F434214

General Info

Members Datasets Scaffolds Average Seq Length
399 199 798 268

Family's Representative Sequence

Representative Sequence 3300005295|Ga0065707_10001963|Ga0065707_100019632
Length 259
Sequence MRGRLGVAGLGVLGAALWFGAPAAIYVIGPVPLQAQPPPVPAAPDARFAGLQWTFVRIHYAAWTLPPRAGLSPFDEPWYIDAPAAEWNLSRRVRSATAIQVNDPIDLRIEDPELFNHPWIYLVEGGNLRLKDAEVPILREPIEWRNVEMELQRVFPDRKIVDLPKEHPIFNCFYKMDGFPQTPGLGSFLQGRTWEKGGYIAALRAIEDDNGRAMVLINWNVDMGDGWEWSNASDYPGYVKYTAMAYRMEINEIIYSLTX

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
126 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
135 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
136 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
137 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
138 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
139 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
140 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
141 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
142 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
143 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
144 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
145 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
148 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
149 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
150 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
153 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
154 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
165 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
166 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
167 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
168 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
169 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
170 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
171 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
172 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
173 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
174 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
175 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
176 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
178 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
179 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
180 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
181 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
182 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
183 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
184 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
185 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
186 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
190 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
191 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
192 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
193 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
194 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
195 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
196 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
197 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
198 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
199 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.51
Nodule 0
Rhizoplane 1.75
Rhizosphere 93.73
Stem 0
Stem Tuber 0
Unclassified 6.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10001963 3300005295 Bacteria 5254
2 JGI25406J46586_10000382 3300003203 Bacteria 20298
3 Ga0065712_10000901 3300005290 Bacteria 7603
4 Ga0065715_10004232 3300005293 Bacteria 3876
5 Ga0065715_10252991 3300005293 Bacteria 1161
6 Ga0065707_10153664 3300005295 Bacteria 1631
7 Ga0070683_100005496 3300005329 Bacteria 10587
8 Ga0070690_100019710 3300005330 Bacteria 4100
9 Ga0070670_100001039 3300005331 Bacteria 22001
10 Ga0070670_100008587 3300005331 Bacteria 8713
11 Ga0070670_100009081 3300005331 Bacteria 8495
12 Ga0070677_10073319 3300005333 Bacteria 1446
13 Ga0068869_100039256 3300005334 Bacteria 3379
14 Ga0070666_10038998 3300005335 Bacteria 3163
15 Ga0068868_100027505 3300005338 Bacteria 4339
16 Ga0070660_100236587 3300005339 Bacteria 1487
17 Ga0070691_10130584 3300005341 Bacteria 1273
18 Ga0070687_100005656 3300005343 Bacteria 5070
19 Ga0070661_100041019 3300005344 Bacteria 3377
20 Ga0070668_100342585 3300005347 Bacteria 1263
21 Ga0070669_100002866 3300005353 Bacteria 12442
22 Ga0070669_100026328 3300005353 Bacteria 4184
23 Ga0070669_100634130 3300005353 Unclassified 898
24 Ga0070675_100025591 3300005354 Unclassified 4731
25 Ga0070675_100032145 3300005354 Bacteria 4245
26 Ga0070675_100156792 3300005354 Bacteria 1955
27 Ga0070671_100024740 3300005355 Bacteria 4918
28 Ga0070671_100202850 3300005355 Bacteria 1682
29 Ga0070674_100002813 3300005356 Bacteria 9626
30 Ga0070674_100026715 3300005356 Bacteria 3774
31 Ga0070674_100132889 3300005356 Bacteria 1858
32 Ga0070674_100405414 3300005356 Bacteria 1115
33 Ga0070673_100009015 3300005364 Bacteria 6677
34 Ga0070659_100112258 3300005366 Unclassified 2201
35 Ga0070701_10071826 3300005438 Bacteria 1852
36 Ga0070705_100338805 3300005440 Unclassified 1092
37 Ga0070700_100009163 3300005441 Bacteria 5426
38 Ga0070694_100313830 3300005444 Bacteria 1205
39 Ga0068867_100032479 3300005459 Bacteria 3776
40 Ga0070685_10122110 3300005466 Bacteria 1619
41 Ga0070698_100079120 3300005471 Unclassified 3285
42 Ga0070698_100223972 3300005471 Bacteria 1814
43 Ga0070699_100017459 3300005518 Bacteria 6160
44 Ga0070684_100021278 3300005535 Bacteria 5394
45 Ga0070684_100027327 3300005535 Bacteria 4814
46 Ga0070672_100027861 3300005543 Bacteria 4219
47 Ga0070672_100137246 3300005543 Bacteria 2015
48 Ga0070686_100012867 3300005544 Bacteria 4776
49 Ga0070686_100071784 3300005544 Unclassified 2268
50 Ga0070695_100331955 3300005545 Bacteria 1134
51 Ga0070696_100284259 3300005546 Bacteria 1262
52 Ga0070693_100019415 3300005547 Bacteria 3562
53 Ga0070693_100067552 3300005547 Bacteria 2096
54 Ga0070665_100112768 3300005548 Bacteria 2722
55 Ga0070704_100099283 3300005549 Bacteria 2189
56 Ga0070704_100136816 3300005549 Bacteria 1907
57 Ga0070704_100398649 3300005549 Bacteria 1174
58 Ga0068855_100428153 3300005563 Bacteria 1447
59 Ga0070664_100037529 3300005564 Bacteria 4074
60 Ga0070664_100201338 3300005564 Unclassified 1777
61 Ga0070664_100299462 3300005564 Bacteria 1453
62 Ga0068857_100031649 3300005577 Bacteria 4675
63 Ga0068857_100486195 3300005577 Bacteria 1157
64 Ga0068854_100036792 3300005578 Bacteria 3433
65 Ga0068852_100153612 3300005616 Bacteria 2143
66 Ga0068864_100286926 3300005618 Unclassified 1538
67 Ga0068861_100170567 3300005719 Bacteria 1803
68 Ga0068851_10087631 3300005834 Bacteria 1635
69 Ga0068858_100281180 3300005842 Bacteria 1584
70 Ga0068862_100058515 3300005844 Bacteria 3306
71 Ga0068862_100118281 3300005844 Bacteria 2333
72 Ga0068862_100340528 3300005844 Bacteria 1389
73 Ga0081539_10000112 3300005985 Bacteria 190218
74 Ga0081539_10001191 3300005985 Bacteria 46937
75 Ga0081539_10001673 3300005985 Bacteria 35884
76 Ga0075368_10003672 3300006042 Bacteria 5148
77 Ga0075364_10002202 3300006051 Bacteria 10928
78 Ga0075364_10124470 3300006051 Bacteria 1727
79 Ga0075362_10054299 3300006177 Bacteria 1800
80 Ga0075367_10001249 3300006178 Bacteria 10723
81 Ga0075367_10052471 3300006178 Bacteria 2413
82 Ga0075366_10027112 3300006195 Bacteria 3360
83 Ga0075366_10084078 3300006195 Bacteria 1902
84 Ga0075370_10015473 3300006353 Bacteria 4085
85 Ga0075428_100063750 3300006844 Bacteria 4035
86 Ga0075428_100066911 3300006844 Bacteria 3933
87 Ga0075428_100080118 3300006844 Bacteria 3564
88 Ga0075428_100551371 3300006844 Bacteria 1232
89 Ga0075430_100004220 3300006846 Bacteria 12132
90 Ga0075430_100023431 3300006846 Bacteria 5255
91 Ga0075430_100143561 3300006846 Bacteria 1988
92 Ga0075431_100003766 3300006847 Bacteria 14740
93 Ga0075431_100005703 3300006847 Bacteria 12303
94 Ga0075431_100010377 3300006847 Bacteria 9359
95 Ga0075431_100011980 3300006847 Bacteria 8750
96 Ga0075431_100079777 3300006847 Bacteria 3379
97 Ga0075431_100106006 3300006847 Bacteria 2900
98 Ga0075431_100196232 3300006847 Bacteria 2066
99 Ga0075431_100337576 3300006847 Bacteria 1517
100 Ga0075433_10013920 3300006852 Bacteria 6558
101 Ga0075433_10045378 3300006852 Bacteria 3821
102 Ga0075433_10190038 3300006852 Bacteria 1827
103 Ga0075433_10360166 3300006852 Bacteria 1285
104 Ga0075434_100005509 3300006871 Bacteria 11528
105 Ga0075434_100256332 3300006871 Bacteria 1768
106 Ga0075434_100332176 3300006871 Bacteria 1541
107 Ga0075429_100007367 3300006880 Bacteria 9551
108 Ga0075429_100032326 3300006880 Bacteria 4548
109 Ga0075429_100119155 3300006880 Bacteria 2306
110 Ga0075429_100156150 3300006880 Bacteria 1998
111 Ga0075429_100185668 3300006880 Bacteria 1822
112 Ga0068865_100323558 3300006881 Bacteria 1241
113 Ga0075435_100009826 3300007076 Bacteria 6962
114 Ga0075435_100038785 3300007076 Bacteria 3799
115 Ga0105240_10031831 3300009093 Bacteria 6834
116 Ga0111539_10000159 3300009094 Bacteria 76817
117 Ga0111539_10006172 3300009094 Bacteria 15467
118 Ga0111539_10010895 3300009094 Bacteria 11445
119 Ga0111539_10376676 3300009094 Bacteria 1652
120 Ga0111539_10440379 3300009094 Unclassified 1517
121 Ga0105247_10163231 3300009101 Bacteria 1477
122 Ga0114129_10002734 3300009147 Bacteria 24595
123 Ga0114129_10003342 3300009147 Bacteria 22532
124 Ga0114129_10003724 3300009147 Bacteria 21497
125 Ga0114129_10008821 3300009147 Bacteria 14385
126 Ga0114129_10008879 3300009147 Bacteria 14334
127 Ga0114129_10031445 3300009147 Bacteria 7503
128 Ga0114129_10102876 3300009147 Bacteria 3950
129 Ga0114129_10194511 3300009147 Unclassified 2751
130 Ga0114129_10769008 3300009147 Bacteria 1231
131 Ga0105243_10030947 3300009148 Bacteria 4124
132 Ga0105241_10046858 3300009174 Bacteria 3284
133 Ga0105242_10161964 3300009176 Bacteria 1959
134 Ga0105248_10007791 3300009177 Bacteria 11754
135 Ga0105248_10057904 3300009177 Bacteria 4351
136 Ga0105238_10800967 3300009551 Bacteria 958
137 Ga0105249_10225372 3300009553 Bacteria 1846
138 Ga0105249_11173107 3300009553 Unclassified 839
139 Ga0105239_10089899 3300010375 Bacteria 3387
140 Ga0105246_10038474 3300011119 Bacteria 3217
141 Ga0105246_10586377 3300011119 Unclassified 961
142 Ga0157370_10162091 3300013104 Bacteria 2080
143 Ga0157372_10146626 3300013307 Bacteria 2722
144 Ga0157375_10463587 3300013308 Bacteria 1432
145 Ga0157375_10893785 3300013308 Bacteria 1033
146 Ga0163163_10050535 3300014325 Bacteria 4094
147 Ga0163163_10118118 3300014325 Bacteria 2684
148 Ga0157380_10028799 3300014326 Bacteria 4239
149 Ga0157380_10143116 3300014326 Bacteria 2057
150 Ga0157379_10194832 3300014968 Bacteria 1831
151 Ga0163161_10173849 3300017792 Bacteria 1648
152 Ga0207697_10000945 3300025315 Bacteria 16386
153 Ga0207653_10027347 3300025885 Bacteria 1831
154 Ga0207682_10042776 3300025893 Bacteria 1852
155 Ga0207688_10002563 3300025901 Bacteria 9830
156 Ga0207645_10003556 3300025907 Bacteria 11793
157 Ga0207654_10439584 3300025911 Unclassified 913
158 Ga0207707_10082512 3300025912 Bacteria 2807
159 Ga0207707_10207837 3300025912 Bacteria 1706
160 Ga0207707_10222995 3300025912 Bacteria 1641
161 Ga0207695_10059969 3300025913 Bacteria 3942
162 Ga0207663_10238721 3300025916 Bacteria 1332
163 Ga0207662_10000562 3300025918 Bacteria 16477
164 Ga0207657_10102639 3300025919 Unclassified 2372
165 Ga0207657_10178841 3300025919 Bacteria 1716
166 Ga0207649_10033790 3300025920 Bacteria 3059
167 Ga0207649_10155339 3300025920 Bacteria 1580
168 Ga0207681_10020181 3300025923 Bacteria 4219
169 Ga0207681_10034706 3300025923 Bacteria 3318
170 Ga0207681_10137046 3300025923 Bacteria 1818
171 Ga0207650_10005129 3300025925 Bacteria 8940
172 Ga0207650_10011924 3300025925 Bacteria 5991
173 Ga0207650_10022860 3300025925 Bacteria 4430
174 Ga0207650_10279563 3300025925 Bacteria 1359
175 Ga0207659_10255897 3300025926 Bacteria 1422
176 Ga0207659_10278499 3300025926 Bacteria 1367
177 Ga0207659_10410666 3300025926 Bacteria 1134
178 Ga0207644_10091309 3300025931 Bacteria 2270
179 Ga0207644_10179491 3300025931 Bacteria 1658
180 Ga0207690_10058065 3300025932 Bacteria 2616
181 Ga0207690_10221765 3300025932 Bacteria 1447
182 Ga0207706_10139815 3300025933 Unclassified 2130
183 Ga0207706_10287069 3300025933 Bacteria 1434
184 Ga0207709_10100286 3300025935 Bacteria 1913
185 Ga0207670_10008521 3300025936 Bacteria 5794
186 Ga0207669_10054850 3300025937 Bacteria 2410
187 Ga0207669_10059220 3300025937 Bacteria 2341
188 Ga0207669_10109361 3300025937 Bacteria 1848
189 Ga0207669_10174575 3300025937 Bacteria 1534
190 Ga0207704_10189848 3300025938 Bacteria 1494
191 Ga0207691_10013789 3300025940 Bacteria 7721
192 Ga0207691_10047568 3300025940 Bacteria 3936
193 Ga0207691_10121565 3300025940 Bacteria 2313
194 Ga0207711_10006093 3300025941 Bacteria 10181
195 Ga0207689_10116349 3300025942 Bacteria 2198
196 Ga0207661_10016669 3300025944 Bacteria 5422
197 Ga0207679_10002781 3300025945 Bacteria 10832
198 Ga0207679_10177047 3300025945 Bacteria 1761
199 Ga0207667_10234167 3300025949 Bacteria 1880
200 Ga0207651_10031538 3300025960 Bacteria 3389
201 Ga0207712_10277269 3300025961 Bacteria 1367
202 Ga0207712_10304539 3300025961 Bacteria 1309
203 Ga0207658_10183186 3300025986 Unclassified 1735
204 Ga0207677_10195763 3300026023 Unclassified 1602
205 Ga0207678_10027126 3300026067 Bacteria 4995
206 Ga0207708_10007911 3300026075 Bacteria 7880
207 Ga0207676_10325878 3300026095 Bacteria 1412
208 Ga0207675_100075117 3300026118 Bacteria 3163
209 Ga0207683_10288756 3300026121 Bacteria 1500
210 Ga0207683_10495182 3300026121 Bacteria 1128
211 Ga0209971_1015198 3300027682 Bacteria 1824
212 Ga0207428_10003598 3300027907 Bacteria 14966
213 Ga0207428_10018439 3300027907 Bacteria 5961
214 Ga0207428_10030143 3300027907 Bacteria 4487
215 Ga0207428_10140840 3300027907 Bacteria 1841
216 Ga0268265_10217877 3300028380 Bacteria 1668
217 Ga0268265_10285840 3300028380 Bacteria 1478
218 Ga0268265_10379975 3300028380 Unclassified 1299
219 Ga0307408_100020842 3300031548 Bacteria 4429
220 Ga0307408_100030157 3300031548 Bacteria 3764
221 Ga0307408_100119617 3300031548 Bacteria 2038
222 Ga0307408_100336686 3300031548 Bacteria 1276
223 Ga0307405_10003077 3300031731 Bacteria 7566
224 Ga0307405_10026493 3300031731 Bacteria 3345
225 Ga0307405_10084758 3300031731 Bacteria 2081
226 Ga0307405_10265863 3300031731 Bacteria 1284
227 Ga0307413_10011139 3300031824 Bacteria 4404
228 Ga0307413_10020016 3300031824 Bacteria 3549
229 Ga0307413_10023564 3300031824 Bacteria 3338
230 Ga0307410_10296000 3300031852 Bacteria 1275
231 Ga0307410_10536056 3300031852 Bacteria 968
232 Ga0307406_10012351 3300031901 Bacteria 4871
233 Ga0307407_10013893 3300031903 Bacteria 3924
234 Ga0307412_10063037 3300031911 Bacteria 2499
235 Ga0307412_10342901 3300031911 Bacteria 1196
236 Ga0307409_100004983 3300031995 Bacteria 7562
237 Ga0307409_100062450 3300031995 Bacteria 2916
238 Ga0307409_100065998 3300031995 Bacteria 2851
239 Ga0307409_100095155 3300031995 Bacteria 2453
240 Ga0307409_100178351 3300031995 Bacteria 1878
241 Ga0307409_100190589 3300031995 Bacteria 1825
242 Ga0307409_100376577 3300031995 Bacteria 1348
243 Ga0307409_100431594 3300031995 Bacteria 1267
244 Ga0307416_100004704 3300032002 Bacteria 8269
245 Ga0307416_100012910 3300032002 Bacteria 5652
246 Ga0307416_100049704 3300032002 Bacteria 3336
247 Ga0307416_100073181 3300032002 Bacteria 2856
248 Ga0307416_100086511 3300032002 Bacteria 2672
249 Ga0307416_100101350 3300032002 Unclassified 2507
250 Ga0307416_100118362 3300032002 Bacteria 2354
251 Ga0307416_100120691 3300032002 Bacteria 2335
252 Ga0307414_10026983 3300032004 Bacteria 3704
253 Ga0307414_10088663 3300032004 Unclassified 2290
254 Ga0307411_10013154 3300032005 Bacteria 4552
255 Ga0307415_100047553 3300032126 Unclassified 2888
256 Ga0439439_0023709 3300041406 Bacteria 1538
257 Ga0439431_0028518 3300041997 Bacteria 1375
258 Ga0439449_0115640 3300042007 Bacteria 995
259 Ga0450898_030485 3300042134 Unclassified 988
260 Ga0439446_0064136 3300042156 Bacteria 1115
261 Ga0439435_0026147 3300042436 Bacteria 1552
262 Ga0439435_0056218 3300042436 Bacteria 1137
263 Ga0439444_0014958 3300042437 Bacteria 1304
264 Ga0439464_0000289 3300042439 Bacteria 9488
265 Ga0439460_0017335 3300042461 Bacteria 1929
266 Ga0439460_0021923 3300042461 Bacteria 1749
267 Ga0451577_0129374 3300042876 Bacteria 2264
268 Ga0495658_0199005 3300046683 Bacteria 1248
269 Ga0496104_0013690 3300048907 Bacteria 7313
270 Ga0496105_0019238 3300048908 Bacteria 5507
271 Ga0496108_0001031 3300048911 Bacteria 21726
272 Ga0496109_0001298 3300048912 Bacteria 20709
273 Ga0496111_0068069 3300048914 Bacteria 2587
274 Ga0496112_0002025 3300048915 Bacteria 16050
275 Ga0496113_0064882 3300048916 Bacteria 2762
276 Ga0501291_015086 3300049514 Bacteria 1164
277 Ga0501034_0004146 3300049571 Bacteria 16229
278 Ga0501036_0078720 3300049572 Bacteria 2788
279 Ga0501036_0102037 3300049572 Unclassified 2427
280 Ga0501036_0282243 3300049572 Bacteria 1390
281 Ga0501038_0052025 3300049574 Bacteria 3532
282 Ga0501039_0023786 3300049575 Bacteria 4703
283 Ga0501039_0321789 3300049575 Bacteria 1216
284 Ga0501040_0017190 3300049576 Bacteria 4801
285 Ga0501040_0065995 3300049576 Bacteria 2494
286 Ga0501041_0021676 3300049577 Bacteria 3849
287 Ga0501041_0031828 3300049577 Bacteria 3189
288 Ga0501042_0004259 3300049578 Bacteria 9108
289 Ga0501042_0014256 3300049578 Bacteria 5423
290 Ga0501042_0015116 3300049578 Bacteria 5277
291 Ga0501042_0079170 3300049578 Bacteria 2354
292 Ga0501042_0286817 3300049578 Bacteria 1189
293 Ga0501043_0106561 3300049579 Bacteria 2202
294 Ga0501046_0137742 3300049580 Bacteria 1848
295 Ga0501048_0041637 3300049582 Bacteria 3289
296 Ga0501048_0315189 3300049582 Bacteria 1114
297 Ga0501071_0010333 3300049587 Bacteria 6252
298 Ga0501071_0016259 3300049587 Bacteria 5116
299 Ga0501071_0087326 3300049587 Bacteria 2288
300 Ga0501071_0122361 3300049587 Bacteria 1929
301 Ga0501072_0005694 3300049588 Bacteria 9486
302 Ga0501072_0011569 3300049588 Bacteria 6742
303 Ga0501072_0019888 3300049588 Bacteria 5196
304 Ga0501072_0074388 3300049588 Bacteria 2686
305 Ga0501073_0000430 3300049589 Bacteria 28781
306 Ga0501074_0070344 3300049590 Bacteria 2516
307 Ga0501075_0018330 3300049591 Bacteria 5065
308 Ga0501075_0021473 3300049591 Bacteria 4707
309 Ga0501075_0041592 3300049591 Bacteria 3444
310 Ga0501075_0137651 3300049591 Bacteria 1860
311 Ga0501075_0160464 3300049591 Bacteria 1715
312 Ga0501076_0023038 3300049592 Bacteria 4795
313 Ga0501076_0023277 3300049592 Bacteria 4774
314 Ga0501076_0032478 3300049592 Bacteria 4074
315 Ga0501076_0056261 3300049592 Bacteria 3121
316 Ga0501077_0143808 3300049593 Bacteria 1513
317 Ga0501239_014210 3300049672 Bacteria 919
318 Ga0501257_017804 3300049686 Bacteria 1654
319 Ga0501079_0014123 3300049741 Bacteria 6087
320 Ga0501079_0084077 3300049741 Bacteria 2462
321 Ga0501079_0108862 3300049741 Bacteria 2152
322 Ga0501079_0524651 3300049741 Bacteria 931
323 Ga0501080_0104122 3300049742 Bacteria 2632
324 Ga0501080_0191165 3300049742 Bacteria 1881
325 Ga0501081_0018075 3300049743 Bacteria 4678
326 Ga0501081_0032445 3300049743 Bacteria 3543
327 Ga0501081_0327821 3300049743 Bacteria 1126
328 Ga0501035_0058613 3300049822 Bacteria 3431
329 Ga0501035_0065258 3300049822 Bacteria 3234
330 Ga0501045_0003462 3300049824 Bacteria 10804
331 Ga0501045_0025859 3300049824 Bacteria 4220
332 Ga0501045_0039236 3300049824 Unclassified 3446
333 Ga0501045_0041725 3300049824 Bacteria 3339
334 Ga0501045_0064247 3300049824 Bacteria 2694
335 Ga0501045_0375395 3300049824 Unclassified 1058
336 nmdc:mga03683_696_c1 3300050489 Bacteria 9670
337 nmdc:mga00v17_7055_c1 3300050491 Bacteria 5983
338 nmdc:mga00v17_92930_c1 3300050491 Bacteria 1897
339 nmdc:mga0k408_107015_c1 3300050493 Bacteria 1652
340 nmdc:mga0k408_2313_c1 3300050493 Bacteria 10143
341 nmdc:mga06z11_18859_c1 3300050494 Bacteria 3160
342 nmdc:mga06z11_3559_c1 3300050494 Bacteria 6032
343 nmdc:mga04h51_12328_c1 3300050495 Bacteria 2398
344 nmdc:mga05p37_3806_c1 3300050507 Bacteria 17651
345 nmdc:mga05p37_40307_c1 3300050507 Bacteria 5734
346 nmdc:mga05p37_45661_c1 3300050507 Bacteria 5387
347 nmdc:mga05p37_5246_c1 3300050507 Bacteria 15213
348 nmdc:mga05p37_54368_c1 3300050507 Bacteria 4926
349 nmdc:mga05p37_8365_c1 3300050507 Bacteria 12234
350 nmdc:mga09592_144890_c1 3300050508 Bacteria 2048
351 nmdc:mga09592_245176_c1 3300050508 Bacteria 1553
352 nmdc:mga09592_249512_c1 3300050508 Bacteria 1538
353 nmdc:mga09592_4928_c1 3300050508 Bacteria 10824
354 nmdc:mga09592_63596_c1 3300050508 Bacteria 3124
355 nmdc:mga09592_87122_c1 3300050508 Bacteria 2665
356 nmdc:mga0qj67_38247_c1 3300050509 Bacteria 3763
357 nmdc:mga0qj67_47518_c1 3300050509 Bacteria 3391
358 nmdc:mga0qj67_6391_c1 3300050509 Bacteria 8656
359 nmdc:mga0qj67_7597_c1 3300050509 Bacteria 8008
360 nmdc:mga06r32_104333_c1 3300050510 Bacteria 2784
361 nmdc:mga06r32_20569_c1 3300050510 Bacteria 6076
362 nmdc:mga06r32_33540_c1 3300050510 Bacteria 4835
363 nmdc:mga06r32_437551_c1 3300050510 Bacteria 1288
364 nmdc:mga06r32_62086_c1 3300050510 Bacteria 3599
365 nmdc:mga08y16_26409_c1 3300050511 Bacteria 6123
366 nmdc:mga08y16_335146_c1 3300050511 Bacteria 1555
367 nmdc:mga08y16_50568_c1 3300050511 Bacteria 4349
368 nmdc:mga08y16_6460_c1 3300050511 Bacteria 12299
369 nmdc:mga08y16_9556_c1 3300050511 Bacteria 10179
370 nmdc:mga0n895_37043_c1 3300050512 Bacteria 4715
371 nmdc:mga0rr50_110532_c1 3300050513 Bacteria 2174
372 nmdc:mga0rr50_216474_c1 3300050513 Bacteria 1580
373 nmdc:mga0rr50_347788_c1 3300050513 Bacteria 1246
374 nmdc:mga0rr50_53273_c1 3300050513 Bacteria 3010
375 nmdc:mga08x19_215157_c1 3300050514 Bacteria 1319
376 nmdc:mga08x19_41021_c1 3300050514 Bacteria 2947
377 nmdc:mga0a205_281137_c1 3300050515 Bacteria 1539
378 nmdc:mga0a205_521206_c1 3300050515 Bacteria 1045
379 nmdc:mga0a205_6171_c1 3300050515 Bacteria 10813
380 nmdc:mga0a205_6385_c1 3300050515 Bacteria 10650
381 Ga0495619_0012994 3300053085 Bacteria 5246
382 Ga0500556_0015879 3300053104 Bacteria 2332
383 Ga0590071_000043 3300059421 Bacteria 32171
384 Ga0590071_004262 3300059421 Bacteria 3481
385 Ga0590071_004375 3300059421 Bacteria 3435
386 Ga0590071_034258 3300059421 Bacteria 1215
387 Ga0590074_000723 3300059423 Bacteria 5020
388 Ga0590074_009089 3300059423 Bacteria 1656
389 Ga0590075_002116 3300059424 Bacteria 4778
390 Ga0590075_003003 3300059424 Bacteria 4015
391 Ga0590075_005302 3300059424 Bacteria 3044
392 Ga0590077_000159 3300059426 Bacteria 19089
393 Ga0590077_003009 3300059426 Bacteria 3528
394 Ga0590077_011863 3300059426 Bacteria 1802
395 Ga0501082_0146768 3300060353 Bacteria 2048
396 Ga0501082_0189233 3300060353 Bacteria 1791
397 Ga0501082_0469261 3300060353 Bacteria 1100
398 Ga0501082_0795332 3300060353 Bacteria 827
399 Ga0530510_0005343 3300061734 Bacteria 8883
400 Ga0065707_10001963
401 JGI25406J46586_10000382
402 Ga0065712_10000901
403 Ga0065715_10004232
404 Ga0065715_10252991
405 Ga0065707_10153664
406 Ga0070683_100005496
407 Ga0070690_100019710
408 Ga0070670_100001039
409 Ga0070670_100008587
410 Ga0070670_100009081
411 Ga0070677_10073319
412 Ga0068869_100039256
413 Ga0070666_10038998
414 Ga0068868_100027505
415 Ga0070660_100236587
416 Ga0070691_10130584
417 Ga0070687_100005656
418 Ga0070661_100041019
419 Ga0070668_100342585
420 Ga0070669_100002866
421 Ga0070669_100026328
422 Ga0070669_100634130
423 Ga0070675_100025591
424 Ga0070675_100032145
425 Ga0070675_100156792
426 Ga0070671_100024740
427 Ga0070671_100202850
428 Ga0070674_100002813
429 Ga0070674_100026715
430 Ga0070674_100132889
431 Ga0070674_100405414
432 Ga0070673_100009015
433 Ga0070659_100112258
434 Ga0070701_10071826
435 Ga0070705_100338805
436 Ga0070700_100009163
437 Ga0070694_100313830
438 Ga0068867_100032479
439 Ga0070685_10122110
440 Ga0070698_100079120
441 Ga0070698_100223972
442 Ga0070699_100017459
443 Ga0070684_100021278
444 Ga0070684_100027327
445 Ga0070672_100027861
446 Ga0070672_100137246
447 Ga0070686_100012867
448 Ga0070686_100071784
449 Ga0070695_100331955
450 Ga0070696_100284259
451 Ga0070693_100019415
452 Ga0070693_100067552
453 Ga0070665_100112768
454 Ga0070704_100099283
455 Ga0070704_100136816
456 Ga0070704_100398649
457 Ga0068855_100428153
458 Ga0070664_100037529
459 Ga0070664_100201338
460 Ga0070664_100299462
461 Ga0068857_100031649
462 Ga0068857_100486195
463 Ga0068854_100036792
464 Ga0068852_100153612
465 Ga0068864_100286926
466 Ga0068861_100170567
467 Ga0068851_10087631
468 Ga0068858_100281180
469 Ga0068862_100058515
470 Ga0068862_100118281
471 Ga0068862_100340528
472 Ga0081539_10000112
473 Ga0081539_10001191
474 Ga0081539_10001673
475 Ga0075368_10003672
476 Ga0075364_10002202
477 Ga0075364_10124470
478 Ga0075362_10054299
479 Ga0075367_10001249
480 Ga0075367_10052471
481 Ga0075366_10027112
482 Ga0075366_10084078
483 Ga0075370_10015473
484 Ga0075428_100063750
485 Ga0075428_100066911
486 Ga0075428_100080118
487 Ga0075428_100551371
488 Ga0075430_100004220
489 Ga0075430_100023431
490 Ga0075430_100143561
491 Ga0075431_100003766
492 Ga0075431_100005703
493 Ga0075431_100010377
494 Ga0075431_100011980
495 Ga0075431_100079777
496 Ga0075431_100106006
497 Ga0075431_100196232
498 Ga0075431_100337576
499 Ga0075433_10013920
500 Ga0075433_10045378
501 Ga0075433_10190038
502 Ga0075433_10360166
503 Ga0075434_100005509
504 Ga0075434_100256332
505 Ga0075434_100332176
506 Ga0075429_100007367
507 Ga0075429_100032326
508 Ga0075429_100119155
509 Ga0075429_100156150
510 Ga0075429_100185668
511 Ga0068865_100323558
512 Ga0075435_100009826
513 Ga0075435_100038785
514 Ga0105240_10031831
515 Ga0111539_10000159
516 Ga0111539_10006172
517 Ga0111539_10010895
518 Ga0111539_10376676
519 Ga0111539_10440379
520 Ga0105247_10163231
521 Ga0114129_10002734
522 Ga0114129_10003342
523 Ga0114129_10003724
524 Ga0114129_10008821
525 Ga0114129_10008879
526 Ga0114129_10031445
527 Ga0114129_10102876
528 Ga0114129_10194511
529 Ga0114129_10769008
530 Ga0105243_10030947
531 Ga0105241_10046858
532 Ga0105242_10161964
533 Ga0105248_10007791
534 Ga0105248_10057904
535 Ga0105238_10800967
536 Ga0105249_10225372
537 Ga0105249_11173107
538 Ga0105239_10089899
539 Ga0105246_10038474
540 Ga0105246_10586377
541 Ga0157370_10162091
542 Ga0157372_10146626
543 Ga0157375_10463587
544 Ga0157375_10893785
545 Ga0163163_10050535
546 Ga0163163_10118118
547 Ga0157380_10028799
548 Ga0157380_10143116
549 Ga0157379_10194832
550 Ga0163161_10173849
551 Ga0207697_10000945
552 Ga0207653_10027347
553 Ga0207682_10042776
554 Ga0207688_10002563
555 Ga0207645_10003556
556 Ga0207654_10439584
557 Ga0207707_10082512
558 Ga0207707_10207837
559 Ga0207707_10222995
560 Ga0207695_10059969
561 Ga0207663_10238721
562 Ga0207662_10000562
563 Ga0207657_10102639
564 Ga0207657_10178841
565 Ga0207649_10033790
566 Ga0207649_10155339
567 Ga0207681_10020181
568 Ga0207681_10034706
569 Ga0207681_10137046
570 Ga0207650_10005129
571 Ga0207650_10011924
572 Ga0207650_10022860
573 Ga0207650_10279563
574 Ga0207659_10255897
575 Ga0207659_10278499
576 Ga0207659_10410666
577 Ga0207644_10091309
578 Ga0207644_10179491
579 Ga0207690_10058065
580 Ga0207690_10221765
581 Ga0207706_10139815
582 Ga0207706_10287069
583 Ga0207709_10100286
584 Ga0207670_10008521
585 Ga0207669_10054850
586 Ga0207669_10059220
587 Ga0207669_10109361
588 Ga0207669_10174575
589 Ga0207704_10189848
590 Ga0207691_10013789
591 Ga0207691_10047568
592 Ga0207691_10121565
593 Ga0207711_10006093
594 Ga0207689_10116349
595 Ga0207661_10016669
596 Ga0207679_10002781
597 Ga0207679_10177047
598 Ga0207667_10234167
599 Ga0207651_10031538
600 Ga0207712_10277269
601 Ga0207712_10304539
602 Ga0207658_10183186
603 Ga0207677_10195763
604 Ga0207678_10027126
605 Ga0207708_10007911
606 Ga0207676_10325878
607 Ga0207675_100075117
608 Ga0207683_10288756
609 Ga0207683_10495182
610 Ga0209971_1015198
611 Ga0207428_10003598
612 Ga0207428_10018439
613 Ga0207428_10030143
614 Ga0207428_10140840
615 Ga0268265_10217877
616 Ga0268265_10285840
617 Ga0268265_10379975
618 Ga0307408_100020842
619 Ga0307408_100030157
620 Ga0307408_100119617
621 Ga0307408_100336686
622 Ga0307405_10003077
623 Ga0307405_10026493
624 Ga0307405_10084758
625 Ga0307405_10265863
626 Ga0307413_10011139
627 Ga0307413_10020016
628 Ga0307413_10023564
629 Ga0307410_10296000
630 Ga0307410_10536056
631 Ga0307406_10012351
632 Ga0307407_10013893
633 Ga0307412_10063037
634 Ga0307412_10342901
635 Ga0307409_100004983
636 Ga0307409_100062450
637 Ga0307409_100065998
638 Ga0307409_100095155
639 Ga0307409_100178351
640 Ga0307409_100190589
641 Ga0307409_100376577
642 Ga0307409_100431594
643 Ga0307416_100004704
644 Ga0307416_100012910
645 Ga0307416_100049704
646 Ga0307416_100073181
647 Ga0307416_100086511
648 Ga0307416_100101350
649 Ga0307416_100118362
650 Ga0307416_100120691
651 Ga0307414_10026983
652 Ga0307414_10088663
653 Ga0307411_10013154
654 Ga0307415_100047553
655 Ga0439439_0023709
656 Ga0439431_0028518
657 Ga0439449_0115640
658 Ga0450898_030485
659 Ga0439446_0064136
660 Ga0439435_0026147
661 Ga0439435_0056218
662 Ga0439444_0014958
663 Ga0439464_0000289
664 Ga0439460_0017335
665 Ga0439460_0021923
666 Ga0451577_0129374
667 Ga0495658_0199005
668 Ga0496104_0013690
669 Ga0496105_0019238
670 Ga0496108_0001031
671 Ga0496109_0001298
672 Ga0496111_0068069
673 Ga0496112_0002025
674 Ga0496113_0064882
675 Ga0501291_015086
676 Ga0501034_0004146
677 Ga0501036_0078720
678 Ga0501036_0102037
679 Ga0501036_0282243
680 Ga0501038_0052025
681 Ga0501039_0023786
682 Ga0501039_0321789
683 Ga0501040_0017190
684 Ga0501040_0065995
685 Ga0501041_0021676
686 Ga0501041_0031828
687 Ga0501042_0004259
688 Ga0501042_0014256
689 Ga0501042_0015116
690 Ga0501042_0079170
691 Ga0501042_0286817
692 Ga0501043_0106561
693 Ga0501046_0137742
694 Ga0501048_0041637
695 Ga0501048_0315189
696 Ga0501071_0010333
697 Ga0501071_0016259
698 Ga0501071_0087326
699 Ga0501071_0122361
700 Ga0501072_0005694
701 Ga0501072_0011569
702 Ga0501072_0019888
703 Ga0501072_0074388
704 Ga0501073_0000430
705 Ga0501074_0070344
706 Ga0501075_0018330
707 Ga0501075_0021473
708 Ga0501075_0041592
709 Ga0501075_0137651
710 Ga0501075_0160464
711 Ga0501076_0023038
712 Ga0501076_0023277
713 Ga0501076_0032478
714 Ga0501076_0056261
715 Ga0501077_0143808
716 Ga0501239_014210
717 Ga0501257_017804
718 Ga0501079_0014123
719 Ga0501079_0084077
720 Ga0501079_0108862
721 Ga0501079_0524651
722 Ga0501080_0104122
723 Ga0501080_0191165
724 Ga0501081_0018075
725 Ga0501081_0032445
726 Ga0501081_0327821
727 Ga0501035_0058613
728 Ga0501035_0065258
729 Ga0501045_0003462
730 Ga0501045_0025859
731 Ga0501045_0039236
732 Ga0501045_0041725
733 Ga0501045_0064247
734 Ga0501045_0375395
735 nmdc:mga03683_696_c1
736 nmdc:mga00v17_7055_c1
737 nmdc:mga00v17_92930_c1
738 nmdc:mga0k408_107015_c1
739 nmdc:mga0k408_2313_c1
740 nmdc:mga06z11_18859_c1
741 nmdc:mga06z11_3559_c1
742 nmdc:mga04h51_12328_c1
743 nmdc:mga05p37_3806_c1
744 nmdc:mga05p37_40307_c1
745 nmdc:mga05p37_45661_c1
746 nmdc:mga05p37_5246_c1
747 nmdc:mga05p37_54368_c1
748 nmdc:mga05p37_8365_c1
749 nmdc:mga09592_144890_c1
750 nmdc:mga09592_245176_c1
751 nmdc:mga09592_249512_c1
752 nmdc:mga09592_4928_c1
753 nmdc:mga09592_63596_c1
754 nmdc:mga09592_87122_c1
755 nmdc:mga0qj67_38247_c1
756 nmdc:mga0qj67_47518_c1
757 nmdc:mga0qj67_6391_c1
758 nmdc:mga0qj67_7597_c1
759 nmdc:mga06r32_104333_c1
760 nmdc:mga06r32_20569_c1
761 nmdc:mga06r32_33540_c1
762 nmdc:mga06r32_437551_c1
763 nmdc:mga06r32_62086_c1
764 nmdc:mga08y16_26409_c1
765 nmdc:mga08y16_335146_c1
766 nmdc:mga08y16_50568_c1
767 nmdc:mga08y16_6460_c1
768 nmdc:mga08y16_9556_c1
769 nmdc:mga0n895_37043_c1
770 nmdc:mga0rr50_110532_c1
771 nmdc:mga0rr50_216474_c1
772 nmdc:mga0rr50_347788_c1
773 nmdc:mga0rr50_53273_c1
774 nmdc:mga08x19_215157_c1
775 nmdc:mga08x19_41021_c1
776 nmdc:mga0a205_281137_c1
777 nmdc:mga0a205_521206_c1
778 nmdc:mga0a205_6171_c1
779 nmdc:mga0a205_6385_c1
780 Ga0495619_0012994
781 Ga0500556_0015879
782 Ga0590071_000043
783 Ga0590071_004262
784 Ga0590071_004375
785 Ga0590071_034258
786 Ga0590074_000723
787 Ga0590074_009089
788 Ga0590075_002116
789 Ga0590075_003003
790 Ga0590075_005302
791 Ga0590077_000159
792 Ga0590077_003009
793 Ga0590077_011863
794 Ga0501082_0146768
795 Ga0501082_0189233
796 Ga0501082_0469261
797 Ga0501082_0795332
798 Ga0530510_0005343

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13709

DUF4159

Domain of unknown function (DUF4159)

54

142

0.88

PF13709

DUF4159

Domain of unknown function (DUF4159)

139

257

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4i66-assembly1.cif.gz_A-2 crystal structure of hoch_4089 protein from haliangium ochraceum 0.7437 102 291
4i66-assembly1.cif.gz_A-2 crystal structure of hoch_4089 protein from haliangium ochraceum 0.6931 102 291
1e97-assembly1.cif.gz_A-2 crystal structure of ketosteroid isomerase from pseudomonas putida ; triple mutant y16f/y32f/y57f 0.6625 235 258
1dmm-assembly1.cif.gz_A-2 crystal structures of mutant enzymes y57f of ketosteroid isomerase from pseudomonas putida biotype b 0.6613 235 258
2inx-assembly1.cif.gz_A crystal structure of ketosteroid isomerase d40n from pseudomonas putida (pksi) with bound 2,6-difluorophenol 0.6508 235 258
ID Description Score Start End Superfamily
4i66A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Domain of unknown function DUF4159 0.7134 100 287 3.40.50.12140
af_Q4DHC1_29_128_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.6939 137 188 3.40.50.1000
4i66A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Domain of unknown function DUF4159 0.6684 100 287 3.40.50.12140
af_Q66HA4_1_121_2.60.40.2840 Mainly Beta;Sandwich;Immunoglobulin-like; 0.61 234 255 2.60.40.2840
af_Q54D97_569_921_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.5914 176 198 3.60.10.10
ID Description Score Start End GO Terms
AF-A0A257VSL0-F1-model_v4 DUF4159 domain-containing protein 0.9762 126 200
AF-A0A257VSL0-F1-model_v4 DUF4159 domain-containing protein 0.8946 126 200
AF-A0A7C0ZCM3-F1-model_v4 DUF4159 domain-containing protein 0.89 71 198
AF-A0A382ZBH7-F1-model_v4 DUF4159 domain-containing protein 0.8628 72 201
AF-A0A2V8J002-F1-model_v4 DUF4159 domain-containing protein 0.8358 71 293

Map