113_0016018
682 Ga0496114_0029756
683 Ga0496114_0069113
684 Ga0496114_0217280
685 Ga0496115_0050995
686 Ga0496115_0718221
687 Ga0501031_0219883
688 Ga0501031_0359679
689 Ga0501032_0036522
690 Ga0501032_0107006
691 Ga0501033_0019229
692 Ga0501033_0352975
693 Ga0501036_0421636
694 Ga0501036_0595684
695 Ga0501038_0039708
696 Ga0501038_0432171
697 Ga0501038_0690766
698 Ga0501039_0037923
699 Ga0501039_0269755
700 Ga0501039_0590004
701 Ga0501039_1444100
702 Ga0501040_0011123
703 Ga0501040_0025092
704 Ga0501040_0122370
705 Ga0501040_1363206
706 Ga0501041_0004358
707 Ga0501041_0093688
708 Ga0501041_1124768
709 Ga0501042_0005349
710 Ga0501042_0025482
711 Ga0501042_0124128
712 Ga0501042_0731859
713 Ga0501043_0108481
714 Ga0501046_0031932
715 Ga0501046_0370412
716 Ga0501046_0411681
717 Ga0501046_0862547
718 Ga0501048_0019871
719 Ga0501048_0261381
720 Ga0501048_1410956
721 Ga0501068_0017170
722 Ga0501068_1120247
723 Ga0501069_0147945
724 Ga0501070_0161017
725 Ga0501070_0214579
726 Ga0501071_0017473
727 Ga0501071_0043322
728 Ga0501071_0355959
729 Ga0501071_0784595
730 Ga0501071_0878556
731 Ga0501071_1172145
732 Ga0501072_0001074
733 Ga0501072_0273398
734 Ga0501072_0553897
735 Ga0501072_1375957
736 Ga0501073_0112194
737 Ga0501073_0216151
738 Ga0501074_0059226
739 Ga0501074_0283116
740 Ga0501075_0044272
741 Ga0501075_0048575
742 Ga0501075_0171649
743 Ga0501075_0288597
744 Ga0501075_1087968
745 Ga0501076_0002037
746 Ga0501076_0048628
747 Ga0501076_0154388
748 Ga0501076_0699896
749 Ga0501077_0006981
750 Ga0501077_0028471
751 Ga0501077_0126236
752 Ga0501077_0166648
753 Ga0501077_0178335
754 Ga0501077_0523816
755 Ga0501079_0001804
756 Ga0501079_0023108
757 Ga0501079_0146077
758 Ga0501080_0103453
759 Ga0501080_0225945
760 Ga0501080_0735711
761 Ga0501080_1105164
762 Ga0501081_0002825
763 Ga0501081_0143009
764 Ga0501081_0434649
765 Ga0501081_0514447
766 Ga0501083_0042582
767 Ga0501035_0036705
768 Ga0501035_1227229
769 Ga0501044_0390856
770 Ga0501044_0569002
771 Ga0501045_0000404
772 Ga0501045_0001212
773 Ga0501045_0128433
774 Ga0501045_0304713
775 nmdc:mga05p37_2218116_c1
776 nmdc:mga0n895_1643876_c1
777 nmdc:mga08x19_57177_c1
778 Ga0495601_0102996
779 Ga0495595_0069365
780 Ga0495619_0089945
781 Ga0501084_0026068
782 Ga0501084_0269475
783 Ga0501084_0282869
784 Ga0501084_0472851
785 Ga0501084_1100146
786 Ga0501084_1604736
787 Ga0590071_048654
788 Ga0590074_100807
789 Ga0590075_008580
790 Ga0590075_013182
791 Ga0590077_013046
792 Ga0501082_0006028
793 Ga0501082_0429356
794 Ga0466962_0005019
795 Ga0530510_0029090
796 Ga0530510_0526202
797 Ga0530510_0634948
798 Ga0530510_1204997

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00403

HMA

Heavy-metal-associated domain

7

67

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2l3m-assembly1.cif.gz_A solution structure of the putative copper-ion-binding protein from bacillus anthracis str. ames 0.9426 2 69
2qif-assembly1.cif.gz_A crystal structure of a metallochaperone with a tetranuclear cu(i) cluster 0.9421 4 70
3dxs-assembly1.cif.gz_X crystal structure of a copper binding domain from hma7, a p-type atpase 0.9411 4 69
6ff2-assembly1.cif.gz_B copz metallochaperone 0.9409 4 69
1osd-assembly2.cif.gz_B crystal structure of oxidized merp from ralstonia metallidurans ch34 0.9357 2 69
ID Description Score Start End Superfamily
af_A0A0R0FZY9_20_89_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9516 1 69 3.30.70.100
af_Q54Q77_94_172_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9488 5 69 3.30.70.100
af_Q55DN5_348_418_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9447 3 69 3.30.70.100
af_I1JA65_34_107_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9426 3 69 3.30.70.100
6ff2B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9409 4 69 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A538CPG0-F1-model_v4 Cation transporter 0.9927 2 68 GO:0046872
AF-A0A538F2S3-F1-model_v4 Heavy-metal-associated domain-containing protein 0.9903 3 69 GO:0046872
AF-A0A538HAC1-F1-model_v4 Cation transporter 0.9815 1 70 GO:0046872
AF-A0A538JY47-F1-model_v4 Cation transporter 0.981 3 68 GO:0046872
AF-A0A7V9M9A0-F1-model_v4 Cation transporter 0.9804 3 70 GO:0046872

Map