F434255

General Info

Members Datasets Scaffolds Average Seq Length
399 244 798 90

Family's Representative Sequence

Representative Sequence 3300005719|Ga0068861_100753392|Ga0068861_1007533922
Length 105
Sequence VPSSIGTCVGRGYTGVVDSNAFERQLRQEGFRHVYVWQDGAHAFYPDHTHSMDTAHIILEGEMTLTCGGSTHTYKTGERPPDVPAGAVHSARMGPSGCRYLIGEK

Samples

Sample ID Description Type Environment
1 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
131 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
132 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
134 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
135 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
136 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
137 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
138 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
139 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
140 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
141 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
144 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
158 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
159 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
160 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
161 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
162 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
163 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
164 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
172 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
173 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
174 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
175 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
176 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
177 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
178 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
179 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
180 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
181 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
182 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
183 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
184 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
185 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
186 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
187 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
188 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
189 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
190 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
191 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
192 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
193 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
194 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
195 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
196 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
197 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
198 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
199 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
200 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
201 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
202 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
203 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
204 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
205 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
206 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
207 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
208 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
209 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
210 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
211 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
212 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
213 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
214 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
215 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
216 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
217 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
218 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
219 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
220 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
221 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
222 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
223 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
224 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
225 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
226 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
227 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
228 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
232 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
233 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
234 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
235 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
236 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
237 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
238 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
239 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
240 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
241 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
242 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
243 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
244 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.5
Rhizosphere 98.5
Stem 0
Stem Tuber 0
Unclassified 29.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068861_100753392 3300005719 Bacteria 910
2 JGI24746J21847_1019435 3300001977 Bacteria 957
3 JGI24034J26672_10108041 3300002239 Bacteria 529
4 Ga0065714_10151351 3300005288 Unclassified 1104
5 Ga0065715_10378466 3300005293 Bacteria 911
6 Ga0070676_10037833 3300005328 Bacteria 2784
7 Ga0070676_10237704 3300005328 Bacteria 1210
8 Ga0070676_10610383 3300005328 Bacteria 788
9 Ga0070670_100150208 3300005331 Bacteria 2016
10 Ga0070677_10014158 3300005333 Bacteria 2802
11 Ga0068869_100336513 3300005334 Bacteria 1227
12 Ga0070666_10029251 3300005335 Bacteria 3620
13 Ga0068868_100082105 3300005338 Bacteria 2585
14 Ga0070689_100350907 3300005340 Unclassified 1237
15 Ga0070687_100050783 3300005343 Bacteria 2144
16 Ga0070687_100622159 3300005343 Bacteria 745
17 Ga0070661_100205280 3300005344 Unclassified 1507
18 Ga0070692_10149007 3300005345 Bacteria 1331
19 Ga0070668_100247437 3300005347 Unclassified 1479
20 Ga0070669_100062556 3300005353 Bacteria 2737
21 Ga0070669_100186311 3300005353 Unclassified 1626
22 Ga0070669_100474286 3300005353 Unclassified 1034
23 Ga0070675_100034152 3300005354 Bacteria 4126
24 Ga0070675_100378529 3300005354 Bacteria 1259
25 Ga0070675_100491012 3300005354 Unclassified 1105
26 Ga0070675_100749009 3300005354 Bacteria 891
27 Ga0070675_100804716 3300005354 Bacteria 859
28 Ga0070675_101420322 3300005354 Bacteria 640
29 Ga0070671_100090820 3300005355 Bacteria 2557
30 Ga0070671_100107537 3300005355 Bacteria 2342
31 Ga0070673_100083920 3300005364 Bacteria 2589
32 Ga0070673_100417057 3300005364 Bacteria 1203
33 Ga0070673_100880919 3300005364 Unclassified 829
34 Ga0070688_100012016 3300005365 Bacteria 4836
35 Ga0070688_100027761 3300005365 Bacteria 3372
36 Ga0070659_100813981 3300005366 Unclassified 813
37 Ga0070659_101270942 3300005366 Bacteria 652
38 Ga0070667_100534553 3300005367 Unclassified 1076
39 Ga0070667_100685619 3300005367 Bacteria 947
40 Ga0070709_10197535 3300005434 Unclassified 1423
41 Ga0070709_10691617 3300005434 Archaea 793
42 Ga0070714_100057865 3300005435 Unclassified 3319
43 Ga0070714_100594106 3300005435 Unclassified 1063
44 Ga0070710_10732720 3300005437 Unclassified 700
45 Ga0070701_10459677 3300005438 Bacteria 819
46 Ga0070701_10714486 3300005438 Unclassified 675
47 Ga0070711_100262139 3300005439 Bacteria 1360
48 Ga0070711_100988176 3300005439 Unclassified 722
49 Ga0070705_101206793 3300005440 Unclassified 623
50 Ga0070700_100040661 3300005441 Unclassified 2847
51 Ga0070700_100202503 3300005441 Unclassified 1395
52 Ga0070700_100503892 3300005441 Bacteria 932
53 Ga0070708_100103741 3300005445 Unclassified 2607
54 Ga0070663_100514108 3300005455 Unclassified 996
55 Ga0070663_100586445 3300005455 Bacteria 936
56 Ga0070678_100236696 3300005456 Bacteria 1525
57 Ga0070662_100106688 3300005457 Bacteria 2128
58 Ga0070662_100346381 3300005457 Unclassified 1216
59 Ga0070681_11515796 3300005458 Unclassified 595
60 Ga0068867_100034733 3300005459 Bacteria 3657
61 Ga0070685_10011189 3300005466 Bacteria 4692
62 Ga0070698_101817815 3300005471 Bacteria 562
63 Ga0070699_100034920 3300005518 Bacteria 4345
64 Ga0070699_100498693 3300005518 Unclassified 1106
65 Ga0070699_101023916 3300005518 Unclassified 757
66 Ga0070699_101166044 3300005518 Bacteria 707
67 Ga0070697_100052541 3300005536 Bacteria 3311
68 Ga0070672_100040874 3300005543 Bacteria 3561
69 Ga0070672_100360104 3300005543 Unclassified 1241
70 Ga0070672_100735737 3300005543 Bacteria 865
71 Ga0070695_100569153 3300005545 Unclassified 885
72 Ga0070665_100178451 3300005548 Bacteria 2125
73 Ga0070665_100351421 3300005548 Bacteria 1480
74 Ga0070704_100570070 3300005549 Bacteria 991
75 Ga0070704_100987122 3300005549 Bacteria 761
76 Ga0070664_100003542 3300005564 Bacteria 12610
77 Ga0070664_100024597 3300005564 Bacteria 4983
78 Ga0068857_100267386 3300005577 Unclassified 1571
79 Ga0068859_100402115 3300005617 Bacteria 1465
80 Ga0068859_100652580 3300005617 Bacteria 1144
81 Ga0068859_102062181 3300005617 Unclassified 630
82 Ga0068861_100525635 3300005719 Bacteria 1074
83 Ga0068851_10146892 3300005834 Bacteria 1286
84 Ga0068870_10031212 3300005840 Unclassified 2698
85 Ga0068870_10886429 3300005840 Bacteria 629
86 Ga0068863_100263567 3300005841 Bacteria 1666
87 Ga0068863_100833736 3300005841 Bacteria 920
88 Ga0068858_100164142 3300005842 Unclassified 2092
89 Ga0068860_100781603 3300005843 Bacteria 967
90 Ga0068862_100518639 3300005844 Bacteria 1134
91 Ga0068862_100521094 3300005844 Bacteria 1131
92 Ga0068862_100748602 3300005844 Bacteria 950
93 Ga0068862_100917571 3300005844 Unclassified 862
94 Ga0070717_10047589 3300006028 Bacteria 3515
95 Ga0070717_11076007 3300006028 Unclassified 732
96 Ga0070716_100989141 3300006173 Unclassified 664
97 Ga0097621_100075851 3300006237 Bacteria 2788
98 Ga0068871_100126080 3300006358 Bacteria 2167
99 Ga0068871_100564708 3300006358 Unclassified 1032
100 Ga0075428_100506052 3300006844 Bacteria 1292
101 Ga0075431_100004422 3300006847 Bacteria 13779
102 Ga0075431_100297845 3300006847 Bacteria 1630
103 Ga0075433_10275425 3300006852 Bacteria 1491
104 Ga0075434_100273850 3300006871 Unclassified 1707
105 Ga0075434_100437767 3300006871 Bacteria 1328
106 Ga0075429_100000393 3300006880 Bacteria 32106
107 Ga0075429_100395458 3300006880 Bacteria 1210
108 Ga0075429_100908666 3300006880 Unclassified 770
109 Ga0068865_100184861 3300006881 Unclassified 1607
110 Ga0075436_100014148 3300006914 Bacteria 5462
111 Ga0097620_100402099 3300006931 Bacteria 1465
112 Ga0097620_100652659 3300006931 Bacteria 1144
113 Ga0097620_102062167 3300006931 Unclassified 630
114 Ga0075435_100310563 3300007076 Bacteria 1349
115 Ga0075435_100590784 3300007076 Bacteria 963
116 Ga0075435_100890593 3300007076 Bacteria 776
117 Ga0105240_10352625 3300009093 Bacteria 1669
118 Ga0111539_10004119 3300009094 Bacteria 19078
119 Ga0111539_10185788 3300009094 Bacteria 2427
120 Ga0111539_10248941 3300009094 Bacteria 2069
121 Ga0111539_11307607 3300009094 Unclassified 841
122 Ga0111539_11358691 3300009094 Bacteria 824
123 Ga0111539_11840805 3300009094 Unclassified 702
124 Ga0111539_11866867 3300009094 Unclassified 697
125 Ga0105245_11764598 3300009098 Bacteria 671
126 Ga0105245_13207403 3300009098 Bacteria 507
127 Ga0114129_11235865 3300009147 Bacteria 929
128 Ga0105248_10452652 3300009177 Unclassified 1446
129 Ga0105249_13076980 3300009553 Bacteria 536
130 Ga0105246_10160388 3300011119 Bacteria 1712
131 Ga0157374_10097326 3300013296 Bacteria 2816
132 Ga0157374_10181459 3300013296 Unclassified 2056
133 Ga0157374_10260579 3300013296 Bacteria 1708
134 Ga0163162_10003128 3300013306 Bacteria 15810
135 Ga0163162_11060774 3300013306 Bacteria 917
136 Ga0163162_11376719 3300013306 Unclassified 802
137 Ga0163162_12413196 3300013306 Bacteria 605
138 Ga0157375_10288885 3300013308 Bacteria 1803
139 Ga0163163_10033823 3300014325 Bacteria 4948
140 Ga0163163_10048890 3300014325 Bacteria 4161
141 Ga0163163_10311769 3300014325 Bacteria 1626
142 Ga0157380_10027716 3300014326 Unclassified 4310
143 Ga0157380_10047861 3300014326 Bacteria 3365
144 Ga0157380_10340576 3300014326 Bacteria 1399
145 Ga0157380_10510832 3300014326 Bacteria 1170
146 Ga0157380_11231839 3300014326 Bacteria 793
147 Ga0157377_10267194 3300014745 Bacteria 1115
148 Ga0157377_11624423 3300014745 Bacteria 519
149 Ga0157379_10435514 3300014968 Bacteria 1209
150 Ga0157379_10523953 3300014968 Bacteria 1100
151 Ga0157376_10497895 3300014969 Unclassified 1197
152 Ga0207697_10002680 3300025315 Bacteria 9103
153 Ga0207682_10003179 3300025893 Bacteria 7195
154 Ga0207685_10331164 3300025905 Unclassified 762
155 Ga0207699_10090654 3300025906 Unclassified 1918
156 Ga0207699_10229893 3300025906 Archaea 1270
157 Ga0207645_10003053 3300025907 Bacteria 12870
158 Ga0207645_10286454 3300025907 Bacteria 1095
159 Ga0207643_10001361 3300025908 Bacteria 14114
160 Ga0207643_10209991 3300025908 Unclassified 1188
161 Ga0207695_10530411 3300025913 Unclassified 1059
162 Ga0207663_10178910 3300025916 Bacteria 1513
163 Ga0207663_11542570 3300025916 Unclassified 535
164 Ga0207662_10000549 3300025918 Bacteria 16650
165 Ga0207662_10553487 3300025918 Bacteria 797
166 Ga0207649_10109427 3300025920 Bacteria 1843
167 Ga0207646_11467492 3300025922 Unclassified 591
168 Ga0207681_10047071 3300025923 Bacteria 2903
169 Ga0207681_10632487 3300025923 Bacteria 886
170 Ga0207681_10674234 3300025923 Unclassified 858
171 Ga0207681_11354018 3300025923 Archaea 598
172 Ga0207650_10006731 3300025925 Bacteria 7834
173 Ga0207650_10614350 3300025925 Unclassified 915
174 Ga0207659_10579739 3300025926 Bacteria 955
175 Ga0207659_10908734 3300025926 Unclassified 757
176 Ga0207700_10962216 3300025928 Unclassified 764
177 Ga0207664_10015423 3300025929 Bacteria 5546
178 Ga0207664_10138423 3300025929 Unclassified 2056
179 Ga0207644_10099280 3300025931 Bacteria 2184
180 Ga0207644_10673356 3300025931 Unclassified 862
181 Ga0207690_10253580 3300025932 Bacteria 1360
182 Ga0207706_10001893 3300025933 Bacteria 20555
183 Ga0207706_10081144 3300025933 Bacteria 2850
184 Ga0207706_10099962 3300025933 Unclassified 2552
185 Ga0207670_10064481 3300025936 Bacteria 2511
186 Ga0207669_11137817 3300025937 Bacteria 660
187 Ga0207704_10309091 3300025938 Unclassified 1214
188 Ga0207691_10029058 3300025940 Bacteria 5172
189 Ga0207691_10068956 3300025940 Bacteria 3195
190 Ga0207691_10702895 3300025940 Bacteria 852
191 Ga0207711_11215741 3300025941 Bacteria 695
192 Ga0207689_10855686 3300025942 Bacteria 767
193 Ga0207679_10004159 3300025945 Bacteria 8991
194 Ga0207651_10024298 3300025960 Bacteria 3746
195 Ga0207651_10112384 3300025960 Bacteria 2047
196 Ga0207651_10908487 3300025960 Bacteria 784
197 Ga0207712_10271024 3300025961 Bacteria 1381
198 Ga0207668_10212640 3300025972 Unclassified 1548
199 Ga0207658_10201702 3300025986 Unclassified 1661
200 Ga0207658_11345555 3300025986 Bacteria 653
201 Ga0207677_10599455 3300026023 Bacteria 966
202 Ga0207703_10556038 3300026035 Bacteria 1082
203 Ga0207678_10145603 3300026067 Unclassified 2022
204 Ga0207678_10213615 3300026067 Bacteria 1650
205 Ga0207708_10003433 3300026075 Bacteria 11679
206 Ga0207708_10884980 3300026075 Bacteria 772
207 Ga0207708_11134075 3300026075 Bacteria 682
208 Ga0207641_10028497 3300026088 Bacteria 4615
209 Ga0207641_10866597 3300026088 Bacteria 896
210 Ga0207648_10253679 3300026089 Bacteria 1568
211 Ga0207648_10984881 3300026089 Unclassified 789
212 Ga0207676_10163189 3300026095 Bacteria 1933
213 Ga0207674_10224211 3300026116 Bacteria 1828
214 Ga0207675_100003723 3300026118 Bacteria 14848
215 Ga0207675_100488513 3300026118 Bacteria 1224
216 Ga0207675_100891208 3300026118 Bacteria 906
217 Ga0207683_10043207 3300026121 Bacteria 3938
218 Ga0207683_10588727 3300026121 Bacteria 1029
219 Ga0207698_10163185 3300026142 Bacteria 1952
220 Ga0209588_1026336 3300027671 Unclassified 1846
221 Ga0209971_1130380 3300027682 Unclassified 619
222 Ga0209974_10408996 3300027876 Unclassified 534
223 Ga0207428_10081626 3300027907 Bacteria 2524
224 Ga0207428_10142628 3300027907 Bacteria 1827
225 Ga0268266_10158827 3300028379 Bacteria 2044
226 Ga0268265_10641315 3300028380 Bacteria 1020
227 Ga0268265_10932025 3300028380 Bacteria 854
228 Ga0268264_11387230 3300028381 Unclassified 713
229 Ga0265318_10000164 3300028577 Bacteria 58752
230 Ga0265338_10003807 3300028800 Bacteria 20965
231 Ga0265338_10018534 3300028800 Bacteria 7447
232 Ga0265338_10249779 3300028800 Unclassified 1309
233 Ga0265770_1104049 3300030878 Bacteria 581
234 Ga0265332_10018830 3300031238 Bacteria 3049
235 Ga0265328_10072734 3300031239 Bacteria 1264
236 Ga0265320_10000098 3300031240 Bacteria 73999
237 Ga0265325_10000508 3300031241 Bacteria 28188
238 Ga0265325_10021336 3300031241 Bacteria 3559
239 Ga0265325_10076565 3300031241 Unclassified 1669
240 Ga0265329_10000375 3300031242 Bacteria 23650
241 Ga0265340_10001899 3300031247 Bacteria 11912
242 Ga0265339_10002714 3300031249 Bacteria 12581
243 Ga0265331_10000081 3300031250 Bacteria 136351
244 Ga0265316_10205235 3300031344 Unclassified 1460
245 Ga0307408_100132049 3300031548 Bacteria 1949
246 Ga0307408_100529237 3300031548 Bacteria 1037
247 Ga0265313_10000761 3300031595 Bacteria 32812
248 Ga0265313_10247341 3300031595 Unclassified 728
249 Ga0265342_10001101 3300031712 Bacteria 25982
250 Ga0307405_10280279 3300031731 Unclassified 1254
251 Ga0307413_10018402 3300031824 Bacteria 3665
252 Ga0307410_10117753 3300031852 Unclassified 1932
253 Ga0307406_10053860 3300031901 Bacteria 2565
254 Ga0307407_10029832 3300031903 Bacteria 2935
255 Ga0307412_10145287 3300031911 Bacteria 1742
256 Ga0307409_100180710 3300031995 Bacteria 1867
257 Ga0307409_100322551 3300031995 Unclassified 1446
258 Ga0307416_100247936 3300032002 Bacteria 1731
259 Ga0307416_101794093 3300032002 Unclassified 717
260 Ga0307414_10276898 3300032004 Unclassified 1408
261 Ga0307411_10061383 3300032005 Bacteria 2502
262 Ga0307411_10947937 3300032005 Unclassified 767
263 Ga0307415_100138778 3300032126 Bacteria 1853
264 Ga0307415_100172640 3300032126 Unclassified 1687
265 Ga0373923_0054644 3300035111 Bacteria 1681
266 Ga0373941_0123664 3300035115 Bacteria 925
267 Ga0373954_0056381 3300035118 Bacteria 1849
268 Ga0373957_0080312 3300035120 Bacteria 1287
269 Ga0373943_0640329 3300035170 Unclassified 628
270 Ga0373955_0204842 3300035172 Bacteria 1175
271 Ga0373942_0047472 3300035207 Bacteria 1193
272 Ga0373961_0224208 3300035241 Unclassified 671
273 Ga0373924_0078139 3300035410 Bacteria 1404
274 Ga0373931_0499658 3300035691 Unclassified 784
275 Ga0373935_0008118 3300035692 Bacteria 6292
276 Ga0373927_0014290 3300035695 Bacteria 5260
277 Ga0373947_0039581 3300035725 Unclassified 2805
278 Ga0373937_0016234 3300036401 Bacteria 6608
279 Ga0373937_0733718 3300036401 Bacteria 935
280 Ga0373925_0088791 3300037068 Bacteria 2361
281 Ga0436362_1158361 3300039453 Unclassified 573
282 Ga0439439_0062484 3300041406 Unclassified 990
283 Ga0439450_011285 3300042008 Unclassified 1747
284 Ga0439434_0127435 3300042435 Unclassified 833
285 Ga0439435_0163393 3300042436 Bacteria 720
286 Ga0439464_0039980 3300042439 Unclassified 1335
287 Ga0451577_0010385 3300042876 Bacteria 8906
288 Ga0451577_0022164 3300042876 Bacteria 5801
289 Ga0439440_0110596 3300042993 Bacteria 756
290 Ga0453683_0007960 3300044673 Bacteria 7140
291 Ga0453683_0012711 3300044673 Bacteria 5512
292 Ga0453683_0031215 3300044673 Bacteria 3366
293 Ga0453683_0928438 3300044673 Unclassified 576
294 Ga0466961_0506242 3300044693 Unclassified 729
295 Ga0453684_0082507 3300044712 Bacteria 4004
296 Ga0453684_0692038 3300044712 Bacteria 1109
297 Ga0453684_0971249 3300044712 Bacteria 905
298 Ga0466959_0555657 3300045049 Unclassified 774
299 Ga0451576_0035657 3300045051 Bacteria 5276
300 Ga0451576_0330973 3300045051 Bacteria 1594
301 Ga0495592_0007694 3300046454 Bacteria 8064
302 Ga0495592_0122946 3300046454 Bacteria 1823
303 Ga0495641_0477953 3300046461 Unclassified 568
304 Ga0495651_0001039 3300046462 Bacteria 21448
305 Ga0495651_0058668 3300046462 Unclassified 2952
306 Ga0495653_0000966 3300046463 Bacteria 22056
307 Ga0495653_0111282 3300046463 Bacteria 1967
308 Ga0495580_0013512 3300046472 Bacteria 6225
309 Ga0495582_0428775 3300046473 Unclassified 763
310 Ga0495664_0136920 3300046477 Bacteria 1484
311 Ga0495608_0016153 3300046511 Bacteria 5163
312 Ga0495608_0023254 3300046511 Bacteria 4248
313 Ga0495618_0381129 3300046514 Bacteria 865
314 Ga0495628_0007786 3300046516 Bacteria 9237
315 Ga0495628_0008224 3300046516 Bacteria 8972
316 Ga0495628_0211428 3300046516 Bacteria 1459
317 Ga0495628_0328745 3300046516 Bacteria 1127
318 Ga0495630_0037643 3300046517 Bacteria 3617
319 Ga0495630_0058263 3300046517 Bacteria 2895
320 Ga0495630_1008167 3300046517 Bacteria 633
321 Ga0495666_0376839 3300046526 Bacteria 638
322 Ga0495652_0002599 3300046529 Bacteria 18460
323 Ga0495652_0038106 3300046529 Bacteria 4166
324 Ga0495665_0010825 3300046531 Bacteria 4935
325 Ga0495640_0025640 3300046533 Bacteria 4272
326 Ga0495640_0813145 3300046533 Unclassified 557
327 Ga0495586_0011126 3300046535 Bacteria 4781
328 Ga0495587_0002492 3300046536 Bacteria 12290
329 Ga0495587_0006776 3300046536 Bacteria 7457
330 Ga0495598_0139617 3300046537 Unclassified 838
331 Ga0495621_0188750 3300046539 Bacteria 825
332 Ga0495645_0024087 3300046543 Unclassified 4414
333 Ga0495645_0031446 3300046543 Unclassified 3868
334 Ga0495667_0002530 3300046559 Bacteria 12204
335 Ga0495667_0116641 3300046559 Bacteria 1725
336 Ga0495667_0388799 3300046559 Unclassified 879
337 Ga0495656_0125042 3300046615 Bacteria 1218
338 Ga0495634_0010272 3300046642 Bacteria 6860
339 Ga0495634_0781251 3300046642 Bacteria 545
340 Ga0495635_0014159 3300046663 Bacteria 5581
341 Ga0495588_0245652 3300046674 Bacteria 944
342 Ga0495657_0001853 3300046675 Bacteria 18018
343 Ga0495657_0048946 3300046675 Bacteria 2849
344 Ga0495599_0035777 3300046678 Bacteria 3117
345 Ga0495623_0000992 3300046679 Bacteria 19141
346 Ga0495623_0138403 3300046679 Bacteria 1451
347 Ga0495646_0001860 3300046680 Bacteria 12695
348 Ga0495613_0034711 3300046689 Unclassified 3745
349 Ga0495624_0003356 3300046690 Bacteria 11898
350 Ga0495670_0073248 3300046691 Unclassified 1736
351 Ga0495604_0047428 3300047317 Bacteria 3345
352 Ga0495604_0177402 3300047317 Bacteria 1492
353 Ga0495604_0536830 3300047317 Unclassified 755
354 Ga0495674_0005180 3300047319 Bacteria 12521
355 Ga0495674_0386666 3300047319 Bacteria 1131
356 Ga0495680_0001866 3300047322 Bacteria 22167
357 Ga0495680_0216681 3300047322 Unclassified 1368
358 Ga0495675_0000084 3300047444 Bacteria 66406
359 Ga0495675_0010540 3300047444 Bacteria 5777
360 Ga0495675_0014331 3300047444 Bacteria 5008
361 Ga0495684_0010622 3300047471 Bacteria 7117
362 Ga0495684_0020125 3300047471 Bacteria 5139
363 Ga0495602_0033898 3300048088 Bacteria 4784
364 Ga0495602_0067076 3300048088 Bacteria 3088
365 Ga0495614_0055868 3300048089 Bacteria 1693
366 Ga0496104_0670726 3300048907 Bacteria 945
367 Ga0496104_0899988 3300048907 Bacteria 790
368 Ga0496106_0432718 3300048909 Bacteria 1057
369 Ga0496109_0311617 3300048912 Unclassified 1485
370 Ga0496112_0154777 3300048915 Bacteria 2260
371 Ga0496115_0220810 3300048918 Bacteria 1564
372 Ga0501036_0582720 3300049572 Bacteria 929
373 Ga0501038_1336132 3300049574 Unclassified 517
374 Ga0501042_0917087 3300049578 Unclassified 638
375 Ga0501075_0334689 3300049591 Bacteria 1154
376 Ga0501076_0542750 3300049592 Unclassified 959
377 Ga0501045_0550255 3300049824 Unclassified 856
378 Ga0501045_1417470 3300049824 Unclassified 504
379 nmdc:mga05p37_922224_c1 3300050507 Bacteria 939
380 nmdc:mga09592_710025_c1 3300050508 Bacteria 855
381 nmdc:mga09592_8497_c1 3300050508 Bacteria 8350
382 nmdc:mga0qj67_281571_c1 3300050509 Bacteria 1348
383 nmdc:mga0qj67_391437_c1 3300050509 Bacteria 1122
384 nmdc:mga06r32_118039_c1 3300050510 Bacteria 2615
385 nmdc:mga08y16_304836_c1 3300050511 Bacteria 1641
386 nmdc:mga08y16_487643_c1 3300050511 Unclassified 1254
387 nmdc:mga08y16_577898_c1 3300050511 Bacteria 1135
388 nmdc:mga08y16_826840_c1 3300050511 Bacteria 917
389 nmdc:mga08y16_83615_c1 3300050511 Bacteria 3327
390 nmdc:mga08y16_842597_c1 3300050511 Unclassified 907
391 nmdc:mga0n895_1238632_c1 3300050512 Unclassified 719
392 nmdc:mga0n895_590988_c1 3300050512 Bacteria 1113
393 nmdc:mga0rr50_528445_c1 3300050513 Unclassified 1004
394 nmdc:mga0rr50_668901_c1 3300050513 Bacteria 886
395 nmdc:mga0rr50_707145_c1 3300050513 Unclassified 860
396 nmdc:mga08x19_913274_c1 3300050514 Unclassified 624
397 nmdc:mga0a205_27646_c1 3300050515 Bacteria 5417
398 Ga0495601_0009939 3300053077 Bacteria 5640
399 Ga0495612_0001224 3300053078 Bacteria 10581
400 Ga0068861_100753392
401 JGI24746J21847_1019435
402 JGI24034J26672_10108041
403 Ga0065714_10151351
404 Ga0065715_10378466
405 Ga0070676_10037833
406 Ga0070676_10237704
407 Ga0070676_10610383
408 Ga0070670_100150208
409 Ga0070677_10014158
410 Ga0068869_100336513
411 Ga0070666_10029251
412 Ga0068868_100082105
413 Ga0070689_100350907
414 Ga0070687_100050783
415 Ga0070687_100622159
416 Ga0070661_100205280
417 Ga0070692_10149007
418 Ga0070668_100247437
419 Ga0070669_100062556
420 Ga0070669_100186311
421 Ga0070669_100474286
422 Ga0070675_100034152
423 Ga0070675_100378529
424 Ga0070675_100491012
425 Ga0070675_100749009
426 Ga0070675_100804716
427 Ga0070675_101420322
428 Ga0070671_100090820
429 Ga0070671_100107537
430 Ga0070673_100083920
431 Ga0070673_100417057
432 Ga0070673_100880919
433 Ga0070688_100012016
434 Ga0070688_100027761
435 Ga0070659_100813981
436 Ga0070659_101270942
437 Ga0070667_100534553
438 Ga0070667_100685619
439 Ga0070709_10197535
440 Ga0070709_10691617
441 Ga0070714_100057865
442 Ga0070714_100594106
443 Ga0070710_10732720
444 Ga0070701_10459677
445 Ga0070701_10714486
446 Ga0070711_100262139
447 Ga0070711_100988176
448 Ga0070705_101206793
449 Ga0070700_100040661
450 Ga0070700_100202503
451 Ga0070700_100503892
452 Ga0070708_100103741
453 Ga0070663_100514108
454 Ga0070663_100586445
455 Ga0070678_100236696
456 Ga0070662_100106688
457 Ga0070662_100346381
458 Ga0070681_11515796
459 Ga0068867_100034733
460 Ga0070685_10011189
461 Ga0070698_101817815
462 Ga0070699_100034920
463 Ga0070699_100498693
464 Ga0070699_101023916
465 Ga0070699_101166044
466 Ga0070697_100052541
467 Ga0070672_100040874
468 Ga0070672_100360104
469 Ga0070672_100735737
470 Ga0070695_100569153
471 Ga0070665_100178451
472 Ga0070665_100351421
473 Ga0070704_100570070
474 Ga0070704_100987122
475 Ga0070664_100003542
476 Ga0070664_100024597
477 Ga0068857_100267386
478 Ga0068859_100402115
479 Ga0068859_100652580
480 Ga0068859_102062181
481 Ga0068861_100525635
482 Ga0068851_10146892
483 Ga0068870_10031212
484 Ga0068870_10886429
485 Ga0068863_100263567
486 Ga0068863_100833736
487 Ga0068858_100164142
488 Ga0068860_100781603
489 Ga0068862_100518639
490 Ga0068862_100521094
491 Ga0068862_100748602
492 Ga0068862_100917571
493 Ga0070717_10047589
494 Ga0070717_11076007
495 Ga0070716_100989141
496 Ga0097621_100075851
497 Ga0068871_100126080
498 Ga0068871_100564708
499 Ga0075428_100506052
500 Ga0075431_100004422
501 Ga0075431_100297845
502 Ga0075433_10275425
503 Ga0075434_100273850
504 Ga0075434_100437767
505 Ga0075429_100000393
506 Ga0075429_100395458
507 Ga0075429_100908666
508 Ga0068865_100184861
509 Ga0075436_100014148
510 Ga0097620_100402099
511 Ga0097620_100652659
512 Ga0097620_102062167
513 Ga0075435_100310563
514 Ga0075435_100590784
515 Ga0075435_100890593
516 Ga0105240_10352625
517 Ga0111539_10004119
518 Ga0111539_10185788
519 Ga0111539_10248941
520 Ga0111539_11307607
521 Ga0111539_11358691
522 Ga0111539_11840805
523 Ga0111539_11866867
524 Ga0105245_11764598
525 Ga0105245_13207403
526 Ga0114129_11235865
527 Ga0105248_10452652
528 Ga0105249_13076980
529 Ga0105246_10160388
530 Ga0157374_10097326
531 Ga0157374_10181459
532 Ga0157374_10260579
533 Ga0163162_10003128
534 Ga0163162_11060774
535 Ga0163162_11376719
536 Ga0163162_12413196
537 Ga0157375_10288885
538 Ga0163163_10033823
539 Ga0163163_10048890
540 Ga0163163_10311769
541 Ga0157380_10027716
542 Ga0157380_10047861
543 Ga0157380_10340576
544 Ga0157380_10510832
545 Ga0157380_11231839
546 Ga0157377_10267194
547 Ga0157377_11624423
548 Ga0157379_10435514
549 Ga0157379_10523953
550 Ga0157376_10497895
551 Ga0207697_10002680
552 Ga0207682_10003179
553 Ga0207685_10331164
554 Ga0207699_10090654
555 Ga0207699_10229893
556 Ga0207645_10003053
557 Ga0207645_10286454
558 Ga0207643_10001361
559 Ga0207643_10209991
560 Ga0207695_10530411
561 Ga0207663_10178910
562 Ga0207663_11542570
563 Ga0207662_10000549
564 Ga0207662_10553487
565 Ga0207649_10109427
566 Ga0207646_11467492
567 Ga0207681_10047071
568 Ga0207681_10632487
569 Ga0207681_10674234
570 Ga0207681_11354018
571 Ga0207650_10006731
572 Ga0207650_10614350
573 Ga0207659_10579739
574 Ga0207659_10908734
575 Ga0207700_10962216
576 Ga0207664_10015423
577 Ga0207664_10138423
578 Ga0207644_10099280
579 Ga0207644_10673356
580 Ga0207690_10253580
581 Ga0207706_10001893
582 Ga0207706_10081144
583 Ga0207706_10099962
584 Ga0207670_10064481
585 Ga0207669_11137817
586 Ga0207704_10309091
587 Ga0207691_10029058
588 Ga0207691_10068956
589 Ga0207691_10702895
590 Ga0207711_11215741
591 Ga0207689_10855686
592 Ga0207679_10004159
593 Ga0207651_10024298
594 Ga0207651_10112384
595 Ga0207651_10908487
596 Ga0207712_10271024
597 Ga0207668_10212640
598 Ga0207658_10201702
599 Ga0207658_11345555
600 Ga0207677_10599455
601 Ga0207703_10556038
602 Ga0207678_10145603
603 Ga0207678_10213615
604 Ga0207708_10003433
605 Ga0207708_10884980
606 Ga0207708_11134075
607 Ga0207641_10028497
608 Ga0207641_10866597
609 Ga0207648_10253679
610 Ga0207648_10984881
611 Ga0207676_10163189
612 Ga0207674_10224211
613 Ga0207675_100003723
614 Ga0207675_100488513
615 Ga0207675_100891208
616 Ga0207683_10043207
617 Ga0207683_10588727
618 Ga0207698_10163185
619 Ga0209588_1026336
620 Ga0209971_1130380
621 Ga0209974_10408996
622 Ga0207428_10081626
623 Ga0207428_10142628
624 Ga0268266_10158827
625 Ga0268265_10641315
626 Ga0268265_10932025
627 Ga0268264_11387230
628 Ga0265318_10000164
629 Ga0265338_10003807
630 Ga0265338_10018534
631 Ga0265338_10249779
632 Ga0265770_1104049
633 Ga0265332_10018830
634 Ga0265328_10072734
635 Ga0265320_10000098
636 Ga0265325_10000508
637 Ga0265325_10021336
638 Ga0265325_10076565
639 Ga0265329_10000375
640 Ga0265340_10001899
641 Ga0265339_10002714
642 Ga0265331_10000081
643 Ga0265316_10205235
644 Ga0307408_100132049
645 Ga0307408_100529237
646 Ga0265313_10000761
647 Ga0265313_10247341
648 Ga0265342_10001101
649 Ga0307405_10280279
650 Ga0307413_10018402
651 Ga0307410_10117753
652 Ga0307406_10053860
653 Ga0307407_10029832
654 Ga0307412_10145287
655 Ga0307409_100180710
656 Ga0307409_100322551
657 Ga0307416_100247936
658 Ga0307416_101794093
659 Ga0307414_10276898
660 Ga0307411_10061383
661 Ga0307411_10947937
662 Ga0307415_100138778
663 Ga0307415_100172640
664 Ga0373923_0054644
665 Ga0373941_0123664
666 Ga0373954_0056381
667 Ga0373957_0080312
668 Ga0373943_0640329
669 Ga0373955_0204842
670 Ga0373942_0047472
671 Ga0373961_0224208
672 Ga0373924_0078139
673 Ga0373931_0499658
674 Ga0373935_0008118
675 Ga0373927_0014290
676 Ga0373947_0039581
677 Ga0373937_0016234
678 Ga0373937_0733718
679 Ga0373925_0088791
680 Ga0436362_1158361
681 Ga0439439_0062484
682 Ga0439450_011285
683 Ga0439434_0127435
684 Ga0439435_0163393
685 Ga0439464_0039980
686 Ga0451577_0010385
687 Ga0451577_0022164
688 Ga0439440_0110596
689 Ga0453683_0007960
690 Ga0453683_0012711
691 Ga0453683_0031215
692 Ga0453683_0928438
693 Ga0466961_0506242
694 Ga0453684_0082507
695 Ga0453684_0692038
696 Ga0453684_0971249
697 Ga0466959_0555657
698 Ga0451576_0035657
699 Ga0451576_0330973
700 Ga0495592_0007694
701 Ga0495592_0122946
702 Ga0495641_0477953
703 Ga0495651_0001039
704 Ga0495651_0058668
705 Ga0495653_0000966
706 Ga0495653_0111282
707 Ga0495580_0013512
708 Ga0495582_0428775
709 Ga0495664_0136920
710 Ga0495608_0016153
711 Ga0495608_0023254
712 Ga0495618_0381129
713 Ga0495628_0007786
714 Ga0495628_0008224
715 Ga0495628_0211428
716 Ga0495628_0328745
717 Ga0495630_0037643
718 Ga0495630_0058263
719 Ga0495630_1008167
720 Ga0495666_0376839
721 Ga0495652_0002599
722 Ga0495652_0038106
723 Ga0495665_0010825
724 Ga0495640_0025640
725 Ga0495640_0813145
726 Ga0495586_0011126
727 Ga0495587_0002492
728 Ga0495587_0006776
729 Ga0495598_0139617
730 Ga0495621_0188750
731 Ga0495645_0024087
732 Ga0495645_0031446
733 Ga0495667_0002530
734 Ga0495667_0116641
735 Ga0495667_0388799
736 Ga0495656_0125042
737 Ga0495634_0010272
738 Ga0495634_0781251
739 Ga0495635_0014159
740 Ga0495588_0245652
741 Ga0495657_0001853
742 Ga0495657_0048946
743 Ga0495599_0035777
744 Ga0495623_0000992
745 Ga0495623_0138403
746 Ga0495646_0001860
747 Ga0495613_0034711
748 Ga0495624_0003356
749 Ga0495670_0073248
750 Ga0495604_0047428
751 Ga0495604_0177402
752 Ga0495604_0536830
753 Ga0495674_0005180
754 Ga0495674_0386666
755 Ga0495680_0001866
756 Ga0495680_0216681
757 Ga0495675_0000084
758 Ga0495675_0010540
759 Ga0495675_0014331
760 Ga0495684_0010622
761 Ga0495684_0020125
762 Ga0495602_0033898
763 Ga0495602_0067076
764 Ga0495614_0055868
765 Ga0496104_0670726
766 Ga0496104_0899988
767 Ga0496106_0432718
768 Ga0496109_0311617
769 Ga0496112_0154777
770 Ga0496115_0220810
771 Ga0501036_0582720
772 Ga0501038_1336132
773 Ga0501042_0917087
774 Ga0501075_0334689
775 Ga0501076_0542750
776 Ga0501045_0550255
777 Ga0501045_1417470
778 nmdc:mga05p37_922224_c1
779 nmdc:mga09592_710025_c1
780 nmdc:mga09592_8497_c1
781 nmdc:mga0qj67_281571_c1
782 nmdc:mga0qj67_391437_c1
783 nmdc:mga06r32_118039_c1
784 nmdc:mga08y16_304836_c1
785 nmdc:mga08y16_487643_c1
786 nmdc:mga08y16_577898_c1
787 nmdc:mga08y16_826840_c1
788 nmdc:mga08y16_83615_c1
789 nmdc:mga08y16_842597_c1
790 nmdc:mga0n895_1238632_c1
791 nmdc:mga0n895_590988_c1
792 nmdc:mga0rr50_528445_c1
793 nmdc:mga0rr50_668901_c1
794 nmdc:mga0rr50_707145_c1
795 nmdc:mga08x19_913274_c1
796 nmdc:mga0a205_27646_c1
797 Ga0495601_0009939
798 Ga0495612_0001224

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lwc-assembly1.cif.gz_A-2 crystal structure of structural genomics, unknown function (yp_766765.1) from rhizobium leguminosarum bv. viciae 3841 at 1.40 a resolution 0.947 18 87
4e2g-assembly3.cif.gz_E crystal structure of cupin fold protein sthe2323 from sphaerobacter thermophilus 0.909 18 88
4la3-assembly2.cif.gz_B crystal structure of dimethylsulphoniopropionate (dmsp) lyase dddq y131a in complex with dmsp 0.9085 18 88
7nzq-assembly1.cif.gz_AAA d-lyxose isomerase from the hyperthermophilic archaeon thermofilum sp complexed with d-mannose 0.9079 18 88
5jsp-assembly1.cif.gz_A new mechanistic insight from substrate and product bound structures of the metal-dependent dimethylsulfoniopropionate lyase dddq 0.9027 18 88
ID Description Score Start End Superfamily
af_Q05212_199_307_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9094 18 88 2.60.120.10
5jspB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9025 18 88 2.60.120.10
4e2gD00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9004 18 87 2.60.120.10
af_O86372_11_115_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8946 18 87 2.60.120.10
2pfwB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8915 18 87 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A2V8Z9P8-F1-model_v4 Cupin domain-containing protein 0.9785 1 88
AF-A0A2W0BZM9-F1-model_v4 Cupin domain-containing protein 0.9761 1 88
AF-A0A2V9D4X5-F1-model_v4 Cupin type-2 domain-containing protein 0.9717 1 88
AF-A0A2W0BZM9-F1-model_v4 Cupin domain-containing protein 0.9653 1 88
AF-A0A2V9D4X5-F1-model_v4 Cupin type-2 domain-containing protein 0.9609 1 88

Map