F434169

General Info

Members Datasets Scaffolds Average Seq Length
398 243 341 340

Family's Representative Sequence

Representative Sequence 3300049822|Ga0501035_0196998|Ga0501035_0196998_109_1296
Length 395
Sequence LKAPFARFIQKPVHTGYIARYFCYAGKYRLACGAASWQAGSGNFDNLTLKQTYFPSMKKSDLKISQATIWISSVFLGLLSSVPQIAEHHFNVAEAAVNAGLTATFALMMWYFNIFMMRRRTDNTRKQGISYTRLLSSLLFGLVVMLGLAWVQQLILSHINFGPVMLMVEVRGILINLVFYMFLHLLQQNYENQHVSMELERIKNDNLSAQYELLKQQVNPHFLFNSLNTLKAMVESGDEEAADFIIKLSNFYRFTLESRKLDLIHVHEEMEILNAYLFLQKARFDNGFTFKATLSDKTLGTLIPPFTLQLLVENCIKHNIVSLEKPLHIRIYEDPDGIVVENQVQQKTGDNNSLGVGLKNIDLRYSHLLDKHIDIINDQQIFQIKLPFIHEYHHH

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
3 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
4 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
5 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
6 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
7 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
8 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
9 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
10 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
11 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
12 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
13 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
14 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
15 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
16 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
17 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
18 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
19 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
20 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
21 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
22 2818991444 Filimonas endophytica 3197 Isolate Unclassified
23 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
24 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
25 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
26 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
27 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
28 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
29 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
30 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
31 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
32 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
33 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
34 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
35 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
36 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
37 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
38 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
39 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
40 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
41 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
42 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
43 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
44 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
45 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
46 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
47 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
48 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
49 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
50 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
51 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
52 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
53 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
54 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
55 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
56 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
57 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
58 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
59 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
60 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
61 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
62 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
63 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
64 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
65 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
66 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
67 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
68 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
69 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
70 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
71 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
72 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
73 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
74 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
75 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
76 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
77 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
78 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
79 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
80 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
81 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
82 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
83 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
84 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
85 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
86 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
87 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
88 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
89 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
90 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
91 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
92 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
112 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
113 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
116 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
117 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
118 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
119 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
120 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
121 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
122 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
123 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
124 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
127 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
130 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
131 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
133 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
152 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
153 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
154 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
155 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
156 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
157 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
163 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
164 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
165 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
166 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
167 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
168 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
169 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
170 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
171 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
172 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
173 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
174 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
175 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
176 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
177 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
178 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
179 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
180 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
181 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
182 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
183 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
184 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
185 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
186 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
187 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
188 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
189 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
190 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
191 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
192 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
193 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
194 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
195 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
196 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
197 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
198 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
199 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
200 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
201 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
202 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
203 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
204 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
205 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
206 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
207 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
208 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
209 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
210 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
211 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
214 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
215 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
216 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
217 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
218 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
219 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
220 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
221 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
222 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
223 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
224 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
225 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
226 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
227 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
228 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
229 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
230 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
231 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
232 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
233 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
234 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
235 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
236 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
237 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
238 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
239 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
240 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
241 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
242 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
243 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 85.43
Metatranscriptomes 0
Isolates 14.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.35
Nodule 0.25
Rhizoplane 0.75
Rhizosphere 61.31
Stem 0
Stem Tuber 0
Unclassified 18.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1514992 2162886007 Bacteria 3845
2 SwRhRL2b_contig_3363423 2162886007 Bacteria 16466
3 JGI24741J21665_1002079 3300001915 Bacteria 5356
4 JGI24740J21852_10001824 3300001979 Bacteria 9761
5 JGI24739J22299_10005326 3300001989 Bacteria 4899
6 JGI24739J22299_10007026 3300001989 Bacteria 4238
7 JGI24737J22298_10000457 3300001990 Bacteria 14037
8 JGI24735J21928_10000008 3300002067 Bacteria 319819
9 JGI24735J21928_10010468 3300002067 Bacteria 2956
10 JGI25162J39368_1000005 3300002737 Bacteria 435925
11 JGI25162J39368_1001122 3300002737 Bacteria 16127
12 JGI25154J39366_1000021 3300002738 Bacteria 221559
13 JGI25158J39367_1002903 3300002739 Bacteria 2710
14 JGI25157J39369_1002939 3300002741 Bacteria 3774
15 JGI25164J39214_1002229 3300002772 Bacteria 3166
16 JGI25152J39213_1000125 3300002773 Bacteria 52141
17 JGI25150J39212_1000001 3300002774 Bacteria 1318726
18 JGI25151J46595_10000005 3300003187 Bacteria 431598
19 JGI25165J46597_1004310 3300003214 Bacteria 3105
20 JGI25153J46596_10000018 3300003215 Bacteria 269774
21 JGI25153J46596_10000412 3300003215 Bacteria 28300
22 rootH1_10019084 3300003316 Bacteria 28574
23 rootH1_10116431 3300003316 Bacteria 2709
24 rootH2_10045691 3300003320 Bacteria 1754
25 rootH2_10118471 3300003320 Bacteria 3237
26 rootH2_10122821 3300003320 Bacteria 1716
27 rootH2_10142084 3300003320 Bacteria 2810
28 rootH2_10185469 3300003320 Bacteria 2490
29 rootL2_10008215 3300003322 Bacteria 13010
30 rootL2_10049568 3300003322 Bacteria 7025
31 rootL2_10076282 3300003322 Bacteria 8278
32 rootL2_10095994 3300003322 Bacteria 4150
33 rootL2_10129401 3300003322 Bacteria 4593
34 rootL2_10178171 3300003322 Bacteria 6008
35 rootL2_10256028 3300003322 Bacteria 1420
36 rootH1_10000856 3300003323 Bacteria 89425
37 rootH1_10009456 3300003323 Bacteria 35353
38 rootH1_10015682 3300003323 Bacteria 9007
39 rootH1_10049103 3300003316 Bacteria 3028
40 rootH1_10049103 3300003323 Bacteria 19767
41 rootH1_10125391 3300003323 Unclassified 3053
42 rootH1_10176484 3300003323 Bacteria 5093
43 rootH1_10184598 3300003323 Bacteria 2740
44 rootH1_10221553 3300003323 Bacteria 1825
45 rootH1_10272529 3300003323 Bacteria 3654
46 JGI25160J50197_1002202 3300003354 Bacteria 9160
47 JGI25160J50197_1002964 3300003354 Bacteria 7756
48 JGI25160J50197_1005908 3300003354 Bacteria 5027
49 Ga0055536_1000003 3300003781 Bacteria 447744
50 Ga0055528_1000620 3300003790 Bacteria 26412
51 Ga0055530_10001650 3300003791 Bacteria 15916
52 Ga0055531_10000139 3300003794 Bacteria 82993
53 Ga0055543_1004719 3300004625 Bacteria 3638
54 Ga0065165_1000032 3300005262 Bacteria 216051
55 Ga0065165_1000109 3300005262 Bacteria 137370
56 Ga0065165_1016177 3300005262 Bacteria 2805
57 Ga0065714_10010580 3300005288 Bacteria 4437
58 Ga0065714_10074803 3300005288 Bacteria 2988
59 Ga0065704_10000337 3300005289 Bacteria 30393
60 Ga0065704_10075544 3300005289 Bacteria 5529
61 Ga0065704_10077630 3300005289 Bacteria 4677
62 Ga0070682_100000605 3300005337 Bacteria 21844
63 Ga0070682_100019954 3300005337 Bacteria 3938
64 Ga0068868_100065851 3300005338 Bacteria 2879
65 Ga0070660_100040023 3300005339 Bacteria 3565
66 Ga0070669_100064990 3300005353 Bacteria 2687
67 Ga0070669_100161748 3300005353 Bacteria 1740
68 Ga0070659_100020410 3300005366 Bacteria 5032
69 Ga0070659_100070215 3300005366 Bacteria 2782
70 Ga0070662_100000003 3300005457 Bacteria 239813
71 Ga0070662_100016130 3300005457 Bacteria 5012
72 Ga0068853_100019969 3300005539 Bacteria 5566
73 Ga0068853_100086818 3300005539 Bacteria 2744
74 Ga0070665_100000178 3300005548 Bacteria 113002
75 Ga0070665_100000189 3300005548 Bacteria 109948
76 Ga0068857_100092426 3300005577 Bacteria 2709
77 Ga0068860_100000041 3300005843 Bacteria 227790
78 Ga0075366_10000181 3300006195 Bacteria 27528
79 Ga0075366_10035511 3300006195 Bacteria 2939
80 Ga0105244_10000050 3300009036 Bacteria 138868
81 Ga0105244_10000131 3300009036 Bacteria 76424
82 Ga0105240_10000160 3300009093 Bacteria 137390
83 Ga0105240_10000212 3300009093 Bacteria 117609
84 Ga0105240_10001569 3300009093 Bacteria 38745
85 Ga0105240_10006103 3300009093 Bacteria 17779
86 Ga0105243_10003425 3300009148 Bacteria 12847
87 Ga0105241_10001130 3300009174 Bacteria 20322
88 Ga0105241_10200174 3300009174 Bacteria 1668
89 Ga0105241_10306686 3300009174 Bacteria 1364
90 Ga0105242_10452827 3300009176 Bacteria 1210
91 Ga0105237_10005484 3300009545 Bacteria 14299
92 Ga0105237_10008559 3300009545 Bacteria 11063
93 Ga0105237_10013781 3300009545 Bacteria 8465
94 Ga0105237_10014137 3300009545 Bacteria 8353
95 Ga0105237_10018634 3300009545 Bacteria 7178
96 Ga0105237_10172348 3300009545 Bacteria 2164
97 Ga0105237_10198387 3300009545 Bacteria 2006
98 Ga0105237_10282185 3300009545 Bacteria 1663
99 Ga0105238_10016365 3300009551 Bacteria 7505
100 Ga0105239_10000032 3300010375 Bacteria 225528
101 Ga0105239_10000137 3300010375 Bacteria 102833
102 Ga0105239_10004342 3300010375 Bacteria 16988
103 Ga0105239_10020320 3300010375 Bacteria 7325
104 Ga0105239_10032086 3300010375 Bacteria 5772
105 Ga0105239_10069327 3300010375 Bacteria 3874
106 Ga0105239_10081819 3300010375 Bacteria 3555
107 Ga0105246_10019865 3300011119 Bacteria 4303
108 Ga0157373_10001883 3300013100 Bacteria 15913
109 Ga0157373_10004387 3300013100 Bacteria 10632
110 Ga0157373_10006325 3300013100 Bacteria 8846
111 Ga0157373_10010818 3300013100 Bacteria 6716
112 Ga0157373_10016125 3300013100 Bacteria 5454
113 Ga0157371_10000242 3300013102 Bacteria 78183
114 Ga0157371_10002388 3300013102 Bacteria 17967
115 Ga0157371_10004530 3300013102 Bacteria 12104
116 Ga0157371_10009491 3300013102 Bacteria 7653
117 Ga0157371_10020036 3300013102 Bacteria 4925
118 Ga0157370_10013484 3300013104 Bacteria 8417
119 Ga0157370_10014075 3300013104 Bacteria 8207
120 Ga0157370_10019624 3300013104 Bacteria 6772
121 Ga0157370_10034944 3300013104 Bacteria 4891
122 Ga0157370_10136808 3300013104 Unclassified 2283
123 Ga0157370_10211582 3300013104 Bacteria 1797
124 Ga0157370_10258337 3300013104 Unclassified 1610
125 Ga0157369_10000004 3300013105 Bacteria 479764
126 Ga0157369_10003300 3300013105 Bacteria 19193
127 Ga0157369_10224521 3300013105 Bacteria 1965
128 Ga0157369_10323778 3300013105 Bacteria 1602
129 Ga0157374_10000563 3300013296 Bacteria 32897
130 Ga0163162_10000008 3300013306 Bacteria 316194
131 Ga0163162_10234954 3300013306 Bacteria 1964
132 Ga0157372_10000009 3300013307 Bacteria 302051
133 Ga0157372_10000252 3300013307 Bacteria 59348
134 Ga0157372_10007329 3300013307 Bacteria 11743
135 Ga0157372_10090908 3300013307 Bacteria 3471
136 Ga0157372_10483053 3300013307 Bacteria 1444
137 Ga0157375_10000222 3300013308 Bacteria 53493
138 Ga0157375_10017439 3300013308 Bacteria 6480
139 Ga0182008_10000021 3300014497 Bacteria 227140
140 Ga0182008_10008219 3300014497 Bacteria 5710
141 Ga0157377_10142545 3300014745 Bacteria 1474
142 Ga0182006_1000012 3300015261 Bacteria 394239
143 Ga0182006_1000434 3300015261 Bacteria 33365
144 Ga0182007_10000006 3300015262 Bacteria 427355
145 Ga0182005_1000204 3300015265 Bacteria 40184
146 Ga0163161_10019684 3300017792 Bacteria 4734
147 Ga0213872_10008053 3300021361 Bacteria 5125
148 Ga0209436_100710 3300025208 Bacteria 13959
149 Ga0207427_100243 3300025231 Bacteria 43831
150 Ga0209437_100034 3300025233 Bacteria 494007
151 Ga0209437_100043 3300025233 Bacteria 440454
152 Ga0207425_1000002 3300025245 Bacteria 1362590
153 Ga0207425_1023552 3300025245 Bacteria 1288
154 Ga0209646_1000050 3300025246 Bacteria 296599
155 Ga0209646_1001502 3300025246 Bacteria 6192
156 Ga0209026_1000240 3300025250 Bacteria 71671
157 Ga0209129_1000002 3300025258 Bacteria 1359086
158 Ga0209129_1016288 3300025258 Bacteria 1497
159 Ga0209233_1000038 3300025261 Bacteria 548972
160 Ga0209455_1000882 3300025272 Bacteria 15832
161 Ga0209673_1000271 3300025273 Bacteria 97740
162 Ga0209130_1001404 3300025284 Bacteria 16096
163 Ga0209675_1000088 3300025291 Bacteria 147320
164 Ga0209676_1000001 3300025292 Bacteria 1852142
165 Ga0209676_1000774 3300025292 Bacteria 42719
166 Ga0209025_1000004 3300025294 Bacteria 1361782
167 Ga0209758_1000006 3300025297 Bacteria 1359562
168 Ga0209758_1001281 3300025297 Bacteria 31000
169 Ga0209050_1000016 3300025298 Bacteria 729149
170 Ga0209050_1020031 3300025298 Bacteria 2509
171 Ga0207426_1000032 3300025302 Bacteria 457997
172 Ga0207426_1000293 3300025302 Bacteria 98805
173 Ga0207426_1000700 3300025302 Bacteria 39724
174 Ga0207426_1003549 3300025302 Bacteria 8323
175 Ga0209257_1000025 3300025304 Bacteria 724838
176 Ga0209257_1002120 3300025304 Bacteria 20719
177 Ga0207655_1000480 3300025728 Bacteria 51524
178 Ga0207655_1000510 3300025728 Bacteria 49469
179 Ga0207647_10000049 3300025904 Bacteria 88392
180 Ga0207647_10000480 3300025904 Bacteria 32267
181 Ga0207695_10000489 3300025913 Bacteria 84728
182 Ga0207695_10004063 3300025913 Bacteria 20122
183 Ga0207695_10004212 3300025913 Bacteria 19763
184 Ga0207671_10001573 3300025914 Bacteria 26010
185 Ga0207671_10001899 3300025914 Bacteria 23236
186 Ga0207671_10050869 3300025914 Bacteria 3068
187 Ga0207671_10108630 3300025914 Bacteria 2108
188 Ga0207671_10122236 3300025914 Bacteria 1991
189 Ga0207657_10050776 3300025919 Bacteria 3607
190 Ga0207681_10177544 3300025923 Bacteria 1619
191 Ga0207694_10212300 3300025924 Bacteria 1577
192 Ga0207644_10012788 3300025931 Bacteria 5581
193 Ga0207690_10012993 3300025932 Bacteria 4993
194 Ga0207706_10000111 3300025933 Bacteria 87282
195 Ga0207706_10028977 3300025933 Bacteria 4943
196 Ga0207709_10002381 3300025935 Bacteria 11855
197 Ga0207667_10175931 3300025949 Bacteria 2199
198 Ga0207667_10252780 3300025949 Bacteria 1803
199 Ga0207658_10360201 3300025986 Bacteria 1269
200 Ga0207639_10007512 3300026041 Bacteria 7434
201 Ga0207639_10021016 3300026041 Bacteria 4681
202 Ga0207674_10039375 3300026116 Bacteria 4900
203 Ga0207674_10111316 3300026116 Bacteria 2712
204 Ga0268266_10000098 3300028379 Bacteria 182784
205 Ga0268266_10000180 3300028379 Bacteria 112295
206 Ga0268264_10000094 3300028381 Bacteria 231083
207 Ga0307515_10004429 3300028794 Bacteria 29072
208 Ga0307515_10007801 3300028794 Bacteria 21063
209 Ga0307515_10026375 3300028794 Bacteria 10006
210 Ga0316177_1210761 3300030731 Bacteria 8270
211 Ga0316176_1045869 3300030732 Bacteria 3683
212 Ga0316183_1047717 3300030742 Bacteria 56911
213 Ga0316181_1032668 3300030744 Bacteria 13809
214 Ga0307513_10112611 3300031456 Bacteria 2711
215 Ga0307408_100007854 3300031548 Bacteria 7052
216 Ga0307405_10000012 3300031731 Bacteria 233774
217 Ga0307405_10015231 3300031731 Bacteria 4159
218 Ga0307407_10000014 3300031903 Bacteria 156064
219 Ga0307412_10000029 3300031911 Bacteria 209074
220 Ga0307412_10000175 3300031911 Bacteria 45704
221 Ga0307412_10058947 3300031911 Bacteria 2571
222 Ga0307416_100000007 3300032002 Bacteria 433284
223 Ga0307414_10000484 3300032004 Bacteria 20707
224 Ga0307414_10116559 3300032004 Unclassified 2045
225 Ga0307414_10137674 3300032004 Unclassified 1906
226 Ga0307414_10173313 3300032004 Bacteria 1727
227 Ga0307414_10216999 3300032004 Unclassified 1568
228 Ga0307510_10024866 3300033180 Bacteria 6914
229 Ga0395899_0000220 3300037312 Bacteria 78900
230 Ga0436361_0665619 3300039447 Bacteria 11353
231 Ga0439465_0063790 3300041413 Bacteria 1224
232 Ga0451802_0360344 3300041460 Bacteria 1361
233 Ga0439431_0000081 3300041997 Bacteria 15454
234 Ga0439445_0000151 3300042004 Bacteria 12227
235 Ga0439457_000899 3300042014 Bacteria 8976
236 Ga0466969_0009231 3300044656 Bacteria 5230
237 Ga0466972_0000002 3300044658 Bacteria 408005
238 Ga0466972_0000014 3300044658 Bacteria 216776
239 Ga0466972_0000017 3300044658 Bacteria 199884
240 Ga0466972_0034442 3300044658 Bacteria 2481
241 Ga0466966_0035186 3300044684 Bacteria 3237
242 Ga0466961_0017203 3300044693 Bacteria 4645
243 Ga0466970_0001775 3300044765 Bacteria 10400
244 Ga0466970_0001923 3300044765 Bacteria 10040
245 Ga0466957_0001781 3300044842 Bacteria 11334
246 Ga0466957_0003227 3300044842 Bacteria 8924
247 Ga0466959_0020294 3300045049 Bacteria 4894
248 Ga0466958_0002948 3300045836 Bacteria 8708
249 Ga0495627_000002 3300046453 Bacteria 903861
250 Ga0495627_006760 3300046453 Bacteria 4462
251 Ga0495650_0000025 3300046471 Bacteria 486001
252 Ga0495585_0000017 3300046492 Bacteria 164054
253 Ga0495596_0003434 3300046500 Bacteria 8018
254 Ga0495606_0000026 3300046507 Bacteria 259118
255 Ga0495606_0011454 3300046507 Bacteria 7233
256 Ga0495606_0032737 3300046507 Bacteria 3596
257 Ga0495610_0000009 3300046512 Bacteria 554843
258 Ga0495610_0007114 3300046512 Bacteria 7547
259 Ga0495616_0002267 3300046513 Bacteria 12863
260 Ga0495632_0001703 3300046519 Bacteria 17915
261 Ga0495637_0042204 3300046520 Bacteria 1953
262 Ga0495644_0026807 3300046523 Bacteria 2185
263 Ga0495648_0008501 3300046524 Bacteria 8071
264 Ga0495648_0018503 3300046524 Bacteria 4928
265 Ga0495654_0000001 3300046530 Bacteria 1513197
266 Ga0495633_0000002 3300046558 Bacteria 488754
267 Ga0495633_0000894 3300046558 Bacteria 25504
268 Ga0495633_0012788 3300046558 Bacteria 4447
269 Ga0495668_0000003 3300046616 Bacteria 695023
270 Ga0495611_0000010 3300046648 Bacteria 156661
271 Ga0495625_0000008 3300046660 Bacteria 536165
272 Ga0495625_0000899 3300046660 Bacteria 40086
273 Ga0495625_0004252 3300046660 Bacteria 13638
274 Ga0495625_0011370 3300046660 Bacteria 7264
275 Ga0495625_0020939 3300046660 Bacteria 5042
276 Ga0495625_0078842 3300046660 Bacteria 2299
277 Ga0495661_0004208 3300046665 Bacteria 10456
278 Ga0495661_0038592 3300046665 Bacteria 2973
279 Ga0495649_0000006 3300046694 Bacteria 542188
280 Ga0495660_0006627 3300046810 Bacteria 6845
281 Ga0495687_002743 3300047443 Bacteria 13651
282 Ga0495686_0000095 3300047472 Bacteria 184643
283 Ga0495686_0012370 3300047472 Bacteria 5972
284 Ga0495686_0062668 3300047472 Bacteria 2306
285 Ga0495614_0026624 3300048089 Bacteria 2493
286 Ga0496113_0034581 3300048916 Bacteria 3688
287 Ga0496116_0000022 3300048919 Bacteria 482506
288 Ga0496117_0000074 3300048920 Bacteria 232732
289 Ga0496118_0001613 3300048921 Bacteria 33370
290 Ga0496119_0000017 3300048922 Bacteria 309779
291 Ga0496121_0000007 3300048924 Bacteria 942516
292 Ga0496122_0000159 3300048925 Bacteria 159297
293 Ga0496122_0000354 3300048925 Bacteria 98798
294 Ga0496122_0002282 3300048925 Bacteria 27757
295 Ga0496122_0006840 3300048925 Bacteria 12929
296 Ga0496123_0001157 3300048926 Bacteria 39190
297 Ga0496123_0004160 3300048926 Bacteria 15474
298 Ga0496123_0010609 3300048926 Bacteria 8109
299 Ga0496123_0026291 3300048926 Bacteria 4363
300 Ga0496124_0007684 3300048927 Bacteria 11404
301 Ga0496125_0001036 3300048928 Bacteria 43109
302 Ga0496125_0003480 3300048928 Bacteria 19037
303 Ga0496126_0013884 3300048929 Bacteria 8171
304 Ga0496126_0022716 3300048929 Bacteria 6094
305 Ga0501047_0022561 3300049581 Bacteria 6044
306 Ga0501202_000736 3300049652 Bacteria 4893
307 Ga0501236_000520 3300049670 Bacteria 4306
308 Ga0501257_000238 3300049686 Bacteria 10814
309 Ga0501225_0000271 3300049705 Bacteria 16361
310 Ga0501241_000254 3300049758 Bacteria 11801
311 Ga0501241_016482 3300049758 Bacteria 1348
312 Ga0501264_001894 3300049761 Bacteria 2048
313 Ga0501035_0196998 3300049822 Bacteria 1730
314 nmdc:mga0k408_70256_c1 3300050493 Bacteria 2044
315 nmdc:mga0k408_70_c2 3300050493 Bacteria 27573
316 Ga0500635_0005155 3300053080 Bacteria 3407
317 Ga0500578_0000362 3300053086 Bacteria 55748
318 Ga0500644_0000222 3300053088 Bacteria 32776
319 Ga0500581_048383 3300053089 Bacteria 2171
320 Ga0500646_0003119 3300053090 Bacteria 4252
321 Ga0500583_0000214 3300053092 Bacteria 21581
322 Ga0500583_0026609 3300053092 Unclassified 2487
323 Ga0500651_0045844 3300053093 Unclassified 2750
324 Ga0500562_000083 3300053108 Bacteria 41350
325 Ga0500569_000383 3300053109 Bacteria 7165
326 Ga0500607_019201 3300053121 Bacteria 3872
327 Ga0500618_000004 3300053125 Bacteria 293180
328 Ga0500642_0023792 3300053130 Bacteria 2465
329 Ga0500652_005691 3300053131 Bacteria 3950
330 Ga0500568_0005250 3300053139 Bacteria 6735
331 Ga0500577_0003007 3300053142 Bacteria 4349
332 Ga0500589_012330 3300053147 Bacteria 3738
333 Ga0500616_0000004 3300053153 Bacteria 1002714
334 Ga0500616_0008043 3300053153 Bacteria 6605
335 Ga0500616_0064218 3300053153 Unclassified 1891
336 Ga0500622_0000267 3300053156 Bacteria 53425
337 Ga0500622_0009120 3300053156 Bacteria 5506
338 Ga0500627_0004625 3300053158 Bacteria 4451
339 Ga0500633_0063432 3300053160 Unclassified 1304
340 Ga0500634_0036263 3300053161 Unclassified 2685
341 Ga0500645_024284 3300053730 Bacteria 1853

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2889290771 2889291256 304
2 3300046453 Ga0495627_000002 Ga0495627_000002_233608_234624 307
3 3300046530 Ga0495654_0000001 Ga0495654_0000001_1268495_1269652 307
4 3300046558 Ga0495633_0000002 Ga0495633_0000002_216197_217213 307
5 3300047472 Ga0495686_0012370 Ga0495686_0012370_2953_3969 307
6 3300031911 Ga0307412_10000175 Ga0307412_1000017541 309
7 3300046519 Ga0495632_0001703 Ga0495632_0001703_15910_17046 309
8 3300046558 Ga0495633_0000894 Ga0495633_0000894_2723_3739 309
9 3300046660 Ga0495625_0000899 Ga0495625_0000899_11256_12392 309
10 3300049758 Ga0501241_000254 Ga0501241_000254_9003_10019 309
11 3300009036 Ga0105244_10000131 Ga0105244_1000013166 310
12 3300025728 Ga0207655_1000510 Ga0207655_100051054 310
13 3300042004 Ga0439445_0000151 Ga0439445_0000151_1777_2835 316
14 3300046507 Ga0495606_0032737 Ga0495606_0032737_2609_3559 316
15 3300046665 Ga0495661_0004208 Ga0495661_0004208_2756_3706 316
16 3300053156 Ga0500622_0000267 Ga0500622_0000267_1812_2762 316
17 3300005366 Ga0070659_100020410 Ga0070659_1000204103 318
18 3300025932 Ga0207690_10012993 Ga0207690_100129933 318
19 3300025914 Ga0207671_10122236 Ga0207671_101222362 320
20 3300046660 Ga0495625_0020939 Ga0495625_0020939_3004_3966 320
21 3300049705 Ga0501225_0000271 Ga0501225_0000271_10894_11856 320
22 3300049581 Ga0501047_0022561 Ga0501047_0022561_4135_5100 321
23 3300041460 Ga0451802_0360344 Ga0451802_0360344_180_1226 323
24 3300001979 JGI24740J21852_10001824 JGI24740J21852_100018249 326
25 3300002738 JGI25154J39366_1000021 JGI25154J39366_100002135 326
26 3300002741 JGI25157J39369_1002939 JGI25157J39369_10029392 326
27 3300003215 JGI25153J46596_10000412 JGI25153J46596_1000041223 326
28 3300003320 rootH2_10142084 rootH2_101420842 326
29 3300003323 rootH1_10272529 rootH1_102725293 326
30 3300005337 Ga0070682_100019954 Ga0070682_1000199544 326
31 3300025245 Ga0207425_1023552 Ga0207425_10235522 326
32 3300025246 Ga0209646_1000050 Ga0209646_1000050220 326
33 3300025250 Ga0209026_1000240 Ga0209026_100024048 326
34 3300025258 Ga0209129_1016288 Ga0209129_10162882 326
35 3300025297 Ga0209758_1001281 Ga0209758_100128115 326
36 3300025302 Ga0207426_1000293 Ga0207426_100029351 326
37 3300053131 Ga0500652_005691 Ga0500652_005691_2508_3611 326
38 3300003322 rootL2_10095994 rootL2_100959946 327
39 3300003323 rootH1_10176484 rootH1_101764844 327
40 3300031911 Ga0307412_10058947 Ga0307412_100589472 329
41 3300048929 Ga0496126_0022716 Ga0496126_0022716_4697_5698 332
42 iso_pu_bacteria 2818991442 2819575482 332
43 iso_pu_bacteria 2821136567 2821138030 332
44 iso_pu_bacteria 2904467357 2904468825 332
45 iso_pu_bacteria 2582581278 2585145485 333
46 iso_pu_bacteria 2585428182 2588209582 333
47 iso_pu_bacteria 2585428183 2588213875 333
48 iso_pu_bacteria 2585428184 2588218508 333
49 iso_pu_bacteria 2585428185 2588225807 333
50 iso_pu_bacteria 2765235839 2765573290 333
51 iso_pu_bacteria 2772190705 2772605073 333
52 iso_pu_bacteria 2816332188 2816873689 333
53 iso_pu_bacteria 2871720351 2871720751 333
54 iso_pu_bacteria 2889290771 2889291037 333
55 3300003323 rootH1_10015682 rootH1_100156822 334
56 3300028794 Ga0307515_10007801 Ga0307515_1000780112 334
57 3300045049 Ga0466959_0020294 Ga0466959_0020294_188_1192 334
58 iso_pu_bacteria 2585428045 2587677665 334
59 iso_pu_bacteria 2585428060 2587746815 334
60 iso_pu_bacteria 2585428095 2587867969 334
61 iso_pu_bacteria 2585428115 2587943330 334
62 iso_pu_bacteria 2588253712 2588444953 334
63 iso_pu_bacteria 2588254255 2590604473 334
64 iso_pu_bacteria 2728369107 2729199190 334
65 iso_pu_bacteria 2775506739 2775672523 334
66 iso_pu_bacteria 2818991444 2819587570 334
67 iso_pu_bacteria 2842083920 2842085094 334
68 iso_pu_bacteria 2919097161 2919100659 334
69 iso_pu_bacteria 2945924605 2945927934 334
70 iso_pu_bacteria 2946019816 2946021938 334
71 3300003323 rootH1_10184598 rootH1_101845982 335
72 iso_pu_bacteria 2522125168 2522550632 335
73 iso_pu_bacteria 2599185184 2599476671 335
74 iso_pu_bacteria 2842903701 2842906648 335
75 iso_pu_bacteria 2842909656 2842914951 335
76 iso_pu_bacteria 2852623160 2852624454 335
77 iso_pu_bacteria 2884933994 2884936677 335
78 iso_pu_bacteria 2896109856 2896115402 335
79 iso_pu_bacteria 2919186247 2919190485 335
80 iso_pu_bacteria 2919437846 2919439116 335
81 iso_pu_bacteria 2928078545 2928078620 335
82 iso_pu_bacteria 2928147474 2928151703 335
83 iso_pu_bacteria 2929177148 2929181423 335
84 iso_pu_bacteria 2929239360 2929239679 335
85 iso_pu_bacteria 2929239360 2929243611 335
86 iso_pu_bacteria 2932082852 2932084320 335
87 iso_pu_bacteria 2939664404 2939668766 335
88 iso_pu_bacteria 2945977869 2945983830 335
89 iso_pu_bacteria 2945997725 2946001294 335
90 iso_pu_bacteria 2946013367 2946016776 335
91 iso_pu_bacteria 2954016120 2954018191 335
92 iso_pu_bacteria 8003151029 8003156035 335
93 3300005262 Ga0065165_1016177 Ga0065165_10161772 336
94 3300005288 Ga0065714_10010580 Ga0065714_100105806 336
95 3300005289 Ga0065704_10000337 Ga0065704_1000033729 336
96 3300015265 Ga0182005_1000204 Ga0182005_10002044 336
97 3300025302 Ga0207426_1003549 Ga0207426_10035498 336
98 3300031911 Ga0307412_10000029 Ga0307412_1000002987 336
99 iso_pu_bacteria 2818991460 2819680076 336
100 iso_pu_bacteria 2884791551 2884791962 336
101 3300001915 JGI24741J21665_1002079 JGI24741J21665_10020792 337
102 3300005337 Ga0070682_100000605 Ga0070682_10000060519 337
103 3300005339 Ga0070660_100040023 Ga0070660_1000400233 337
104 3300009036 Ga0105244_10000050 Ga0105244_1000005063 337
105 3300013100 Ga0157373_10006325 Ga0157373_100063258 337
106 3300013104 Ga0157370_10013484 Ga0157370_100134845 337
107 3300025291 Ga0209675_1000088 Ga0209675_1000088156 337
108 3300025728 Ga0207655_1000480 Ga0207655_100048043 337
109 3300025919 Ga0207657_10050776 Ga0207657_100507763 337
110 3300046500 Ga0495596_0003434 Ga0495596_0003434_5336_6349 337
111 3300048916 Ga0496113_0034581 Ga0496113_0034581_852_1865 337
112 3300048919 Ga0496116_0000022 Ga0496116_0000022_53670_54683 337
113 3300048920 Ga0496117_0000074 Ga0496117_0000074_57000_58013 337
114 3300048921 Ga0496118_0001613 Ga0496118_0001613_6698_7711 337
115 3300048922 Ga0496119_0000017 Ga0496119_0000017_174637_175650 337
116 3300048924 Ga0496121_0000007 Ga0496121_0000007_418559_419578 337
117 3300048925 Ga0496122_0000354 Ga0496122_0000354_61712_62725 337
118 3300048925 Ga0496122_0002282 Ga0496122_0002282_16875_17888 337
119 3300048926 Ga0496123_0001157 Ga0496123_0001157_9921_10934 337
120 3300048926 Ga0496123_0010609 Ga0496123_0010609_4819_5832 337
121 3300048927 Ga0496124_0007684 Ga0496124_0007684_1549_2562 337
122 3300048928 Ga0496125_0001036 Ga0496125_0001036_3417_4430 337
123 3300048929 Ga0496126_0013884 Ga0496126_0013884_479_1492 337
124 iso_pu_bacteria 2588254257 2590610612 337
125 iso_pu_bacteria 2884791551 2884792567 337
126 3300002773 JGI25152J39213_1000125 JGI25152J39213_10001259 338
127 3300002774 JGI25150J39212_1000001 JGI25150J39212_10000011195 338
128 3300003187 JGI25151J46595_10000005 JGI25151J46595_100000053 338
129 3300003215 JGI25153J46596_10000018 JGI25153J46596_10000018231 338
130 3300005289 Ga0065704_10075544 Ga0065704_100755445 338
131 3300009148 Ga0105243_10003425 Ga0105243_100034258 338
132 3300013308 Ga0157375_10000222 Ga0157375_1000022224 338
133 3300015261 Ga0182006_1000012 Ga0182006_1000012100 338
134 3300025245 Ga0207425_1000002 Ga0207425_10000028 338
135 3300025258 Ga0209129_1000002 Ga0209129_10000028 338
136 3300025294 Ga0209025_1000004 Ga0209025_10000041181 338
137 3300025297 Ga0209758_1000006 Ga0209758_10000061181 338
138 3300025935 Ga0207709_10002381 Ga0207709_100023818 338
139 3300028794 Ga0307515_10026375 Ga0307515_100263755 338
140 3300041413 Ga0439465_0063790 Ga0439465_0063790_58_1086 338
141 3300046453 Ga0495627_006760 Ga0495627_006760_3180_4196 338
142 3300046512 Ga0495610_0000009 Ga0495610_0000009_118234_119250 338
143 3300046524 Ga0495648_0008501 Ga0495648_0008501_1010_2053 338
144 3300046616 Ga0495668_0000003 Ga0495668_0000003_108694_109737 338
145 3300047472 Ga0495686_0000095 Ga0495686_0000095_130544_131629 338
146 3300047472 Ga0495686_0062668 Ga0495686_0062668_218_1261 338
147 3300048925 Ga0496122_0000159 Ga0496122_0000159_22584_23600 338
148 3300048926 Ga0496123_0026291 Ga0496123_0026291_918_1934 338
149 3300048928 Ga0496125_0003480 Ga0496125_0003480_11165_12181 338
150 2162886007 SwRhRL2b_contig_1514992 SwRhRL2b_0869.00005470 339
151 2162886007 SwRhRL2b_contig_3363423 SwRhRL2b_0069.00001510 339
152 3300001989 JGI24739J22299_10005326 JGI24739J22299_100053267 339
153 3300001989 JGI24739J22299_10007026 JGI24739J22299_100070263 339
154 3300001990 JGI24737J22298_10000457 JGI24737J22298_100004579 339
155 3300002067 JGI24735J21928_10000008 JGI24735J21928_10000008196 339
156 3300002067 JGI24735J21928_10010468 JGI24735J21928_100104683 339
157 3300002737 JGI25162J39368_1000005 JGI25162J39368_1000005287 339
158 3300002737 JGI25162J39368_1001122 JGI25162J39368_100112214 339
159 3300002739 JGI25158J39367_1002903 JGI25158J39367_10029032 339
160 3300002772 JGI25164J39214_1002229 JGI25164J39214_10022294 339
161 3300003214 JGI25165J46597_1004310 JGI25165J46597_10043101 339
162 3300003316 rootH1_10019084 rootH1_1001908415 339
163 3300003316 rootH1_10116431 rootH1_101164313 339
164 3300003320 rootH2_10045691 rootH2_100456911 339
165 3300003320 rootH2_10118471 rootH2_101184714 339
166 3300003320 rootH2_10122821 rootH2_101228212 339
167 3300003320 rootH2_10185469 rootH2_101854692 339
168 3300003322 rootL2_10008215 rootL2_100082154 339
169 3300003322 rootL2_10049568 rootL2_100495687 339
170 3300003322 rootL2_10076282 rootL2_100762826 339
171 3300003322 rootL2_10129401 rootL2_101294014 339
172 3300003322 rootL2_10178171 rootL2_101781713 339
173 3300003322 rootL2_10256028 rootL2_102560282 339
174 3300003323 rootH1_10000856 rootH1_1000085655 339
175 3300003323 rootH1_10009456 rootH1_100094562 339
176 3300003323 rootH1_10049103 rootH1_1004910322 339
177 3300003323 rootH1_10125391 rootH1_101253911 339
178 3300003323 rootH1_10221553 rootH1_102215531 339
179 3300003354 JGI25160J50197_1002202 JGI25160J50197_10022026 339
180 3300003354 JGI25160J50197_1002964 JGI25160J50197_10029645 339
181 3300003354 JGI25160J50197_1005908 JGI25160J50197_10059086 339
182 3300003781 Ga0055536_1000003 Ga0055536_1000003198 339
183 3300003790 Ga0055528_1000620 Ga0055528_10006204 339
184 3300003791 Ga0055530_10001650 Ga0055530_100016507 339
185 3300003794 Ga0055531_10000139 Ga0055531_100001397 339
186 3300004625 Ga0055543_1004719 Ga0055543_10047194 339
187 3300005262 Ga0065165_1000032 Ga0065165_100003239 339
188 3300005262 Ga0065165_1000109 Ga0065165_100010978 339
189 3300005288 Ga0065714_10074803 Ga0065714_100748032 339
190 3300005289 Ga0065704_10077630 Ga0065704_100776306 339
191 3300005338 Ga0068868_100065851 Ga0068868_1000658513 339
192 3300005353 Ga0070669_100064990 Ga0070669_1000649903 339
193 3300005353 Ga0070669_100161748 Ga0070669_1001617482 339
194 3300005366 Ga0070659_100070215 Ga0070659_1000702153 339
195 3300005457 Ga0070662_100000003 Ga0070662_100000003210 339
196 3300005457 Ga0070662_100016130 Ga0070662_1000161303 339
197 3300005539 Ga0068853_100019969 Ga0068853_1000199694 339
198 3300005539 Ga0068853_100086818 Ga0068853_1000868183 339
199 3300005548 Ga0070665_100000178 Ga0070665_10000017861 339
200 3300005548 Ga0070665_100000189 Ga0070665_10000018977 339
201 3300005577 Ga0068857_100092426 Ga0068857_1000924263 339
202 3300005843 Ga0068860_100000041 Ga0068860_100000041155 339
203 3300006195 Ga0075366_10000181 Ga0075366_1000018116 339
204 3300006195 Ga0075366_10035511 Ga0075366_100355114 339
205 3300009093 Ga0105240_10000160 Ga0105240_1000016082 339
206 3300009093 Ga0105240_10000212 Ga0105240_1000021261 339
207 3300009093 Ga0105240_10001569 Ga0105240_1000156931 339
208 3300009093 Ga0105240_10006103 Ga0105240_100061033 339
209 3300009174 Ga0105241_10001130 Ga0105241_100011303 339
210 3300009174 Ga0105241_10200174 Ga0105241_102001742 339
211 3300009174 Ga0105241_10306686 Ga0105241_103066862 339
212 3300009176 Ga0105242_10452827 Ga0105242_104528271 339
213 3300009545 Ga0105237_10005484 Ga0105237_100054847 339
214 3300009545 Ga0105237_10008559 Ga0105237_1000855912 339
215 3300009545 Ga0105237_10013781 Ga0105237_100137816 339
216 3300009545 Ga0105237_10014137 Ga0105237_100141379 339
217 3300009545 Ga0105237_10018634 Ga0105237_100186342 339
218 3300009545 Ga0105237_10172348 Ga0105237_101723482 339
219 3300009545 Ga0105237_10198387 Ga0105237_101983872 339
220 3300009545 Ga0105237_10282185 Ga0105237_102821852 339
221 3300009551 Ga0105238_10016365 Ga0105238_100163652 339
222 3300010375 Ga0105239_10000032 Ga0105239_10000032127 339
223 3300010375 Ga0105239_10000137 Ga0105239_1000013768 339
224 3300010375 Ga0105239_10004342 Ga0105239_100043423 339
225 3300010375 Ga0105239_10020320 Ga0105239_100203203 339
226 3300010375 Ga0105239_10032086 Ga0105239_100320864 339
227 3300010375 Ga0105239_10069327 Ga0105239_100693272 339
228 3300010375 Ga0105239_10081819 Ga0105239_100818193 339
229 3300011119 Ga0105246_10019865 Ga0105246_100198653 339
230 3300013100 Ga0157373_10001883 Ga0157373_1000188315 339
231 3300013100 Ga0157373_10004387 Ga0157373_1000438714 339
232 3300013100 Ga0157373_10010818 Ga0157373_100108182 339
233 3300013100 Ga0157373_10016125 Ga0157373_100161253 339
234 3300013102 Ga0157371_10000242 Ga0157371_1000024235 339
235 3300013102 Ga0157371_10002388 Ga0157371_1000238810 339
236 3300013102 Ga0157371_10004530 Ga0157371_1000453014 339
237 3300013102 Ga0157371_10009491 Ga0157371_100094911 339
238 3300013102 Ga0157371_10020036 Ga0157371_100200362 339
239 3300013104 Ga0157370_10014075 Ga0157370_100140759 339
240 3300013104 Ga0157370_10019624 Ga0157370_100196245 339
241 3300013104 Ga0157370_10034944 Ga0157370_100349445 339
242 3300013104 Ga0157370_10136808 Ga0157370_101368083 339
243 3300013104 Ga0157370_10211582 Ga0157370_102115822 339
244 3300013104 Ga0157370_10258337 Ga0157370_102583371 339
245 3300013105 Ga0157369_10000004 Ga0157369_10000004339 339
246 3300013105 Ga0157369_10003300 Ga0157369_1000330014 339
247 3300013105 Ga0157369_10224521 Ga0157369_102245212 339
248 3300013105 Ga0157369_10323778 Ga0157369_103237781 339
249 3300013296 Ga0157374_10000563 Ga0157374_1000056328 339
250 3300013306 Ga0163162_10000008 Ga0163162_10000008227 339
251 3300013306 Ga0163162_10234954 Ga0163162_102349542 339
252 3300013307 Ga0157372_10000009 Ga0157372_10000009197 339
253 3300013307 Ga0157372_10000252 Ga0157372_100002525 339
254 3300013307 Ga0157372_10007329 Ga0157372_100073295 339
255 3300013307 Ga0157372_10090908 Ga0157372_100909082 339
256 3300013307 Ga0157372_10483053 Ga0157372_104830531 339
257 3300013308 Ga0157375_10017439 Ga0157375_100174393 339
258 3300014497 Ga0182008_10000021 Ga0182008_1000002179 339
259 3300014497 Ga0182008_10008219 Ga0182008_100082195 339
260 3300014745 Ga0157377_10142545 Ga0157377_101425452 339
261 3300015261 Ga0182006_1000434 Ga0182006_10004348 339
262 3300015262 Ga0182007_10000006 Ga0182007_10000006130 339
263 3300017792 Ga0163161_10019684 Ga0163161_100196842 339
264 3300021361 Ga0213872_10008053 Ga0213872_100080533 339
265 3300025208 Ga0209436_100710 Ga0209436_10071011 339
266 3300025231 Ga0207427_100243 Ga0207427_10024313 339
267 3300025233 Ga0209437_100034 Ga0209437_100034372 339
268 3300025233 Ga0209437_100043 Ga0209437_100043120 339
269 3300025246 Ga0209646_1001502 Ga0209646_10015028 339
270 3300025261 Ga0209233_1000038 Ga0209233_1000038372 339
271 3300025272 Ga0209455_1000882 Ga0209455_100088212 339
272 3300025273 Ga0209673_1000271 Ga0209673_100027137 339
273 3300025284 Ga0209130_1001404 Ga0209130_100140412 339
274 3300025292 Ga0209676_1000001 Ga0209676_1000001533 339
275 3300025292 Ga0209676_1000774 Ga0209676_100077425 339
276 3300025298 Ga0209050_1000016 Ga0209050_1000016198 339
277 3300025298 Ga0209050_1020031 Ga0209050_10200313 339
278 3300025302 Ga0207426_1000032 Ga0207426_1000032296 339
279 3300025302 Ga0207426_1000700 Ga0207426_100070024 339
280 3300025304 Ga0209257_1000025 Ga0209257_100002512 339
281 3300025304 Ga0209257_1002120 Ga0209257_10021209 339
282 3300025904 Ga0207647_10000049 Ga0207647_1000004925 339
283 3300025904 Ga0207647_10000480 Ga0207647_100004809 339
284 3300025913 Ga0207695_10000489 Ga0207695_1000048932 339
285 3300025913 Ga0207695_10004063 Ga0207695_100040635 339
286 3300025913 Ga0207695_10004212 Ga0207695_100042124 339
287 3300025914 Ga0207671_10001573 Ga0207671_100015737 339
288 3300025914 Ga0207671_10001899 Ga0207671_1000189911 339
289 3300025914 Ga0207671_10050869 Ga0207671_100508692 339
290 3300025914 Ga0207671_10108630 Ga0207671_101086302 339
291 3300025923 Ga0207681_10177544 Ga0207681_101775442 339
292 3300025924 Ga0207694_10212300 Ga0207694_102123002 339
293 3300025931 Ga0207644_10012788 Ga0207644_100127886 339
294 3300025933 Ga0207706_10000111 Ga0207706_1000011124 339
295 3300025933 Ga0207706_10028977 Ga0207706_100289773 339
296 3300025949 Ga0207667_10175931 Ga0207667_101759313 339
297 3300025949 Ga0207667_10252780 Ga0207667_102527802 339
298 3300025986 Ga0207658_10360201 Ga0207658_103602011 339
299 3300026041 Ga0207639_10007512 Ga0207639_100075125 339
300 3300026041 Ga0207639_10021016 Ga0207639_100210162 339
301 3300026116 Ga0207674_10039375 Ga0207674_100393753 339
302 3300026116 Ga0207674_10111316 Ga0207674_101113162 339
303 3300028379 Ga0268266_10000098 Ga0268266_10000098105 339
304 3300028379 Ga0268266_10000180 Ga0268266_1000018020 339
305 3300028381 Ga0268264_10000094 Ga0268264_1000009475 339
306 3300028794 Ga0307515_10004429 Ga0307515_1000442917 339
307 3300030731 Ga0316177_1210761 Ga0316177_12107616 339
308 3300030732 Ga0316176_1045869 Ga0316176_10458693 339
309 3300030742 Ga0316183_1047717 Ga0316183_104771725 339
310 3300030744 Ga0316181_1032668 Ga0316181_103266815 339
311 3300031456 Ga0307513_10112611 Ga0307513_101126112 339
312 3300031548 Ga0307408_100007854 Ga0307408_1000078545 339
313 3300031731 Ga0307405_10000012 Ga0307405_10000012152 339
314 3300031731 Ga0307405_10015231 Ga0307405_100152313 339
315 3300031903 Ga0307407_10000014 Ga0307407_1000001466 339
316 3300032002 Ga0307416_100000007 Ga0307416_100000007126 339
317 3300032004 Ga0307414_10000484 Ga0307414_1000048415 339
318 3300032004 Ga0307414_10116559 Ga0307414_101165593 339
319 3300032004 Ga0307414_10137674 Ga0307414_101376742 339
320 3300032004 Ga0307414_10173313 Ga0307414_101733132 339
321 3300032004 Ga0307414_10216999 Ga0307414_102169992 339
322 3300033180 Ga0307510_10024866 Ga0307510_100248667 339
323 3300037312 Ga0395899_0000220 Ga0395899_0000220_75703_76794 339
324 3300039447 Ga0436361_0665619 Ga0436361_0665619_1999_3060 339
325 3300041997 Ga0439431_0000081 Ga0439431_0000081_14134_15153 339
326 3300042014 Ga0439457_000899 Ga0439457_000899_6675_7694 339
327 3300044656 Ga0466969_0009231 Ga0466969_0009231_330_1349 339
328 3300044658 Ga0466972_0000002 Ga0466972_0000002_264400_265431 339
329 3300044658 Ga0466972_0000014 Ga0466972_0000014_77653_78684 339
330 3300044658 Ga0466972_0000017 Ga0466972_0000017_168216_169235 339
331 3300044658 Ga0466972_0034442 Ga0466972_0034442_1095_2114 339
332 3300044684 Ga0466966_0035186 Ga0466966_0035186_1565_2584 339
333 3300044693 Ga0466961_0017203 Ga0466961_0017203_2024_3043 339
334 3300044765 Ga0466970_0001775 Ga0466970_0001775_1981_3012 339
335 3300044765 Ga0466970_0001923 Ga0466970_0001923_5108_6139 339
336 3300044842 Ga0466957_0001781 Ga0466957_0001781_7383_8402 339
337 3300044842 Ga0466957_0003227 Ga0466957_0003227_6365_7384 339
338 3300045836 Ga0466958_0002948 Ga0466958_0002948_1432_2451 339
339 3300046471 Ga0495650_0000025 Ga0495650_0000025_23417_24439 339
340 3300046492 Ga0495585_0000017 Ga0495585_0000017_52181_53203 339
341 3300046507 Ga0495606_0000026 Ga0495606_0000026_34452_35474 339
342 3300046507 Ga0495606_0011454 Ga0495606_0011454_4183_5253 339
343 3300046512 Ga0495610_0007114 Ga0495610_0007114_47_1069 339
344 3300046513 Ga0495616_0002267 Ga0495616_0002267_1433_2455 339
345 3300046520 Ga0495637_0042204 Ga0495637_0042204_657_1679 339
346 3300046523 Ga0495644_0026807 Ga0495644_0026807_687_1730 339
347 3300046524 Ga0495648_0018503 Ga0495648_0018503_1279_2298 339
348 3300046558 Ga0495633_0012788 Ga0495633_0012788_460_1482 339
349 3300046648 Ga0495611_0000010 Ga0495611_0000010_129679_130761 339
350 3300046660 Ga0495625_0000008 Ga0495625_0000008_271913_272935 339
351 3300046660 Ga0495625_0004252 Ga0495625_0004252_10697_11716 339
352 3300046660 Ga0495625_0011370 Ga0495625_0011370_4544_5590 339
353 3300046660 Ga0495625_0078842 Ga0495625_0078842_963_1994 339
354 3300046665 Ga0495661_0038592 Ga0495661_0038592_707_1729 339
355 3300046694 Ga0495649_0000006 Ga0495649_0000006_497414_498436 339
356 3300046810 Ga0495660_0006627 Ga0495660_0006627_2946_3965 339
357 3300047443 Ga0495687_002743 Ga0495687_002743_2617_3642 339
358 3300048089 Ga0495614_0026624 Ga0495614_0026624_1209_2228 339
359 3300048925 Ga0496122_0006840 Ga0496122_0006840_3265_4284 339
360 3300048926 Ga0496123_0004160 Ga0496123_0004160_9643_10662 339
361 3300049652 Ga0501202_000736 Ga0501202_000736_244_1263 339
362 3300049670 Ga0501236_000520 Ga0501236_000520_2615_3634 339
363 3300049686 Ga0501257_000238 Ga0501257_000238_8627_9646 339
364 3300049758 Ga0501241_016482 Ga0501241_016482_248_1267 339
365 3300049761 Ga0501264_001894 Ga0501264_001894_411_1430 339
366 3300049822 Ga0501035_0196998 Ga0501035_0196998_109_1296 339
367 3300050493 nmdc:mga0k408_70256_c1 nmdc:mga0k408_70256_c1_603_1625 339
368 3300050493 nmdc:mga0k408_70_c2 nmdc:mga0k408_70_c2_19159_20178 339
369 3300053080 Ga0500635_0005155 Ga0500635_0005155_775_1794 339
370 3300053086 Ga0500578_0000362 Ga0500578_0000362_17871_18890 339
371 3300053088 Ga0500644_0000222 Ga0500644_0000222_25614_26633 339
372 3300053089 Ga0500581_048383 Ga0500581_048383_1004_2035 339
373 3300053090 Ga0500646_0003119 Ga0500646_0003119_2746_3765 339
374 3300053092 Ga0500583_0000214 Ga0500583_0000214_16422_17531 339
375 3300053092 Ga0500583_0026609 Ga0500583_0026609_898_1917 339
376 3300053093 Ga0500651_0045844 Ga0500651_0045844_1036_2055 339
377 3300053108 Ga0500562_000083 Ga0500562_000083_11556_12575 339
378 3300053109 Ga0500569_000383 Ga0500569_000383_5496_6515 339
379 3300053121 Ga0500607_019201 Ga0500607_019201_1353_2372 339
380 3300053125 Ga0500618_000004 Ga0500618_000004_166091_167110 339
381 3300053130 Ga0500642_0023792 Ga0500642_0023792_1133_2197 339
382 3300053139 Ga0500568_0005250 Ga0500568_0005250_3813_4841 339
383 3300053142 Ga0500577_0003007 Ga0500577_0003007_785_1804 339
384 3300053147 Ga0500589_012330 Ga0500589_012330_1966_3093 339
385 3300053153 Ga0500616_0000004 Ga0500616_0000004_228692_229711 339
386 3300053153 Ga0500616_0008043 Ga0500616_0008043_873_1892 339
387 3300053153 Ga0500616_0064218 Ga0500616_0064218_326_1345 339
388 3300053156 Ga0500622_0009120 Ga0500622_0009120_1307_2410 339
389 3300053158 Ga0500627_0004625 Ga0500627_0004625_1791_2810 339
390 3300053160 Ga0500633_0063432 Ga0500633_0063432_201_1220 339
391 3300053161 Ga0500634_0036263 Ga0500634_0036263_1001_2020 339
392 3300053730 Ga0500645_024284 Ga0500645_024284_542_1561 339
393 iso_pu_bacteria 2582581278 2585144161 339
394 iso_pu_bacteria 2585428183 2588212677 339
395 iso_pu_bacteria 2765235839 2765573037 339
396 iso_pu_bacteria 2842722452 2842725758 339
397 iso_pu_bacteria 2929921140 2929922541 339
398 iso_pu_bacteria 2965320100 2965320543 339

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06580

His_kinase

Histidine kinase

209

288

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6swk-assembly1.cif.gz_A-2 the kinase domain of gans, a histidine kinase from geobacillus stearothermophilus 0.6988 161 336
6swj-assembly1.cif.gz_A-2 the kinase domain of gans, a histidine kinase from geobacillus stearothermophilus (with pt) 0.6957 161 336
3jz3-assembly1.cif.gz_A structure of the cytoplasmic segment of histidine kinase qsec 0.6709 205 336
8dwz-assembly1.cif.gz_A ca domain of vansa histidine kinase, 7 kev data 0.6305 207 334
8dwz-assembly1.cif.gz_A ca domain of vansa histidine kinase, 7 kev data 0.6162 207 334
ID Description Score Start End Superfamily
af_P0AA93_414_560_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.7918 208 331 3.30.565.10
af_Q53705_433_584_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.7917 208 339 3.30.565.10
af_P0AD14_423_557_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.7746 208 331 3.30.565.10
af_Q2G1E0_342_515_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.7389 189 336 3.30.565.10
af_P0AD14_423_557_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.7132 208 331 3.30.565.10
ID Description Score Start End GO Terms
AF-A0A6C1QDH2-F1-model_v4 Histidine kinase 0.958 165 333 GO:0000155
GO:0016020
AF-A0A5M4AUS9-F1-model_v4 Signal transduction histidine kinase internal region domain-containing protein 0.9457 229 334
AF-A0A6C1QDH2-F1-model_v4 Histidine kinase 0.9361 165 333 GO:0000155
GO:0016020
AF-A0A520CEG9-F1-model_v4 Histidine kinase 0.9251 164 335 GO:0000155
GO:0016020
AF-A0A644Z6R6-F1-model_v4 Sensor histidine kinase BtsS (EC 2.7.13.3) 0.9166 172 335 GO:0000155
GO:0016020

Feature Viewer

pLDDT pTM Quality
82.85 0.56 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map