F434147

General Info

Members Datasets Scaffolds Average Seq Length
398 283 346 195

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0005323|Ga0495686_0005323_3866_4483
Length 205
Sequence LIHHEKESNMSNTEFIDTIFRNARSQNGWREQPVSDERLKEVYDLMKWGPTSVNCSPARVVFVRSEEGKSKLKSALAPGNVDKSMAAPVVAIVAYDTEFYEKLPQLFPHNPAVKDWFDGEAKAAFAEKTAFRNGTLQGAYLIIAARAAGLDCGPMSGFDNAKLDEAFFAGTSWKSNFICALGHGDPTKVHPRSPRLSFEEACKLA

Samples

Sample ID Description Type Environment
1 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
2 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
3 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
4 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
5 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
6 2643221582 Rhizobium sp. Root651 Isolate Unclassified
7 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
8 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
9 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
10 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
11 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
12 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
13 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
14 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
15 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
16 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
17 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
18 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
19 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
20 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
21 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
22 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
23 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
24 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
25 2847085930 Erwinia persicina B64 Isolate Bulb
26 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
27 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
28 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
29 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
30 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
31 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
32 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
33 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
34 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
35 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
36 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
37 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
38 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
39 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
40 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
41 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
42 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
43 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
44 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
45 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
46 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
47 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
48 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
49 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
50 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
51 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
52 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
53 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
54 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
55 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
56 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
57 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
58 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
59 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
60 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
61 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
62 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
63 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
64 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
65 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
66 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
67 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
68 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
69 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
70 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
71 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
72 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
73 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
74 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
75 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
76 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
77 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
78 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
79 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
80 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
81 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
82 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
83 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
84 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
85 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
86 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
87 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
88 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
89 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
90 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
91 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
92 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
93 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
94 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
96 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
97 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
98 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
99 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
117 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
118 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
119 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
121 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
123 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
167 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
168 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
169 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
170 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
171 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
172 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
173 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
174 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
175 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
176 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
177 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
178 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
179 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
180 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
181 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
182 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
183 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
184 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
185 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
186 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
187 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
188 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
189 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
190 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
191 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
192 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
193 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
194 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
195 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
196 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
197 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
198 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
199 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
200 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
201 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
202 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
203 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
204 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
205 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
206 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
207 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
208 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
209 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
210 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
211 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
212 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
213 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
214 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
215 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
216 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
217 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
218 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
219 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
220 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
221 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
222 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
223 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
224 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
225 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
226 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
227 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
228 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
229 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
230 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
231 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
232 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
233 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
234 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
235 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
236 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
237 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
238 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
239 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
240 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
241 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
242 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
243 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
244 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
245 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
246 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
247 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
248 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
249 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
250 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
251 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
252 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
253 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
254 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
255 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
256 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
257 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
258 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
259 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
260 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
261 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
262 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
263 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
264 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
265 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
266 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
267 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
268 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
269 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
270 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
271 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
272 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
273 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
274 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
275 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
276 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
277 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
278 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
279 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
280 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
281 8033232454 Acinetobacter radioresistens SA188 Isolate Unclassified
282 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
283 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.93
Metatranscriptomes 0
Isolates 13.07

Biome Distribution

Category Percentage (%)
Aerial Root 1.01
Bulb 0.25
Endosphere 10.05
Nodule 7.04
Rhizoplane 1.01
Rhizosphere 69.1
Stem 0
Stem Tuber 0
Unclassified 11.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10096132 3300001990 Bacteria 878
2 JGI24735J21928_10009445 3300002067 Bacteria 3131
3 JGI24735J21928_10012493 3300002067 Bacteria 2684
4 JGI25165J46597_1000124 3300003214 Bacteria 131341
5 Ga0058692_1004974 3300003856 Bacteria 3856
6 Ga0058692_1005282 3300003856 Bacteria 3707
7 Ga0070658_10003660 3300005327 Bacteria 12586
8 Ga0070658_10017856 3300005327 Bacteria 5673
9 Ga0070658_10085059 3300005327 Bacteria 2601
10 Ga0070683_100020697 3300005329 Bacteria 5858
11 Ga0070683_100874138 3300005329 Bacteria 862
12 Ga0070666_10154602 3300005335 Bacteria 1601
13 Ga0070680_100112990 3300005336 Bacteria 2262
14 Ga0068868_100344510 3300005338 Bacteria 1275
15 Ga0070660_100026706 3300005339 Bacteria 4302
16 Ga0070660_100108860 3300005339 Bacteria 2203
17 Ga0070661_100003945 3300005344 Bacteria 10202
18 Ga0070661_100149296 3300005344 Bacteria 1766
19 Ga0070692_10443332 3300005345 Bacteria 829
20 Ga0070674_100057228 3300005356 Bacteria 2706
21 Ga0070659_100004570 3300005366 Bacteria 9895
22 Ga0070667_100013267 3300005367 Bacteria 6807
23 Ga0070709_10136619 3300005434 Bacteria 1680
24 Ga0070709_10286816 3300005434 Bacteria 1198
25 Ga0070714_100002566 3300005435 Bacteria 13379
26 Ga0070714_100010877 3300005435 Bacteria 7207
27 Ga0070713_100000011 3300005436 Bacteria 146314
28 Ga0070705_100059523 3300005440 Bacteria 2262
29 Ga0070663_100002845 3300005455 Bacteria 9837
30 Ga0070663_100038186 3300005455 Bacteria 3348
31 Ga0070663_100513312 3300005455 Bacteria 997
32 Ga0070678_100185751 3300005456 Bacteria 1705
33 Ga0070662_100003998 3300005457 Bacteria 9244
34 Ga0070662_100994815 3300005457 Bacteria 718
35 Ga0070681_10010730 3300005458 Bacteria 9052
36 Ga0068867_100233455 3300005459 Bacteria 1488
37 Ga0070699_100756591 3300005518 Bacteria 889
38 Ga0070679_100063255 3300005530 Bacteria 3689
39 Ga0070684_100158709 3300005535 Bacteria 2051
40 Ga0070697_100161010 3300005536 Bacteria 1896
41 Ga0068853_100002089 3300005539 Bacteria 14817
42 Ga0068853_100009051 3300005539 Bacteria 8017
43 Ga0070672_100033184 3300005543 Bacteria 3907
44 Ga0070695_100054578 3300005545 Bacteria 2572
45 Ga0070665_100001308 3300005548 Bacteria 29745
46 Ga0068855_100004053 3300005563 Bacteria 17877
47 Ga0068855_100020022 3300005563 Bacteria 8034
48 Ga0068855_100114813 3300005563 Bacteria 3087
49 Ga0068855_100125801 3300005563 Bacteria 2931
50 Ga0070664_100001119 3300005564 Bacteria 21198
51 Ga0068857_100000131 3300005577 Bacteria 45365
52 Ga0068857_100002260 3300005577 Bacteria 15661
53 Ga0068854_100411748 3300005578 Bacteria 1121
54 Ga0068856_100001764 3300005614 Bacteria 22636
55 Ga0068856_100021277 3300005614 Bacteria 6301
56 Ga0068856_100050192 3300005614 Bacteria 4112
57 Ga0068852_100002634 3300005616 Bacteria 12393
58 Ga0068851_10370477 3300005834 Bacteria 837
59 Ga0068863_100160920 3300005841 Bacteria 2151
60 Ga0068863_101383041 3300005841 Bacteria 711
61 Ga0068858_100128744 3300005842 Bacteria 2373
62 Ga0068860_100503472 3300005843 Bacteria 1209
63 Ga0075364_10012341 3300006051 Bacteria 5222
64 Ga0070712_100000014 3300006175 Bacteria 108668
65 Ga0075366_10060881 3300006195 Bacteria 2243
66 Ga0097621_100899179 3300006237 Bacteria 825
67 Ga0075370_10039894 3300006353 Bacteria 2647
68 Ga0075370_10050701 3300006353 Bacteria 2354
69 Ga0075436_100000047 3300006914 Bacteria 72907
70 Ga0075435_100357168 3300007076 Bacteria 1253
71 Ga0105244_10009582 3300009036 Bacteria 5938
72 Ga0105244_10027197 3300009036 Bacteria 3085
73 Ga0105250_10005696 3300009092 Bacteria 5561
74 Ga0105240_10000353 3300009093 Bacteria 86068
75 Ga0105240_10000355 3300009093 Bacteria 86025
76 Ga0105240_10000838 3300009093 Bacteria 55365
77 Ga0105240_10006563 3300009093 Bacteria 17085
78 Ga0105240_10043035 3300009093 Bacteria 5750
79 Ga0105241_10006494 3300009174 Bacteria 8621
80 Ga0105248_10322611 3300009177 Bacteria 1739
81 Ga0105237_10006560 3300009545 Bacteria 12870
82 Ga0105237_10095666 3300009545 Bacteria 2960
83 Ga0105238_10001566 3300009551 Bacteria 22947
84 Ga0105238_10001828 3300009551 Bacteria 21327
85 Ga0105239_10004849 3300010375 Bacteria 15916
86 Ga0105239_10042265 3300010375 Bacteria 4995
87 Ga0105239_10723685 3300010375 Bacteria 1138
88 Ga0157373_10003426 3300013100 Bacteria 12004
89 Ga0157370_10000080 3300013104 Bacteria 105872
90 Ga0157370_10005949 3300013104 Bacteria 13583
91 Ga0157370_10006365 3300013104 Bacteria 13033
92 Ga0157369_10014179 3300013105 Bacteria 9005
93 Ga0157369_10014583 3300013105 Bacteria 8867
94 Ga0157369_10017627 3300013105 Bacteria 8027
95 Ga0157369_10947497 3300013105 Bacteria 882
96 Ga0157374_10193933 3300013296 Bacteria 1987
97 Ga0157374_10408964 3300013296 Bacteria 1354
98 Ga0157378_10418225 3300013297 Bacteria 1324
99 Ga0157372_10007021 3300013307 Bacteria 11994
100 Ga0157372_10018126 3300013307 Bacteria 7568
101 Ga0157372_10023649 3300013307 Bacteria 6665
102 Ga0157375_10199938 3300013308 Bacteria 2154
103 Ga0157375_11330502 3300013308 Bacteria 845
104 Ga0163163_10051142 3300014325 Bacteria 4073
105 Ga0157379_10010103 3300014968 Bacteria 8227
106 Ga0157376_10392879 3300014969 Bacteria 1339
107 Ga0213874_10182361 3300021377 Bacteria 747
108 Ga0207427_101436 3300025231 Bacteria 8618
109 Ga0209026_1001068 3300025250 Bacteria 13281
110 Ga0209148_1001541 3300025254 Bacteria 11199
111 Ga0209233_1000189 3300025261 Bacteria 131465
112 Ga0209455_1000971 3300025272 Bacteria 14523
113 Ga0209025_1000255 3300025294 Bacteria 125764
114 Ga0207656_10270553 3300025321 Bacteria 836
115 Ga0207696_1007868 3300025711 Bacteria 4133
116 Ga0207655_1051535 3300025728 Bacteria 1663
117 Ga0207680_10083486 3300025903 Bacteria 2013
118 Ga0207647_10047644 3300025904 Bacteria 2665
119 Ga0207647_10067539 3300025904 Bacteria 2166
120 Ga0207699_10000233 3300025906 Bacteria 31418
121 Ga0207699_10240292 3300025906 Bacteria 1244
122 Ga0207705_10000014 3300025909 Bacteria 434286
123 Ga0207705_10003669 3300025909 Bacteria 11682
124 Ga0207705_10071427 3300025909 Bacteria 2516
125 Ga0207654_10083298 3300025911 Bacteria 1931
126 Ga0207707_10024797 3300025912 Bacteria 5247
127 Ga0207695_10001073 3300025913 Bacteria 47807
128 Ga0207695_10001110 3300025913 Bacteria 46818
129 Ga0207695_10022114 3300025913 Bacteria 7232
130 Ga0207695_10078038 3300025913 Bacteria 3361
131 Ga0207695_10116140 3300025913 Bacteria 2650
132 Ga0207671_10128061 3300025914 Bacteria 1947
133 Ga0207671_10160603 3300025914 Bacteria 1740
134 Ga0207693_10000018 3300025915 Bacteria 138365
135 Ga0207660_10059984 3300025917 Bacteria 2733
136 Ga0207657_10000630 3300025919 Bacteria 37349
137 Ga0207657_10023764 3300025919 Bacteria 5700
138 Ga0207657_10044173 3300025919 Bacteria 3919
139 Ga0207649_10003570 3300025920 Bacteria 8500
140 Ga0207652_10025491 3300025921 Bacteria 4918
141 Ga0207646_10795226 3300025922 Bacteria 843
142 Ga0207694_10001560 3300025924 Bacteria 19448
143 Ga0207694_10027946 3300025924 Bacteria 4299
144 Ga0207694_10046784 3300025924 Bacteria 3345
145 Ga0207700_10000005 3300025928 Bacteria 394836
146 Ga0207700_10042284 3300025928 Bacteria 3340
147 Ga0207664_10016923 3300025929 Bacteria 5332
148 Ga0207664_10122190 3300025929 Bacteria 2181
149 Ga0207664_10319909 3300025929 Bacteria 1369
150 Ga0207690_10009473 3300025932 Bacteria 5784
151 Ga0207690_10087860 3300025932 Bacteria 2188
152 Ga0207706_10028563 3300025933 Bacteria 4981
153 Ga0207669_10033448 3300025937 Bacteria 2902
154 Ga0207691_10040952 3300025940 Bacteria 4279
155 Ga0207661_10039548 3300025944 Bacteria 3702
156 Ga0207679_10006603 3300025945 Bacteria 7336
157 Ga0207667_10008594 3300025949 Bacteria 12119
158 Ga0207667_10023649 3300025949 Bacteria 6763
159 Ga0207667_10060708 3300025949 Bacteria 3957
160 Ga0207667_10110605 3300025949 Bacteria 2834
161 Ga0207640_10150016 3300025981 Bacteria 1711
162 Ga0207658_10098949 3300025986 Bacteria 2280
163 Ga0207677_10500190 3300026023 Bacteria 1051
164 Ga0207639_10007140 3300026041 Bacteria 7609
165 Ga0207639_10021357 3300026041 Bacteria 4649
166 Ga0207678_10001721 3300026067 Bacteria 20039
167 Ga0207678_10054504 3300026067 Bacteria 3444
168 Ga0207678_10380719 3300026067 Bacteria 1220
169 Ga0207702_10000680 3300026078 Bacteria 36910
170 Ga0207702_10001063 3300026078 Bacteria 28134
171 Ga0207702_10009734 3300026078 Bacteria 8071
172 Ga0207702_10009967 3300026078 Bacteria 7966
173 Ga0207641_10165228 3300026088 Bacteria 2015
174 Ga0207648_10022805 3300026089 Bacteria 5617
175 Ga0207674_10000112 3300026116 Bacteria 94220
176 Ga0207674_10001449 3300026116 Bacteria 30652
177 Ga0207683_10134271 3300026121 Bacteria 2227
178 Ga0207698_10019977 3300026142 Bacteria 4600
179 Ga0209371_1002941 3300027312 Bacteria 8883
180 Ga0209371_1003350 3300027312 Bacteria 7871
181 Ga0209998_10011461 3300027717 Bacteria 1835
182 Ga0209974_10017028 3300027876 Bacteria 2411
183 Ga0268266_10724064 3300028379 Bacteria 959
184 Ga0268264_10451817 3300028381 Bacteria 1245
185 Ga0307515_10109202 3300028794 Bacteria 3251
186 Ga0265338_10003597 3300028800 Bacteria 21634
187 Ga0265338_10253910 3300028800 Bacteria 1296
188 Ga0268256_1002891 3300030500 Bacteria 8238
189 Ga0268256_1017420 3300030500 Bacteria 2022
190 Ga0268256_1019969 3300030500 Bacteria 1819
191 Ga0268256_1057323 3300030500 Bacteria 794
192 Ga0316181_1065167 3300030744 Bacteria 2065
193 Ga0265325_10086611 3300031241 Bacteria 1550
194 Ga0265331_10053864 3300031250 Bacteria 1917
195 Ga0265327_10094284 3300031251 Bacteria 1455
196 Ga0307513_10010987 3300031456 Bacteria 11297
197 Ga0307513_10016486 3300031456 Bacteria 8906
198 Ga0307513_10195431 3300031456 Bacteria 1870
199 Ga0265313_10037970 3300031595 Bacteria 2403
200 Ga0265314_10064744 3300031711 Bacteria 2473
201 Ga0265314_10176973 3300031711 Bacteria 1282
202 Ga0307412_10529097 3300031911 Bacteria 986
203 Ga0373939_0036332 3300035114 Bacteria 1457
204 Ga0373927_0345266 3300035695 Bacteria 981
205 Ga0395899_0001244 3300037312 Bacteria 22134
206 Ga0395900_0140199 3300037418 Bacteria 2476
207 Ga0395900_0158879 3300037418 Bacteria 2307
208 Ga0395900_0690275 3300037418 Bacteria 955
209 Ga0395905_0466308 3300037471 Bacteria 1162
210 Ga0395905_0617057 3300037471 Bacteria 986
211 Ga0400483_161840 3300039062 Bacteria 3358
212 Ga0436363_1512733 3300039450 Bacteria 771
213 Ga0439438_004107 3300041405 Bacteria 5685
214 Ga0439447_006056 3300041407 Bacteria 3966
215 Ga0451851_1360998 3300041507 Bacteria 1022
216 Ga0439448_0003958 3300042005 Bacteria 4158
217 Ga0439448_0006212 3300042005 Bacteria 3428
218 Ga0439452_002044 3300042010 Bacteria 7681
219 Ga0439455_0017464 3300042012 Bacteria 1672
220 Ga0451577_0551069 3300042876 Bacteria 1047
221 Ga0451576_0672177 3300045051 Bacteria 1088
222 Ga0495590_0148477 3300046457 Bacteria 849
223 Ga0495591_001159 3300046458 Bacteria 17260
224 Ga0495651_0043401 3300046462 Bacteria 3489
225 Ga0495650_0000032 3300046471 Bacteria 425389
226 Ga0495650_0020093 3300046471 Bacteria 3266
227 Ga0495580_0052032 3300046472 Bacteria 2894
228 Ga0495605_0056275 3300046474 Bacteria 1897
229 Ga0495584_0006356 3300046491 Bacteria 6189
230 Ga0495607_0044030 3300046501 Bacteria 2634
231 Ga0495606_0000483 3300046507 Bacteria 65224
232 Ga0495606_0264078 3300046507 Bacteria 949
233 Ga0495610_0010684 3300046512 Bacteria 5683
234 Ga0495610_0048247 3300046512 Bacteria 2091
235 Ga0495616_0021460 3300046513 Bacteria 3498
236 Ga0495628_0515012 3300046516 Bacteria 862
237 Ga0495643_0023425 3300046522 Bacteria 3511
238 Ga0495644_0009273 3300046523 Bacteria 3792
239 Ga0495642_0102971 3300046528 Bacteria 1216
240 Ga0495654_0000052 3300046530 Bacteria 145382
241 Ga0495654_0110821 3300046530 Bacteria 1252
242 Ga0495587_0087998 3300046536 Bacteria 1797
243 Ga0495609_0018155 3300046538 Bacteria 3262
244 Ga0495597_0000352 3300046542 Bacteria 41199
245 Ga0495622_0007281 3300046557 Bacteria 5137
246 Ga0495668_0015415 3300046616 Bacteria 4464
247 Ga0495611_0233503 3300046648 Bacteria 854
248 Ga0495625_0137871 3300046660 Bacteria 1648
249 Ga0495625_0154917 3300046660 Bacteria 1538
250 Ga0495599_0002656 3300046678 Bacteria 10426
251 Ga0495623_0002133 3300046679 Bacteria 13213
252 Ga0495623_0211815 3300046679 Bacteria 1109
253 Ga0495658_0003755 3300046683 Bacteria 7515
254 Ga0495671_0008541 3300046692 Bacteria 5755
255 Ga0495649_0033619 3300046694 Bacteria 2822
256 Ga0495589_0116561 3300046794 Bacteria 1287
257 Ga0495660_0000021 3300046810 Bacteria 293250
258 Ga0495660_0037100 3300046810 Bacteria 2716
259 Ga0495604_0003722 3300047317 Bacteria 12154
260 Ga0495674_0054773 3300047319 Bacteria 3500
261 Ga0495674_0330087 3300047319 Bacteria 1241
262 Ga0495672_0000002 3300047320 Bacteria 740116
263 Ga0495672_0003774 3300047320 Bacteria 12768
264 Ga0495676_0173649 3300047321 Bacteria 1515
265 Ga0495680_0010183 3300047322 Bacteria 8400
266 Ga0495683_0068165 3300047323 Bacteria 1750
267 Ga0495683_0207924 3300047323 Bacteria 879
268 Ga0495687_000017 3300047443 Bacteria 350429
269 Ga0495675_0006613 3300047444 Bacteria 7097
270 Ga0495675_0175806 3300047444 Bacteria 1313
271 Ga0495679_000020 3300047446 Bacteria 228413
272 Ga0495673_0000095 3300047469 Bacteria 183429
273 Ga0495681_0000688 3300047470 Bacteria 25777
274 Ga0495681_0025691 3300047470 Bacteria 3077
275 Ga0495686_0005323 3300047472 Bacteria 10194
276 Ga0495602_0023892 3300048088 Bacteria 5943
277 Ga0495602_0026620 3300048088 Bacteria 5575
278 Ga0496108_0972609 3300048911 Bacteria 726
279 Ga0496116_0013166 3300048919 Bacteria 6692
280 Ga0496116_0097637 3300048919 Bacteria 1765
281 Ga0496117_0028588 3300048920 Bacteria 4315
282 Ga0496118_0109923 3300048921 Bacteria 1833
283 Ga0496119_0000080 3300048922 Bacteria 139962
284 Ga0496119_0010211 3300048922 Bacteria 7923
285 Ga0496119_0036997 3300048922 Bacteria 3177
286 Ga0496119_0101303 3300048922 Bacteria 1617
287 Ga0496120_0000075 3300048923 Bacteria 163540
288 Ga0496120_0003436 3300048923 Bacteria 14444
289 Ga0496120_0033835 3300048923 Bacteria 3067
290 Ga0496120_0140271 3300048923 Bacteria 1228
291 Ga0496121_0000143 3300048924 Bacteria 159577
292 Ga0496121_0000710 3300048924 Bacteria 61765
293 Ga0496121_0244110 3300048924 Bacteria 1249
294 Ga0496122_0096628 3300048925 Bacteria 1991
295 Ga0496124_0000397 3300048927 Bacteria 79293
296 Ga0496124_0056079 3300048927 Bacteria 3325
297 Ga0496124_0125294 3300048927 Bacteria 2047
298 Ga0496124_0312865 3300048927 Bacteria 1128
299 Ga0496124_0346986 3300048927 Bacteria 1051
300 Ga0496124_0357019 3300048927 Bacteria 1031
301 Ga0496125_0004938 3300048928 Bacteria 15090
302 Ga0496125_0013012 3300048928 Bacteria 8213
303 Ga0496126_0140114 3300048929 Bacteria 2083
304 Ga0496126_0241314 3300048929 Bacteria 1509
305 Ga0495678_000326 3300049459 Bacteria 50497
306 Ga0495682_0000015 3300049460 Bacteria 235048
307 Ga0501069_0145601 3300049585 Bacteria 1360
308 Ga0501070_0040580 3300049586 Bacteria 3881
309 Ga0501073_0699739 3300049589 Bacteria 699
310 Ga0501080_0535627 3300049742 Bacteria 1044
311 Ga0501083_0012716 3300049744 Bacteria 5888
312 nmdc:mga00v17_10053_c1 3300050491 Bacteria 5152
313 nmdc:mga00v17_1012_c1 3300050491 Bacteria 15037
314 nmdc:mga00v17_526802_c1 3300050491 Bacteria 765
315 nmdc:mga0k408_219757_c1 3300050493 Bacteria 1134
316 nmdc:mga0rr50_95294_c1 3300050513 Bacteria 2326
317 nmdc:mga08x19_11335_c1 3300050514 Bacteria 5365
318 nmdc:mga08x19_62_c1 3300050514 Bacteria 114601
319 nmdc:mga0sz30_23852_c1 3300050516 Bacteria 2493
320 Ga0500635_0178239 3300053080 Bacteria 820
321 Ga0500578_0014194 3300053086 Bacteria 5124
322 Ga0500643_033177 3300053087 Bacteria 1562
323 Ga0500641_0001936 3300053096 Bacteria 7343
324 Ga0500556_0030618 3300053104 Bacteria 1824
325 Ga0500560_001783 3300053107 Bacteria 3876
326 Ga0500560_060194 3300053107 Bacteria 1236
327 Ga0500562_006671 3300053108 Bacteria 2909
328 Ga0500569_043175 3300053109 Bacteria 1330
329 Ga0500572_003354 3300053111 Bacteria 3679
330 Ga0500621_000001 3300053126 Bacteria 1049698
331 Ga0500573_0002805 3300053140 Bacteria 8833
332 Ga0500573_0009196 3300053140 Bacteria 5473
333 Ga0500577_0027899 3300053142 Bacteria 1939
334 Ga0500604_0020511 3300053151 Bacteria 1861
335 Ga0500616_0004694 3300053153 Bacteria 9622
336 Ga0500616_0006278 3300053153 Bacteria 7818
337 Ga0500616_0012283 3300053153 Bacteria 5014
338 Ga0500622_0226914 3300053156 Bacteria 834
339 Ga0500634_0070795 3300053161 Bacteria 1825
340 Ga0500639_095619 3300053163 Bacteria 1472
341 Ga0500636_0000009 3300053177 Bacteria 155504
342 Ga0500636_0000962 3300053177 Bacteria 15499
343 Ga0500637_0007241 3300053178 Bacteria 5535
344 Ga0500645_001141 3300053730 Bacteria 14389
345 Ga0501084_0131592 3300054114 Bacteria 2106
346 Ga0501082_0045233 3300060353 Bacteria 3796

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053080 Ga0500635_0178239 Ga0500635_0178239_333_803 154
2 3300045051 Ga0451576_0672177 Ga0451576_0672177_42_554 169
3 iso_pu_bacteria 2876377896 2876384104 185
4 iso_pu_bacteria 2889010040 2889013330 185
5 iso_pu_bacteria 2906354277 2906360587 185
6 iso_pu_bacteria 2922185730 2922188900 185
7 iso_pu_bacteria 2938014810 2938021314 185
8 3300048922 Ga0496119_0101303 Ga0496119_0101303_183_752 189
9 3300048923 Ga0496120_0003436 Ga0496120_0003436_6313_6882 189
10 iso_pu_bacteria 2513237166 2514053890 189
11 iso_pu_bacteria 2885270888 2885278823 189
12 iso_pu_bacteria 8054460903 8054464891 190
13 3300028794 Ga0307515_10109202 Ga0307515_101092022 191
14 3300031456 Ga0307513_10016486 Ga0307513_100164863 191
15 3300031911 Ga0307412_10529097 Ga0307412_105290972 191
16 3300046471 Ga0495650_0020093 Ga0495650_0020093_1049_1624 191
17 3300031456 Ga0307513_10195431 Ga0307513_101954312 192
18 3300035114 Ga0373939_0036332 Ga0373939_0036332_793_1377 192
19 3300035695 Ga0373927_0345266 Ga0373927_0345266_245_829 192
20 3300046457 Ga0495590_0148477 Ga0495590_0148477_65_649 192
21 3300046528 Ga0495642_0102971 Ga0495642_0102971_335_919 192
22 3300046530 Ga0495654_0110821 Ga0495654_0110821_419_997 192
23 3300046557 Ga0495622_0007281 Ga0495622_0007281_4147_4731 192
24 3300046648 Ga0495611_0233503 Ga0495611_0233503_197_781 192
25 3300046683 Ga0495658_0003755 Ga0495658_0003755_2998_3582 192
26 3300046694 Ga0495649_0033619 Ga0495649_0033619_1429_2013 192
27 3300046794 Ga0495589_0116561 Ga0495589_0116561_385_969 192
28 3300047320 Ga0495672_0003774 Ga0495672_0003774_10237_10821 192
29 3300047446 Ga0495679_000020 Ga0495679_000020_98454_99032 192
30 3300053178 Ga0500637_0007241 Ga0500637_0007241_390_974 192
31 iso_pu_bacteria 2537561587 2537877146 192
32 iso_pu_bacteria 2599185210 2599602050 192
33 iso_pu_bacteria 2600255279 2601609699 192
34 iso_pu_bacteria 2600255308 2601746474 192
35 iso_pu_bacteria 2643221582 2643919955 192
36 iso_pu_bacteria 2791354903 2791925039 192
37 iso_pu_bacteria 2818991439 2819559444 192
38 iso_pu_bacteria 2838675328 2838675379 192
39 iso_pu_bacteria 2838714209 2838714260 192
40 iso_pu_bacteria 2838719591 2838721938 192
41 iso_pu_bacteria 2838724970 2838725021 192
42 iso_pu_bacteria 2841846520 2841848917 192
43 iso_pu_bacteria 2841859092 2841862586 192
44 iso_pu_bacteria 2842124991 2842125052 192
45 iso_pu_bacteria 2842130223 2842130274 192
46 iso_pu_bacteria 2842152218 2842154556 192
47 iso_pu_bacteria 2842170452 2842170503 192
48 iso_pu_bacteria 2842175837 2842178176 192
49 iso_pu_bacteria 2842187318 2842187369 192
50 iso_pu_bacteria 2842211629 2842211680 192
51 iso_pu_bacteria 2842224351 2842226700 192
52 iso_pu_bacteria 2842515876 2842519370 192
53 iso_pu_bacteria 2842775625 2842779154 192
54 iso_pu_bacteria 2847085930 2847088176 192
55 iso_pu_bacteria 2899792073 2899795731 192
56 iso_pu_bacteria 2919114240 2919114291 192
57 iso_pu_bacteria 2926754445 2926755311 192
58 iso_pu_bacteria 2929138655 2929141619 192
59 iso_pu_bacteria 2933006813 2933009201 192
60 iso_pu_bacteria 2933011516 2933014459 192
61 iso_pu_bacteria 2933594066 2933596209 192
62 iso_pu_bacteria 2979100975 2979104295 192
63 iso_pu_bacteria 2984509177 2984511125 192
64 iso_pu_bacteria 2984518228 2984522513 192
65 iso_pu_bacteria 2984537506 2984541817 192
66 iso_pu_bacteria 2984601300 2984604172 192
67 iso_pu_bacteria 651053060 651177568 192
68 iso_pu_bacteria 8054844752 8054844771 192
69 3300005335 Ga0070666_10154602 Ga0070666_101546022 193
70 3300005338 Ga0068868_100344510 Ga0068868_1003445101 193
71 3300005356 Ga0070674_100057228 Ga0070674_1000572282 193
72 3300005367 Ga0070667_100013267 Ga0070667_1000132675 193
73 3300005456 Ga0070678_100185751 Ga0070678_1001857512 193
74 3300005459 Ga0068867_100233455 Ga0068867_1002334552 193
75 3300005543 Ga0070672_100033184 Ga0070672_1000331841 193
76 3300005548 Ga0070665_100001308 Ga0070665_10000130815 193
77 3300005841 Ga0068863_101383041 Ga0068863_1013830412 193
78 3300005843 Ga0068860_100503472 Ga0068860_1005034722 193
79 3300009177 Ga0105248_10322611 Ga0105248_103226111 193
80 3300013296 Ga0157374_10408964 Ga0157374_104089641 193
81 3300013308 Ga0157375_10199938 Ga0157375_101999382 193
82 3300014969 Ga0157376_10392879 Ga0157376_103928792 193
83 3300025903 Ga0207680_10083486 Ga0207680_100834862 193
84 3300025937 Ga0207669_10033448 Ga0207669_100334482 193
85 3300025940 Ga0207691_10040952 Ga0207691_100409524 193
86 3300025986 Ga0207658_10098949 Ga0207658_100989492 193
87 3300026023 Ga0207677_10500190 Ga0207677_105001901 193
88 3300026089 Ga0207648_10022805 Ga0207648_100228052 193
89 3300026121 Ga0207683_10134271 Ga0207683_101342712 193
90 3300028379 Ga0268266_10724064 Ga0268266_107240641 193
91 3300028381 Ga0268264_10451817 Ga0268264_104518171 193
92 3300031456 Ga0307513_10010987 Ga0307513_100109872 193
93 3300037471 Ga0395905_0617057 Ga0395905_0617057_166_843 193
94 3300046462 Ga0495651_0043401 Ga0495651_0043401_1433_2023 193
95 3300046472 Ga0495580_0052032 Ga0495580_0052032_638_1228 193
96 3300046516 Ga0495628_0515012 Ga0495628_0515012_258_848 193
97 3300046678 Ga0495599_0002656 Ga0495599_0002656_8099_8689 193
98 3300046679 Ga0495623_0002133 Ga0495623_0002133_7100_7690 193
99 3300047317 Ga0495604_0003722 Ga0495604_0003722_2772_3362 193
100 3300047319 Ga0495674_0054773 Ga0495674_0054773_1797_2387 193
101 3300047319 Ga0495674_0330087 Ga0495674_0330087_104_694 193
102 3300047321 Ga0495676_0173649 Ga0495676_0173649_366_956 193
103 3300047322 Ga0495680_0010183 Ga0495680_0010183_3602_4192 193
104 3300047443 Ga0495687_000017 Ga0495687_000017_218248_218838 193
105 3300047444 Ga0495675_0006613 Ga0495675_0006613_1541_2131 193
106 3300048088 Ga0495602_0023892 Ga0495602_0023892_2941_3531 193
107 3300048927 Ga0496124_0056079 Ga0496124_0056079_1008_1589 193
108 3300048927 Ga0496124_0312865 Ga0496124_0312865_284_865 193
109 3300048929 Ga0496126_0140114 Ga0496126_0140114_186_767 193
110 3300053142 Ga0500577_0027899 Ga0500577_0027899_759_1352 193
111 3300005327 Ga0070658_10085059 Ga0070658_100850593 194
112 3300005329 Ga0070683_100020697 Ga0070683_1000206973 194
113 3300005336 Ga0070680_100112990 Ga0070680_1001129902 194
114 3300005339 Ga0070660_100108860 Ga0070660_1001088603 194
115 3300005344 Ga0070661_100003945 Ga0070661_1000039458 194
116 3300005366 Ga0070659_100004570 Ga0070659_10000457011 194
117 3300005434 Ga0070709_10286816 Ga0070709_102868162 194
118 3300005435 Ga0070714_100002566 Ga0070714_10000256612 194
119 3300005435 Ga0070714_100010877 Ga0070714_1000108777 194
120 3300005455 Ga0070663_100513312 Ga0070663_1005133121 194
121 3300005458 Ga0070681_10010730 Ga0070681_100107303 194
122 3300005530 Ga0070679_100063255 Ga0070679_1000632553 194
123 3300005539 Ga0068853_100009051 Ga0068853_1000090513 194
124 3300005563 Ga0068855_100004053 Ga0068855_1000040535 194
125 3300005564 Ga0070664_100001119 Ga0070664_1000011193 194
126 3300005577 Ga0068857_100002260 Ga0068857_1000022603 194
127 3300005614 Ga0068856_100021277 Ga0068856_1000212772 194
128 3300005616 Ga0068852_100002634 Ga0068852_1000026348 194
129 3300005834 Ga0068851_10370477 Ga0068851_103704771 194
130 3300006353 Ga0075370_10039894 Ga0075370_100398944 194
131 3300009093 Ga0105240_10006563 Ga0105240_1000656318 194
132 3300009545 Ga0105237_10095666 Ga0105237_100956663 194
133 3300009551 Ga0105238_10001828 Ga0105238_1000182815 194
134 3300013104 Ga0157370_10006365 Ga0157370_100063655 194
135 3300013105 Ga0157369_10017627 Ga0157369_100176273 194
136 3300013296 Ga0157374_10193933 Ga0157374_101939333 194
137 3300013307 Ga0157372_10007021 Ga0157372_1000702111 194
138 3300021377 Ga0213874_10182361 Ga0213874_101823611 194
139 3300025321 Ga0207656_10270553 Ga0207656_102705531 194
140 3300025906 Ga0207699_10240292 Ga0207699_102402922 194
141 3300025909 Ga0207705_10071427 Ga0207705_100714272 194
142 3300025912 Ga0207707_10024797 Ga0207707_100247976 194
143 3300025913 Ga0207695_10022114 Ga0207695_100221143 194
144 3300025914 Ga0207671_10128061 Ga0207671_101280612 194
145 3300025917 Ga0207660_10059984 Ga0207660_100599843 194
146 3300025919 Ga0207657_10023764 Ga0207657_100237643 194
147 3300025920 Ga0207649_10003570 Ga0207649_100035706 194
148 3300025921 Ga0207652_10025491 Ga0207652_100254914 194
149 3300025924 Ga0207694_10001560 Ga0207694_100015608 194
150 3300025928 Ga0207700_10042284 Ga0207700_100422843 194
151 3300025929 Ga0207664_10016923 Ga0207664_100169235 194
152 3300025929 Ga0207664_10319909 Ga0207664_103199092 194
153 3300025932 Ga0207690_10009473 Ga0207690_100094732 194
154 3300025944 Ga0207661_10039548 Ga0207661_100395483 194
155 3300025945 Ga0207679_10006603 Ga0207679_100066033 194
156 3300025949 Ga0207667_10008594 Ga0207667_100085947 194
157 3300025981 Ga0207640_10150016 Ga0207640_101500162 194
158 3300026041 Ga0207639_10007140 Ga0207639_100071403 194
159 3300026067 Ga0207678_10380719 Ga0207678_103807192 194
160 3300026078 Ga0207702_10009734 Ga0207702_100097349 194
161 3300026116 Ga0207674_10001449 Ga0207674_1000144910 194
162 3300026142 Ga0207698_10019977 Ga0207698_100199774 194
163 3300039450 Ga0436363_1512733 Ga0436363_1512733_149_736 194
164 3300046507 Ga0495606_0264078 Ga0495606_0264078_224_814 194
165 3300046512 Ga0495610_0048247 Ga0495610_0048247_387_977 194
166 3300046660 Ga0495625_0137871 Ga0495625_0137871_809_1399 194
167 3300048911 Ga0496108_0972609 Ga0496108_0972609_75_659 194
168 3300048925 Ga0496122_0096628 Ga0496122_0096628_217_801 194
169 3300053087 Ga0500643_033177 Ga0500643_033177_947_1537 194
170 3300053104 Ga0500556_0030618 Ga0500556_0030618_530_1120 194
171 3300053108 Ga0500562_006671 Ga0500562_006671_1842_2432 194
172 3300053111 Ga0500572_003354 Ga0500572_003354_2271_2855 194
173 3300053153 Ga0500616_0012283 Ga0500616_0012283_2074_2664 194
174 3300053177 Ga0500636_0000009 Ga0500636_0000009_36907_37491 194
175 3300053177 Ga0500636_0000962 Ga0500636_0000962_10727_11311 194
176 3300053730 Ga0500645_001141 Ga0500645_001141_4481_5071 194
177 3300005345 Ga0070692_10443332 Ga0070692_104433322 195
178 3300005434 Ga0070709_10136619 Ga0070709_101366192 195
179 3300005436 Ga0070713_100000011 Ga0070713_10000001156 195
180 3300005440 Ga0070705_100059523 Ga0070705_1000595233 195
181 3300005455 Ga0070663_100002845 Ga0070663_1000028451 195
182 3300005518 Ga0070699_100756591 Ga0070699_1007565912 195
183 3300005535 Ga0070684_100158709 Ga0070684_1001587093 195
184 3300005536 Ga0070697_100161010 Ga0070697_1001610102 195
185 3300005539 Ga0068853_100002089 Ga0068853_10000208910 195
186 3300005545 Ga0070695_100054578 Ga0070695_1000545781 195
187 3300005563 Ga0068855_100020022 Ga0068855_1000200222 195
188 3300005563 Ga0068855_100114813 Ga0068855_1001148133 195
189 3300005577 Ga0068857_100000131 Ga0068857_10000013145 195
190 3300005578 Ga0068854_100411748 Ga0068854_1004117482 195
191 3300005614 Ga0068856_100001764 Ga0068856_10000176410 195
192 3300005841 Ga0068863_100160920 Ga0068863_1001609203 195
193 3300005842 Ga0068858_100128744 Ga0068858_1001287442 195
194 3300006175 Ga0070712_100000014 Ga0070712_100000014107 195
195 3300006237 Ga0097621_100899179 Ga0097621_1008991792 195
196 3300006914 Ga0075436_100000047 Ga0075436_10000004722 195
197 3300007076 Ga0075435_100357168 Ga0075435_1003571682 195
198 3300009093 Ga0105240_10000353 Ga0105240_1000035342 195
199 3300009093 Ga0105240_10000355 Ga0105240_1000035514 195
200 3300009093 Ga0105240_10000838 Ga0105240_1000083826 195
201 3300009174 Ga0105241_10006494 Ga0105241_100064949 195
202 3300009545 Ga0105237_10006560 Ga0105237_100065608 195
203 3300009551 Ga0105238_10001566 Ga0105238_1000156619 195
204 3300010375 Ga0105239_10004849 Ga0105239_1000484915 195
205 3300013100 Ga0157373_10003426 Ga0157373_1000342615 195
206 3300013104 Ga0157370_10005949 Ga0157370_100059492 195
207 3300013105 Ga0157369_10014583 Ga0157369_100145837 195
208 3300013297 Ga0157378_10418225 Ga0157378_104182252 195
209 3300013307 Ga0157372_10018126 Ga0157372_100181266 195
210 3300014325 Ga0163163_10051142 Ga0163163_100511424 195
211 3300014968 Ga0157379_10010103 Ga0157379_100101036 195
212 3300025906 Ga0207699_10000233 Ga0207699_1000023329 195
213 3300025911 Ga0207654_10083298 Ga0207654_100832982 195
214 3300025913 Ga0207695_10001073 Ga0207695_1000107344 195
215 3300025913 Ga0207695_10001110 Ga0207695_1000111018 195
216 3300025913 Ga0207695_10078038 Ga0207695_100780385 195
217 3300025915 Ga0207693_10000018 Ga0207693_1000001860 195
218 3300025922 Ga0207646_10795226 Ga0207646_107952261 195
219 3300025924 Ga0207694_10027946 Ga0207694_100279466 195
220 3300025928 Ga0207700_10000005 Ga0207700_1000000521 195
221 3300025929 Ga0207664_10122190 Ga0207664_101221902 195
222 3300025949 Ga0207667_10023649 Ga0207667_100236496 195
223 3300025949 Ga0207667_10060708 Ga0207667_100607085 195
224 3300026041 Ga0207639_10021357 Ga0207639_100213573 195
225 3300026067 Ga0207678_10001721 Ga0207678_1000172110 195
226 3300026078 Ga0207702_10000680 Ga0207702_1000068021 195
227 3300026078 Ga0207702_10001063 Ga0207702_100010639 195
228 3300026088 Ga0207641_10165228 Ga0207641_101652283 195
229 3300026116 Ga0207674_10000112 Ga0207674_1000011264 195
230 3300027717 Ga0209998_10011461 Ga0209998_100114613 195
231 3300027876 Ga0209974_10017028 Ga0209974_100170282 195
232 3300028800 Ga0265338_10003597 Ga0265338_1000359717 195
233 3300028800 Ga0265338_10253910 Ga0265338_102539102 195
234 3300031241 Ga0265325_10086611 Ga0265325_100866113 195
235 3300031250 Ga0265331_10053864 Ga0265331_100538643 195
236 3300031251 Ga0265327_10094284 Ga0265327_100942842 195
237 3300031595 Ga0265313_10037970 Ga0265313_100379703 195
238 3300031711 Ga0265314_10064744 Ga0265314_100647443 195
239 3300031711 Ga0265314_10176973 Ga0265314_101769732 195
240 3300046512 Ga0495610_0010684 Ga0495610_0010684_2735_3322 195
241 3300046522 Ga0495643_0023425 Ga0495643_0023425_984_1571 195
242 3300046660 Ga0495625_0154917 Ga0495625_0154917_65_652 195
243 3300046810 Ga0495660_0037100 Ga0495660_0037100_1154_1741 195
244 3300047323 Ga0495683_0207924 Ga0495683_0207924_212_799 195
245 3300050513 nmdc:mga0rr50_95294_c1 nmdc:mga0rr50_95294_c1_1491_2084 195
246 3300050514 nmdc:mga08x19_11335_c1 nmdc:mga08x19_11335_c1_2645_3238 195
247 3300050514 nmdc:mga08x19_62_c1 nmdc:mga08x19_62_c1_96449_97042 195
248 3300053086 Ga0500578_0014194 Ga0500578_0014194_2194_2781 195
249 3300053096 Ga0500641_0001936 Ga0500641_0001936_312_920 195
250 3300053109 Ga0500569_043175 Ga0500569_043175_594_1181 195
251 3300053153 Ga0500616_0004694 Ga0500616_0004694_6763_7350 195
252 3300053156 Ga0500622_0226914 Ga0500622_0226914_22_609 195
253 iso_pu_bacteria 2856314179 2856318181 195
254 iso_pu_bacteria 2906414383 2906418218 195
255 iso_pu_bacteria 2961170736 2961175834 195
256 iso_pu_bacteria 2970503327 2970508499 195
257 iso_pu_bacteria 2979808191 2979811852 195
258 iso_pu_bacteria 8033232454 8033234545 195
259 3300001990 JGI24737J22298_10096132 JGI24737J22298_100961322 196
260 3300002067 JGI24735J21928_10009445 JGI24735J21928_100094453 196
261 3300002067 JGI24735J21928_10012493 JGI24735J21928_100124932 196
262 3300003214 JGI25165J46597_1000124 JGI25165J46597_100012498 196
263 3300003856 Ga0058692_1004974 Ga0058692_10049743 196
264 3300003856 Ga0058692_1005282 Ga0058692_10052823 196
265 3300005327 Ga0070658_10003660 Ga0070658_100036608 196
266 3300005327 Ga0070658_10017856 Ga0070658_100178566 196
267 3300005329 Ga0070683_100874138 Ga0070683_1008741381 196
268 3300005339 Ga0070660_100026706 Ga0070660_1000267064 196
269 3300005344 Ga0070661_100149296 Ga0070661_1001492962 196
270 3300005455 Ga0070663_100038186 Ga0070663_1000381866 196
271 3300005457 Ga0070662_100003998 Ga0070662_1000039983 196
272 3300005457 Ga0070662_100994815 Ga0070662_1009948151 196
273 3300005563 Ga0068855_100125801 Ga0068855_1001258012 196
274 3300005614 Ga0068856_100050192 Ga0068856_1000501922 196
275 3300006051 Ga0075364_10012341 Ga0075364_100123415 196
276 3300006195 Ga0075366_10060881 Ga0075366_100608811 196
277 3300006353 Ga0075370_10050701 Ga0075370_100507013 196
278 3300009036 Ga0105244_10009582 Ga0105244_100095826 196
279 3300009036 Ga0105244_10027197 Ga0105244_100271972 196
280 3300009092 Ga0105250_10005696 Ga0105250_100056962 196
281 3300009093 Ga0105240_10043035 Ga0105240_100430355 196
282 3300010375 Ga0105239_10042265 Ga0105239_100422653 196
283 3300010375 Ga0105239_10723685 Ga0105239_107236852 196
284 3300013104 Ga0157370_10000080 Ga0157370_1000008097 196
285 3300013105 Ga0157369_10014179 Ga0157369_100141798 196
286 3300013105 Ga0157369_10947497 Ga0157369_109474972 196
287 3300013307 Ga0157372_10023649 Ga0157372_100236494 196
288 3300013308 Ga0157375_11330502 Ga0157375_113305022 196
289 3300025231 Ga0207427_101436 Ga0207427_1014368 196
290 3300025250 Ga0209026_1001068 Ga0209026_100106810 196
291 3300025254 Ga0209148_1001541 Ga0209148_10015416 196
292 3300025261 Ga0209233_1000189 Ga0209233_100018932 196
293 3300025272 Ga0209455_1000971 Ga0209455_10009719 196
294 3300025294 Ga0209025_1000255 Ga0209025_1000255120 196
295 3300025711 Ga0207696_1007868 Ga0207696_10078683 196
296 3300025728 Ga0207655_1051535 Ga0207655_10515352 196
297 3300025904 Ga0207647_10047644 Ga0207647_100476441 196
298 3300025904 Ga0207647_10067539 Ga0207647_100675394 196
299 3300025909 Ga0207705_10000014 Ga0207705_10000014228 196
300 3300025909 Ga0207705_10003669 Ga0207705_100036697 196
301 3300025913 Ga0207695_10116140 Ga0207695_101161402 196
302 3300025914 Ga0207671_10160603 Ga0207671_101606033 196
303 3300025919 Ga0207657_10000630 Ga0207657_100006309 196
304 3300025919 Ga0207657_10044173 Ga0207657_100441732 196
305 3300025924 Ga0207694_10046784 Ga0207694_100467845 196
306 3300025932 Ga0207690_10087860 Ga0207690_100878604 196
307 3300025933 Ga0207706_10028563 Ga0207706_100285633 196
308 3300025949 Ga0207667_10110605 Ga0207667_101106055 196
309 3300026067 Ga0207678_10054504 Ga0207678_100545042 196
310 3300026078 Ga0207702_10009967 Ga0207702_100099675 196
311 3300027312 Ga0209371_1002941 Ga0209371_10029417 196
312 3300027312 Ga0209371_1003350 Ga0209371_10033505 196
313 3300030500 Ga0268256_1002891 Ga0268256_10028911 196
314 3300030500 Ga0268256_1017420 Ga0268256_10174203 196
315 3300030500 Ga0268256_1019969 Ga0268256_10199692 196
316 3300030500 Ga0268256_1057323 Ga0268256_10573232 196
317 3300030744 Ga0316181_1065167 Ga0316181_10651672 196
318 3300037312 Ga0395899_0001244 Ga0395899_0001244_20955_21545 196
319 3300037418 Ga0395900_0140199 Ga0395900_0140199_585_1175 196
320 3300037418 Ga0395900_0158879 Ga0395900_0158879_574_1164 196
321 3300037418 Ga0395900_0690275 Ga0395900_0690275_316_906 196
322 3300037471 Ga0395905_0466308 Ga0395905_0466308_173_763 196
323 3300039062 Ga0400483_161840 Ga0400483_161840_926_1522 196
324 3300041405 Ga0439438_004107 Ga0439438_004107_1544_2134 196
325 3300041407 Ga0439447_006056 Ga0439447_006056_963_1553 196
326 3300041507 Ga0451851_1360998 Ga0451851_1360998_29_619 196
327 3300042005 Ga0439448_0003958 Ga0439448_0003958_3307_3897 196
328 3300042005 Ga0439448_0006212 Ga0439448_0006212_2113_2703 196
329 3300042010 Ga0439452_002044 Ga0439452_002044_6457_7047 196
330 3300042012 Ga0439455_0017464 Ga0439455_0017464_35_625 196
331 3300042876 Ga0451577_0551069 Ga0451577_0551069_444_1034 196
332 3300046458 Ga0495591_001159 Ga0495591_001159_7375_7965 196
333 3300046471 Ga0495650_0000032 Ga0495650_0000032_192098_192688 196
334 3300046474 Ga0495605_0056275 Ga0495605_0056275_658_1248 196
335 3300046491 Ga0495584_0006356 Ga0495584_0006356_3046_3636 196
336 3300046501 Ga0495607_0044030 Ga0495607_0044030_1998_2588 196
337 3300046507 Ga0495606_0000483 Ga0495606_0000483_1172_1762 196
338 3300046513 Ga0495616_0021460 Ga0495616_0021460_1977_2567 196
339 3300046523 Ga0495644_0009273 Ga0495644_0009273_510_1100 196
340 3300046530 Ga0495654_0000052 Ga0495654_0000052_15546_16136 196
341 3300046536 Ga0495587_0087998 Ga0495587_0087998_899_1495 196
342 3300046538 Ga0495609_0018155 Ga0495609_0018155_2643_3239 196
343 3300046542 Ga0495597_0000352 Ga0495597_0000352_27015_27605 196
344 3300046616 Ga0495668_0015415 Ga0495668_0015415_220_810 196
345 3300046679 Ga0495623_0211815 Ga0495623_0211815_236_832 196
346 3300046692 Ga0495671_0008541 Ga0495671_0008541_4832_5422 196
347 3300046810 Ga0495660_0000021 Ga0495660_0000021_42817_43407 196
348 3300047320 Ga0495672_0000002 Ga0495672_0000002_155755_156345 196
349 3300047323 Ga0495683_0068165 Ga0495683_0068165_1007_1597 196
350 3300047444 Ga0495675_0175806 Ga0495675_0175806_280_876 196
351 3300047469 Ga0495673_0000095 Ga0495673_0000095_168854_169444 196
352 3300047470 Ga0495681_0000688 Ga0495681_0000688_21133_21741 196
353 3300047470 Ga0495681_0025691 Ga0495681_0025691_2045_2635 196
354 3300047472 Ga0495686_0005323 Ga0495686_0005323_3866_4483 196
355 3300048088 Ga0495602_0026620 Ga0495602_0026620_449_1045 196
356 3300048919 Ga0496116_0013166 Ga0496116_0013166_738_1328 196
357 3300048919 Ga0496116_0097637 Ga0496116_0097637_458_1048 196
358 3300048920 Ga0496117_0028588 Ga0496117_0028588_2954_3544 196
359 3300048921 Ga0496118_0109923 Ga0496118_0109923_1164_1754 196
360 3300048922 Ga0496119_0000080 Ga0496119_0000080_92715_93305 196
361 3300048922 Ga0496119_0010211 Ga0496119_0010211_1065_1655 196
362 3300048922 Ga0496119_0036997 Ga0496119_0036997_2567_3157 196
363 3300048923 Ga0496120_0000075 Ga0496120_0000075_70211_70801 196
364 3300048923 Ga0496120_0033835 Ga0496120_0033835_1152_1742 196
365 3300048923 Ga0496120_0140271 Ga0496120_0140271_64_654 196
366 3300048924 Ga0496121_0000143 Ga0496121_0000143_67421_68011 196
367 3300048924 Ga0496121_0000710 Ga0496121_0000710_51154_51750 196
368 3300048924 Ga0496121_0244110 Ga0496121_0244110_479_1069 196
369 3300048927 Ga0496124_0000397 Ga0496124_0000397_71898_72488 196
370 3300048927 Ga0496124_0125294 Ga0496124_0125294_1307_1897 196
371 3300048927 Ga0496124_0346986 Ga0496124_0346986_414_1004 196
372 3300048927 Ga0496124_0357019 Ga0496124_0357019_394_984 196
373 3300048928 Ga0496125_0004938 Ga0496125_0004938_8943_9533 196
374 3300048928 Ga0496125_0013012 Ga0496125_0013012_6608_7198 196
375 3300048929 Ga0496126_0241314 Ga0496126_0241314_394_984 196
376 3300049459 Ga0495678_000326 Ga0495678_000326_10460_11050 196
377 3300049460 Ga0495682_0000015 Ga0495682_0000015_82076_82666 196
378 3300049585 Ga0501069_0145601 Ga0501069_0145601_551_1153 196
379 3300049586 Ga0501070_0040580 Ga0501070_0040580_2857_3459 196
380 3300049589 Ga0501073_0699739 Ga0501073_0699739_27_629 196
381 3300049742 Ga0501080_0535627 Ga0501080_0535627_415_1017 196
382 3300049744 Ga0501083_0012716 Ga0501083_0012716_611_1213 196
383 3300050491 nmdc:mga00v17_10053_c1 nmdc:mga00v17_10053_c1_2268_2858 196
384 3300050491 nmdc:mga00v17_1012_c1 nmdc:mga00v17_1012_c1_8295_8891 196
385 3300050491 nmdc:mga00v17_526802_c1 nmdc:mga00v17_526802_c1_23_613 196
386 3300050493 nmdc:mga0k408_219757_c1 nmdc:mga0k408_219757_c1_290_880 196
387 3300050516 nmdc:mga0sz30_23852_c1 nmdc:mga0sz30_23852_c1_1733_2323 196
388 3300053107 Ga0500560_001783 Ga0500560_001783_1348_1956 196
389 3300053107 Ga0500560_060194 Ga0500560_060194_489_1097 196
390 3300053126 Ga0500621_000001 Ga0500621_000001_791371_791961 196
391 3300053140 Ga0500573_0002805 Ga0500573_0002805_2690_3280 196
392 3300053140 Ga0500573_0009196 Ga0500573_0009196_3415_4005 196
393 3300053151 Ga0500604_0020511 Ga0500604_0020511_289_879 196
394 3300053153 Ga0500616_0006278 Ga0500616_0006278_6941_7531 196
395 3300053161 Ga0500634_0070795 Ga0500634_0070795_895_1503 196
396 3300053163 Ga0500639_095619 Ga0500639_095619_514_1137 196
397 3300054114 Ga0501084_0131592 Ga0501084_0131592_846_1448 196
398 3300060353 Ga0501082_0045233 Ga0501082_0045233_2551_3153 196

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00881

Nitroreductase

Nitroreductase family

21

183

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
7vqk-assembly1.cif.gz_B catalytic manifolds of a fmn-dependent oxidoreductase rube7, expanding the functional diversity of the flavoenzyme superfamily 0.9547 3 195
3bem-assembly1.cif.gz_A crystal structure of putative nitroreductase ydfn (2632848) from bacillus subtilis at 1.65 a resolution 0.9021 6 195
3bem-assembly1.cif.gz_A crystal structure of putative nitroreductase ydfn (2632848) from bacillus subtilis at 1.65 a resolution 0.876 6 195
3ge5-assembly1.cif.gz_B crystal structure of a putative nad(p)h:fmn oxidoreductase (pg0310) from porphyromonas gingivalis w83 at 1.70 a resolution 0.8496 4 194
3ge6-assembly1.cif.gz_B crystal structure of a putative nitroreductase in complex with fmn (exig_2970) from exiguobacterium sibiricum 255-15 at 1.85 a resolution 0.8492 3 195
ID Description Score Start End Superfamily
af_P75894_8_194_3.40.109.10 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.9752 9 193 3.40.109.10
af_P75894_8_194_3.40.109.10 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.9599 9 193 3.40.109.10
3eofA00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8474 11 193 3.40.109.10
3bemA00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8433 8 194 3.40.109.10
3ge5B00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8389 4 194 3.40.109.10
ID Description Score Start End GO Terms
AF-A0A357L4Q7-F1-model_v4 Malonic semialdehyde reductase 0.9785 4 133 GO:0016491
AF-A0A2V9PCW3-F1-model_v4 Malonic semialdehyde reductase 0.9785 56 195 GO:0016491
AF-W1XBJ0-F1-model_v4 Putative malonic semialdehyde reductase RutE 0.9784 25 166 GO:0016491
AF-A0A3S4H715-F1-model_v4 Multifunctional fusion protein [Includes: Putative carbamate hydrolase RutD (EC 3.5.1.-) (Aminohydrolase); Probable malonic semialdehyde reductase RutE (EC 1.1.1.298)] 0.9776 1 195 GO:0006212
GO:0016746
GO:0016811
GO:0019740
GO:0035527
AF-A0A5M6IKL2-F1-model_v4 Putative NADH dehydrogenase/NAD(P)H nitroreductase F1189_27230 (EC 1.-.-.-) 0.9775 3 195 GO:0016491

Feature Viewer

pLDDT pTM Quality
95.9 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map