F433989

General Info

Members Datasets Scaffolds Average Seq Length
398 175 796 264

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100211603|Ga0070708_1002116032
Length 293
Sequence MSRVRLLFSEAWSSIRMNLSTTFAATMTVLIGMCLLGLFIALGTWVLSWSNHVQKELQVHVYFCTTAVTTADCSADPTKAQVLAVGKALRNTEHVQKVTFVPKAKAWAQQKKENPGGFPQGTYDLVGPLGNPLPDAYVVTPTEGQYTAVIGKEICHAKYGGVEPCATATTGGLGNAGGVKWESNVTKRVLTIFARRREIEVMKLVGATNWFIRGPFMLEGLLCGLVGAFLAVILLLLGKTIALPSILPHIGGGTGSSDVHALSFTLNAFALLAAGLLLGALGSGLTLRRFLQV

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
25 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
26 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
27 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
30 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
34 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
35 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
41 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
42 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
48 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
67 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
68 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
69 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
70 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
71 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
72 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
73 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
74 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
75 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
76 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
77 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
78 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
79 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
80 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
81 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
82 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
83 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
84 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
85 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
86 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
87 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
88 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
89 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
90 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
91 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
93 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
94 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
95 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
96 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
97 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
98 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
99 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
100 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
101 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
102 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
103 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
104 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
105 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
106 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
107 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
108 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
109 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
110 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
111 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
112 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
113 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
114 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
115 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
116 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
117 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
118 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
119 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
120 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
121 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
122 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
123 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
124 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
125 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
126 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
127 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
128 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
129 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
130 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
131 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
132 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
133 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
134 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
135 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
136 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
137 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
138 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
139 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
140 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
141 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
142 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
143 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
144 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
145 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
146 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
147 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
148 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
149 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
150 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
151 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
152 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
153 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
154 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
155 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
156 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
157 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
158 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
159 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
160 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
163 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
164 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
165 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
166 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
167 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
168 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
169 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
170 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
171 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
172 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
173 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
174 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
175 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.98
Metatranscriptomes 3.02
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.5
Nodule 0
Rhizoplane 3.77
Rhizosphere 95.73
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100211603 3300005445 Bacteria 1817
2 Ga0070658_10055731 3300005327 Bacteria 3211
3 Ga0070683_100005231 3300005329 Bacteria 10800
4 Ga0070683_100127379 3300005329 Bacteria 2407
5 Ga0070680_100140705 3300005336 Bacteria 2023
6 Ga0070680_100185278 3300005336 Bacteria 1753
7 Ga0070680_100207477 3300005336 Bacteria 1653
8 Ga0070682_100014383 3300005337 Bacteria 4572
9 Ga0070682_100227432 3300005337 Bacteria 1332
10 Ga0070660_100002874 3300005339 Bacteria 11862
11 Ga0070660_100044707 3300005339 Bacteria 3388
12 Ga0070660_100071210 3300005339 Bacteria 2714
13 Ga0070660_100071259 3300005339 Bacteria 2713
14 Ga0070660_100084004 3300005339 Bacteria 2502
15 Ga0070660_100170963 3300005339 Bacteria 1755
16 Ga0070671_100337235 3300005355 Bacteria 1286
17 Ga0070659_100088180 3300005366 Bacteria 2484
18 Ga0070714_100019455 3300005435 Bacteria 5533
19 Ga0070714_100046137 3300005435 Bacteria 3695
20 Ga0070714_100130667 3300005435 Bacteria 2244
21 Ga0070714_100159389 3300005435 Bacteria 2040
22 Ga0070714_100194371 3300005435 Bacteria 1853
23 Ga0070714_100213029 3300005435 Bacteria 1771
24 Ga0070711_100403705 3300005439 Bacteria 1110
25 Ga0070663_100162219 3300005455 Bacteria 1721
26 Ga0070681_10010625 3300005458 Bacteria 9099
27 Ga0070681_10013721 3300005458 Bacteria 8066
28 Ga0070681_10081148 3300005458 Bacteria 3199
29 Ga0070681_10096553 3300005458 Bacteria 2903
30 Ga0070681_10108705 3300005458 Bacteria 2713
31 Ga0070681_10163848 3300005458 Bacteria 2147
32 Ga0070681_10341774 3300005458 Bacteria 1407
33 Ga0070681_10516296 3300005458 Bacteria 1108
34 Ga0070707_100002419 3300005468 Bacteria 17795
35 Ga0070707_100568596 3300005468 Bacteria 1096
36 Ga0070698_100178919 3300005471 Bacteria 2059
37 Ga0070679_100032733 3300005530 Bacteria 5145
38 Ga0070679_100033291 3300005530 Bacteria 5103
39 Ga0070679_100110033 3300005530 Bacteria 2741
40 Ga0070679_100159884 3300005530 Bacteria 2227
41 Ga0070679_100256111 3300005530 Bacteria 1705
42 Ga0070679_100314113 3300005530 Bacteria 1517
43 Ga0070679_100337392 3300005530 Bacteria 1455
44 Ga0070684_100223146 3300005535 Bacteria 1719
45 Ga0070684_100288809 3300005535 Bacteria 1503
46 Ga0070684_100392205 3300005535 Bacteria 1280
47 Ga0068853_100209636 3300005539 Bacteria 1776
48 Ga0068853_100219333 3300005539 Bacteria 1737
49 Ga0070695_100000691 3300005545 Bacteria 18047
50 Ga0070665_100017879 3300005548 Bacteria 7118
51 Ga0068855_100043529 3300005563 Bacteria 5318
52 Ga0068855_100085922 3300005563 Bacteria 3639
53 Ga0068855_100117526 3300005563 Bacteria 3046
54 Ga0068855_100147076 3300005563 Bacteria 2681
55 Ga0068855_100293682 3300005563 Bacteria 1801
56 Ga0068855_100776654 3300005563 Bacteria 1020
57 Ga0068856_100050001 3300005614 Bacteria 4120
58 Ga0068856_100124033 3300005614 Bacteria 2585
59 Ga0068852_100084527 3300005616 Bacteria 2825
60 Ga0068852_100179206 3300005616 Bacteria 1991
61 Ga0068852_100538658 3300005616 Bacteria 1167
62 Ga0070717_10011023 3300006028 Bacteria 6846
63 Ga0070717_10286580 3300006028 Bacteria 1462
64 Ga0075433_10482716 3300006852 Bacteria 1092
65 Ga0075434_100063251 3300006871 Bacteria 3683
66 Ga0075436_100292673 3300006914 Viruses 1166
67 Ga0075435_100110813 3300007076 Bacteria 2283
68 Ga0105240_10099696 3300009093 Bacteria 3535
69 Ga0105240_10183091 3300009093 Bacteria 2471
70 Ga0105240_10311037 3300009093 Bacteria 1799
71 Ga0105240_10408591 3300009093 Bacteria 1528
72 Ga0105240_10758547 3300009093 Bacteria 1054
73 Ga0105241_10348179 3300009174 Bacteria 1286
74 Ga0105237_10046549 3300009545 Bacteria 4363
75 Ga0105237_10122877 3300009545 Bacteria 2590
76 Ga0105237_10148537 3300009545 Bacteria 2339
77 Ga0105237_10647102 3300009545 Bacteria 1064
78 Ga0105238_10081390 3300009551 Bacteria 3228
79 Ga0105238_10344477 3300009551 Bacteria 1479
80 Ga0105239_10297924 3300010375 Bacteria 1816
81 Ga0105239_10478293 3300010375 Bacteria 1415
82 Ga0105246_10146455 3300011119 Bacteria 1783
83 Ga0157373_10071996 3300013100 Bacteria 2440
84 Ga0157371_10181234 3300013102 Bacteria 1506
85 Ga0157371_10232351 3300013102 Bacteria 1326
86 Ga0157370_10057333 3300013104 Bacteria 3704
87 Ga0157370_10069784 3300013104 Bacteria 3318
88 Ga0157370_10209273 3300013104 Bacteria 1808
89 Ga0157369_10042770 3300013105 Bacteria 4942
90 Ga0157369_10056857 3300013105 Bacteria 4221
91 Ga0157369_10114592 3300013105 Bacteria 2863
92 Ga0157369_10618237 3300013105 Bacteria 1118
93 Ga0157374_10088772 3300013296 Bacteria 2945
94 Ga0157372_10042313 3300013307 Bacteria 5038
95 Ga0157372_10130806 3300013307 Bacteria 2888
96 Ga0157372_10440493 3300013307 Bacteria 1519
97 Ga0157372_10504514 3300013307 Bacteria 1411
98 Ga0182008_10083208 3300014497 Bacteria 1575
99 Ga0157376_10203487 3300014969 Bacteria 1823
100 Ga0197907_10700966 3300020069 Bacteria 1315
101 Ga0206356_10589173 3300020070 Bacteria 3247
102 Ga0206356_11447407 3300020070 Bacteria 2003
103 Ga0206352_10306049 3300020078 Bacteria 1196
104 Ga0206354_11100769 3300020081 Bacteria 4073
105 Ga0206353_11695820 3300020082 Bacteria 1257
106 Ga0206353_11820485 3300020082 Bacteria 3205
107 Ga0206353_12018606 3300020082 Bacteria 3564
108 Ga0154015_1326565 3300020610 Bacteria 1899
109 Ga0224712_10009509 3300022467 Bacteria 2933
110 Ga0224712_10083843 3300022467 Bacteria 1321
111 Ga0224712_10097985 3300022467 Bacteria 1239
112 Ga0207705_10019196 3300025909 Bacteria 4889
113 Ga0207705_10032110 3300025909 Bacteria 3751
114 Ga0207705_10044950 3300025909 Bacteria 3174
115 Ga0207705_10191704 3300025909 Bacteria 1546
116 Ga0207654_10213970 3300025911 Bacteria 1275
117 Ga0207707_10023261 3300025912 Bacteria 5421
118 Ga0207707_10078282 3300025912 Bacteria 2887
119 Ga0207707_10124891 3300025912 Bacteria 2251
120 Ga0207707_10150780 3300025912 Bacteria 2033
121 Ga0207707_10261280 3300025912 Bacteria 1502
122 Ga0207707_10265475 3300025912 Bacteria 1488
123 Ga0207707_10273397 3300025912 Bacteria 1464
124 Ga0207695_10326443 3300025913 Bacteria 1424
125 Ga0207671_10055517 3300025914 Bacteria 2934
126 Ga0207671_10353390 3300025914 Bacteria 1166
127 Ga0207660_10112356 3300025917 Bacteria 2052
128 Ga0207660_10166719 3300025917 Bacteria 1703
129 Ga0207660_10356247 3300025917 Bacteria 1173
130 Ga0207657_10000286 3300025919 Bacteria 53863
131 Ga0207657_10004630 3300025919 Bacteria 14532
132 Ga0207657_10009122 3300025919 Bacteria 10008
133 Ga0207657_10011291 3300025919 Bacteria 8871
134 Ga0207657_10044779 3300025919 Bacteria 3888
135 Ga0207657_10240010 3300025919 Bacteria 1447
136 Ga0207657_10314450 3300025919 Bacteria 1239
137 Ga0207649_10045073 3300025920 Bacteria 2702
138 Ga0207652_10006261 3300025921 Bacteria 9605
139 Ga0207652_10054864 3300025921 Bacteria 3427
140 Ga0207652_10170550 3300025921 Bacteria 1952
141 Ga0207652_10453710 3300025921 Bacteria 1155
142 Ga0207646_10000648 3300025922 Bacteria 45068
143 Ga0207646_10102402 3300025922 Bacteria 2567
144 Ga0207664_10032851 3300025929 Bacteria 3981
145 Ga0207664_10054734 3300025929 Bacteria 3163
146 Ga0207664_10065990 3300025929 Bacteria 2900
147 Ga0207664_10116469 3300025929 Bacteria 2229
148 Ga0207664_10178574 3300025929 Bacteria 1822
149 Ga0207664_10199995 3300025929 Bacteria 1724
150 Ga0207690_10209329 3300025932 Bacteria 1486
151 Ga0207690_10268825 3300025932 Bacteria 1324
152 Ga0207690_10276143 3300025932 Bacteria 1307
153 Ga0207661_10012316 3300025944 Bacteria 6213
154 Ga0207667_10047802 3300025949 Bacteria 4527
155 Ga0207667_10062242 3300025949 Bacteria 3903
156 Ga0207667_10232536 3300025949 Bacteria 1887
157 Ga0207702_10162640 3300026078 Bacteria 2040
158 Ga0207702_10260170 3300026078 Bacteria 1633
159 Ga0207702_10308003 3300026078 Bacteria 1505
160 Ga0207674_10094124 3300026116 Bacteria 2983
161 Ga0207698_10091741 3300026142 Bacteria 2488
162 Ga0207698_10320751 3300026142 Bacteria 1451
163 Ga0207428_10110782 3300027907 Bacteria 2113
164 Ga0265326_10010165 3300028558 Bacteria 2797
165 Ga0265319_1003094 3300028563 Bacteria 8791
166 Ga0265334_10051253 3300028573 Bacteria 1582
167 Ga0265318_10000299 3300028577 Bacteria 40341
168 Ga0265336_10002636 3300028666 Bacteria 7287
169 Ga0265338_10006281 3300028800 Bacteria 15192
170 Ga0265338_10011084 3300028800 Bacteria 10457
171 Ga0265338_10013886 3300028800 Bacteria 9040
172 Ga0265330_10004771 3300031235 Bacteria 6847
173 Ga0265332_10023266 3300031238 Bacteria 2732
174 Ga0265328_10004618 3300031239 Bacteria 5962
175 Ga0265320_10017880 3300031240 Bacteria 3919
176 Ga0265325_10002129 3300031241 Bacteria 13512
177 Ga0265329_10019333 3300031242 Bacteria 2314
178 Ga0265331_10004413 3300031250 Bacteria 8794
179 Ga0265327_10041849 3300031251 Bacteria 2464
180 Ga0265327_10067487 3300031251 Bacteria 1801
181 Ga0265316_10013380 3300031344 Bacteria 7293
182 Ga0265313_10006943 3300031595 Bacteria 7862
183 Ga0265314_10023905 3300031711 Bacteria 4645
184 Ga0265342_10055057 3300031712 Bacteria 2362
185 Ga0316583_10019054 3300032133 Bacteria 2465
186 Ga0316583_10021740 3300032133 Bacteria 2300
187 Ga0373926_0012103 3300035083 Bacteria 2914
188 Ga0373935_0009941 3300035692 Bacteria 5703
189 Ga0373933_0169945 3300035724 Bacteria 1387
190 Ga0373933_0330592 3300035724 Bacteria 989
191 Ga0373947_0004995 3300035725 Bacteria 7764
192 Ga0373937_0000997 3300036401 Bacteria 23984
193 Ga0373937_0123761 3300036401 Bacteria 2411
194 Ga0373925_0021341 3300037068 Bacteria 4717
195 Ga0395899_0009111 3300037312 Bacteria 7624
196 Ga0395899_0293255 3300037312 Bacteria 1103
197 Ga0395900_0019138 3300037418 Bacteria 6983
198 Ga0395900_0022240 3300037418 Bacteria 6487
199 Ga0395900_0049680 3300037418 Bacteria 4321
200 Ga0395900_0081763 3300037418 Bacteria 3318
201 Ga0395898_0018707 3300037466 Bacteria 7062
202 Ga0395898_0094285 3300037466 Bacteria 2876
203 Ga0395898_0114088 3300037466 Bacteria 2589
204 Ga0395898_0127736 3300037466 Bacteria 2435
205 Ga0395905_0010080 3300037471 Bacteria 9210
206 Ga0395905_0216970 3300037471 Bacteria 1791
207 Ga0395905_0269564 3300037471 Bacteria 1588
208 Ga0395905_0369752 3300037471 Bacteria 1327
209 Ga0395901_0007682 3300038443 Bacteria 10877
210 Ga0395901_0014107 3300038443 Bacteria 8134
211 Ga0395901_0042869 3300038443 Bacteria 4693
212 Ga0395901_0114607 3300038443 Bacteria 2831
213 Ga0395901_0245770 3300038443 Bacteria 1865
214 Ga0436360_0673449 3300039438 Bacteria 3524
215 Ga0466969_0005559 3300044656 Bacteria 6703
216 Ga0466969_0096510 3300044656 Bacteria 1395
217 Ga0466972_0053438 3300044658 Bacteria 1945
218 Ga0466965_0189472 3300044683 Bacteria 1087
219 Ga0466966_0028650 3300044684 Bacteria 3625
220 Ga0466966_0078239 3300044684 Bacteria 2062
221 Ga0466966_0169100 3300044684 Bacteria 1329
222 Ga0466961_0001920 3300044693 Bacteria 12947
223 Ga0466961_0023904 3300044693 Bacteria 3932
224 Ga0466961_0031074 3300044693 Bacteria 3433
225 Ga0466961_0043547 3300044693 Bacteria 2875
226 Ga0466961_0130785 3300044693 Bacteria 1573
227 Ga0466963_0000661 3300044694 Bacteria 16639
228 Ga0466963_0002598 3300044694 Bacteria 10133
229 Ga0466963_0002622 3300044694 Bacteria 10097
230 Ga0466963_0004591 3300044694 Bacteria 8039
231 Ga0466963_0019894 3300044694 Bacteria 4217
232 Ga0466963_0037756 3300044694 Bacteria 3156
233 Ga0466963_0041976 3300044694 Bacteria 3001
234 Ga0466963_0082415 3300044694 Bacteria 2180
235 Ga0466963_0112935 3300044694 Bacteria 1865
236 Ga0466963_0268119 3300044694 Bacteria 1199
237 Ga0466963_0318086 3300044694 Bacteria 1095
238 Ga0466963_0393291 3300044694 Bacteria 977
239 Ga0466964_0013688 3300044706 Bacteria 3079
240 Ga0466964_0016618 3300044706 Bacteria 2811
241 Ga0466964_0062934 3300044706 Bacteria 1548
242 Ga0466964_0094787 3300044706 Bacteria 1305
243 Ga0466964_0132045 3300044706 Bacteria 1138
244 Ga0466971_0003326 3300044719 Bacteria 6864
245 Ga0466971_0008849 3300044719 Bacteria 4396
246 Ga0466971_0019131 3300044719 Bacteria 3040
247 Ga0466971_0054061 3300044719 Bacteria 1809
248 Ga0466968_0012102 3300044735 Bacteria 3370
249 Ga0466968_0041519 3300044735 Bacteria 1942
250 Ga0466968_0091656 3300044735 Bacteria 1347
251 Ga0466970_0065165 3300044765 Bacteria 1954
252 Ga0466970_0077496 3300044765 Bacteria 1792
253 Ga0466957_0007808 3300044842 Bacteria 6060
254 Ga0466957_0016310 3300044842 Bacteria 4344
255 Ga0466957_0026935 3300044842 Bacteria 3413
256 Ga0466957_0029628 3300044842 Bacteria 3265
257 Ga0466957_0052377 3300044842 Bacteria 2485
258 Ga0466960_0090830 3300044901 Bacteria 1556
259 Ga0466960_0183949 3300044901 Bacteria 1134
260 Ga0466959_0001055 3300045049 Bacteria 16508
261 Ga0466959_0003521 3300045049 Bacteria 10278
262 Ga0466959_0027976 3300045049 Bacteria 4180
263 Ga0466959_0042816 3300045049 Bacteria 3340
264 Ga0466959_0129926 3300045049 Bacteria 1785
265 Ga0466958_0001804 3300045836 Bacteria 10395
266 Ga0466958_0004248 3300045836 Bacteria 7532
267 Ga0466958_0014594 3300045836 Bacteria 4484
268 Ga0466958_0111802 3300045836 Bacteria 1705
269 Ga0466958_0122280 3300045836 Bacteria 1630
270 Ga0466958_0198683 3300045836 Bacteria 1276
271 Ga0466967_0003466 3300045976 Bacteria 10297
272 Ga0466967_0009594 3300045976 Bacteria 7193
273 Ga0466967_0016384 3300045976 Bacteria 5843
274 Ga0466967_0017841 3300045976 Bacteria 5652
275 Ga0466967_0026085 3300045976 Bacteria 4833
276 Ga0466967_0043054 3300045976 Bacteria 3907
277 Ga0466967_0046460 3300045976 Bacteria 3780
278 Ga0466967_0054817 3300045976 Bacteria 3511
279 Ga0466967_0158201 3300045976 Bacteria 2124
280 Ga0466967_0271987 3300045976 Bacteria 1623
281 Ga0466967_0272846 3300045976 Bacteria 1621
282 Ga0466967_0296196 3300045976 Bacteria 1555
283 Ga0466967_0360017 3300045976 Bacteria 1409
284 Ga0466967_0456946 3300045976 Bacteria 1249
285 Ga0466967_0508796 3300045976 Bacteria 1182
286 Ga0466967_0588386 3300045976 Bacteria 1097
287 Ga0466967_0635599 3300045976 Bacteria 1055
288 Ga0495592_0000691 3300046454 Bacteria 23491
289 Ga0495592_0061660 3300046454 Bacteria 2755
290 Ga0495603_0043086 3300046455 Bacteria 2696
291 Ga0495629_0072166 3300046459 Bacteria 2409
292 Ga0495629_0282006 3300046459 Bacteria 1140
293 Ga0495641_0074682 3300046461 Bacteria 1520
294 Ga0495651_0000180 3300046462 Bacteria 46908
295 Ga0495651_0021173 3300046462 Bacteria 5051
296 Ga0495651_0034200 3300046462 Bacteria 3962
297 Ga0495651_0046918 3300046462 Bacteria 3342
298 Ga0495653_0030958 3300046463 Bacteria 4257
299 Ga0495653_0058340 3300046463 Bacteria 2934
300 Ga0495653_0112637 3300046463 Bacteria 1952
301 Ga0495580_0032041 3300046472 Bacteria 3795
302 Ga0495639_0035189 3300046475 Bacteria 2240
303 Ga0495664_0012645 3300046477 Bacteria 4781
304 Ga0495664_0118700 3300046477 Bacteria 1599
305 Ga0495608_0010438 3300046511 Bacteria 6482
306 Ga0495608_0013154 3300046511 Bacteria 5743
307 Ga0495618_0018563 3300046514 Bacteria 4270
308 Ga0495618_0106942 3300046514 Bacteria 1791
309 Ga0495628_0000067 3300046516 Bacteria 85377
310 Ga0495628_0019818 3300046516 Bacteria 5556
311 Ga0495628_0228560 3300046516 Bacteria 1395
312 Ga0495630_0002340 3300046517 Bacteria 13170
313 Ga0495666_0000995 3300046526 Bacteria 13428
314 Ga0495652_0000315 3300046529 Bacteria 57240
315 Ga0495652_0016816 3300046529 Bacteria 6537
316 Ga0495652_0034383 3300046529 Bacteria 4417
317 Ga0495665_0074188 3300046531 Bacteria 1791
318 Ga0495587_0000302 3300046536 Bacteria 35079
319 Ga0495587_0014755 3300046536 Bacteria 4893
320 Ga0495645_0008828 3300046543 Bacteria 7039
321 Ga0495645_0073744 3300046543 Bacteria 2458
322 Ga0495645_0308313 3300046543 Bacteria 1032
323 Ga0495667_0087903 3300046559 Bacteria 2015
324 Ga0495667_0112181 3300046559 Bacteria 1762
325 Ga0495667_0163284 3300046559 Bacteria 1432
326 Ga0495656_0003607 3300046615 Bacteria 5244
327 Ga0495634_0025811 3300046642 Bacteria 4104
328 Ga0495635_0013240 3300046663 Bacteria 5773
329 Ga0495635_0019029 3300046663 Bacteria 4793
330 Ga0495635_0123543 3300046663 Bacteria 1765
331 Ga0495661_0159537 3300046665 Bacteria 1212
332 Ga0495657_0004413 3300046675 Bacteria 11227
333 Ga0495657_0067853 3300046675 Bacteria 2339
334 Ga0495599_0000274 3300046678 Bacteria 31892
335 Ga0495599_0018784 3300046678 Bacteria 4309
336 Ga0495599_0148809 3300046678 Bacteria 1451
337 Ga0495623_0000144 3300046679 Bacteria 43790
338 Ga0495623_0163448 3300046679 Bacteria 1306
339 Ga0495646_0014831 3300046680 Bacteria 4951
340 Ga0495646_0115986 3300046680 Bacteria 1520
341 Ga0495647_0008852 3300046681 Bacteria 3391
342 Ga0495658_0081517 3300046683 Bacteria 1900
343 Ga0495613_0003479 3300046689 Bacteria 11778
344 Ga0495624_0008107 3300046690 Bacteria 7352
345 Ga0495624_0118130 3300046690 Bacteria 1629
346 Ga0495600_0154558 3300046809 Bacteria 1484
347 Ga0495600_0181237 3300046809 Bacteria 1357
348 Ga0495600_0225660 3300046809 Bacteria 1197
349 Ga0495581_0045488 3300047315 Bacteria 2537
350 Ga0495581_0250902 3300047315 Bacteria 1035
351 Ga0495604_0000076 3300047317 Bacteria 85332
352 Ga0495674_0076548 3300047319 Bacteria 2877
353 Ga0495674_0099162 3300047319 Bacteria 2480
354 Ga0495676_0132588 3300047321 Bacteria 1796
355 Ga0495680_0013134 3300047322 Bacteria 7237
356 Ga0495680_0023305 3300047322 Bacteria 5149
357 Ga0495680_0068141 3300047322 Bacteria 2719
358 Ga0495680_0190681 3300047322 Bacteria 1475
359 Ga0495680_0205788 3300047322 Bacteria 1410
360 Ga0495675_0000170 3300047444 Bacteria 46990
361 Ga0495684_0157542 3300047471 Bacteria 1695
362 Ga0495593_0002986 3300047673 Bacteria 10185
363 Ga0495602_0000247 3300048088 Bacteria 50489
364 Ga0495602_0038704 3300048088 Bacteria 4404
365 Ga0495614_0000768 3300048089 Bacteria 13586
366 Ga0496101_0247840 3300048904 Bacteria 1387
367 Ga0496102_0070869 3300048905 Bacteria 3201
368 Ga0496103_0141992 3300048906 Bacteria 1536
369 Ga0496107_0018844 3300048910 Bacteria 4865
370 Ga0496107_0168398 3300048910 Bacteria 1625
371 Ga0496108_0149761 3300048911 Bacteria 2013
372 Ga0496108_0262042 3300048911 Bacteria 1504
373 Ga0496109_0208766 3300048912 Bacteria 1836
374 Ga0496109_0466268 3300048912 Bacteria 1193
375 Ga0496112_0044610 3300048915 Bacteria 4345
376 Ga0496112_0116533 3300048915 Bacteria 2642
377 Ga0496112_0180306 3300048915 Bacteria 2076
378 Ga0496112_0350591 3300048915 Bacteria 1418
379 Ga0496113_0045672 3300048916 Bacteria 3250
380 Ga0496113_0226288 3300048916 Bacteria 1491
381 Ga0501067_0000348 3300049583 Bacteria 25209
382 Ga0501069_0024940 3300049585 Bacteria 3265
383 nmdc:mga08y16_317834_c1 3300050511 Bacteria 1603
384 nmdc:mga0n895_187441_c1 3300050512 Bacteria 2100
385 nmdc:mga0rr50_133846_c1 3300050513 Bacteria 1988
386 Ga0495601_0000119 3300053077 Bacteria 43595
387 Ga0495601_0161048 3300053077 Bacteria 1466
388 Ga0495612_0002013 3300053078 Bacteria 8373
389 Ga0495612_0062782 3300053078 Bacteria 1540
390 Ga0495595_0029554 3300053084 Bacteria 2453
391 Ga0495619_0000915 3300053085 Bacteria 19362
392 Ga0495619_0078863 3300053085 Bacteria 2214
393 Ga0495619_0178657 3300053085 Bacteria 1468
394 Ga0500566_0026782 3300053094 Bacteria 3375
395 Ga0500641_0150634 3300053096 Bacteria 1004
396 Ga0466962_0006001 3300061719 Bacteria 5839
397 Ga0466962_0045134 3300061719 Bacteria 2106
398 Ga0530510_0013546 3300061734 Bacteria 5736
399 Ga0070708_100211603
400 Ga0070658_10055731
401 Ga0070683_100005231
402 Ga0070683_100127379
403 Ga0070680_100140705
404 Ga0070680_100185278
405 Ga0070680_100207477
406 Ga0070682_100014383
407 Ga0070682_100227432
408 Ga0070660_100002874
409 Ga0070660_100044707
410 Ga0070660_100071210
411 Ga0070660_100071259
412 Ga0070660_100084004
413 Ga0070660_100170963
414 Ga0070671_100337235
415 Ga0070659_100088180
416 Ga0070714_100019455
417 Ga0070714_100046137
418 Ga0070714_100130667
419 Ga0070714_100159389
420 Ga0070714_100194371
421 Ga0070714_100213029
422 Ga0070711_100403705
423 Ga0070663_100162219
424 Ga0070681_10010625
425 Ga0070681_10013721
426 Ga0070681_10081148
427 Ga0070681_10096553
428 Ga0070681_10108705
429 Ga0070681_10163848
430 Ga0070681_10341774
431 Ga0070681_10516296
432 Ga0070707_100002419
433 Ga0070707_100568596
434 Ga0070698_100178919
435 Ga0070679_100032733
436 Ga0070679_100033291
437 Ga0070679_100110033
438 Ga0070679_100159884
439 Ga0070679_100256111
440 Ga0070679_100314113
441 Ga0070679_100337392
442 Ga0070684_100223146
443 Ga0070684_100288809
444 Ga0070684_100392205
445 Ga0068853_100209636
446 Ga0068853_100219333
447 Ga0070695_100000691
448 Ga0070665_100017879
449 Ga0068855_100043529
450 Ga0068855_100085922
451 Ga0068855_100117526
452 Ga0068855_100147076
453 Ga0068855_100293682
454 Ga0068855_100776654
455 Ga0068856_100050001
456 Ga0068856_100124033
457 Ga0068852_100084527
458 Ga0068852_100179206
459 Ga0068852_100538658
460 Ga0070717_10011023
461 Ga0070717_10286580
462 Ga0075433_10482716
463 Ga0075434_100063251
464 Ga0075436_100292673
465 Ga0075435_100110813
466 Ga0105240_10099696
467 Ga0105240_10183091
468 Ga0105240_10311037
469 Ga0105240_10408591
470 Ga0105240_10758547
471 Ga0105241_10348179
472 Ga0105237_10046549
473 Ga0105237_10122877
474 Ga0105237_10148537
475 Ga0105237_10647102
476 Ga0105238_10081390
477 Ga0105238_10344477
478 Ga0105239_10297924
479 Ga0105239_10478293
480 Ga0105246_10146455
481 Ga0157373_10071996
482 Ga0157371_10181234
483 Ga0157371_10232351
484 Ga0157370_10057333
485 Ga0157370_10069784
486 Ga0157370_10209273
487 Ga0157369_10042770
488 Ga0157369_10056857
489 Ga0157369_10114592
490 Ga0157369_10618237
491 Ga0157374_10088772
492 Ga0157372_10042313
493 Ga0157372_10130806
494 Ga0157372_10440493
495 Ga0157372_10504514
496 Ga0182008_10083208
497 Ga0157376_10203487
498 Ga0197907_10700966
499 Ga0206356_10589173
500 Ga0206356_11447407
501 Ga0206352_10306049
502 Ga0206354_11100769
503 Ga0206353_11695820
504 Ga0206353_11820485
505 Ga0206353_12018606
506 Ga0154015_1326565
507 Ga0224712_10009509
508 Ga0224712_10083843
509 Ga0224712_10097985
510 Ga0207705_10019196
511 Ga0207705_10032110
512 Ga0207705_10044950
513 Ga0207705_10191704
514 Ga0207654_10213970
515 Ga0207707_10023261
516 Ga0207707_10078282
517 Ga0207707_10124891
518 Ga0207707_10150780
519 Ga0207707_10261280
520 Ga0207707_10265475
521 Ga0207707_10273397
522 Ga0207695_10326443
523 Ga0207671_10055517
524 Ga0207671_10353390
525 Ga0207660_10112356
526 Ga0207660_10166719
527 Ga0207660_10356247
528 Ga0207657_10000286
529 Ga0207657_10004630
530 Ga0207657_10009122
531 Ga0207657_10011291
532 Ga0207657_10044779
533 Ga0207657_10240010
534 Ga0207657_10314450
535 Ga0207649_10045073
536 Ga0207652_10006261
537 Ga0207652_10054864
538 Ga0207652_10170550
539 Ga0207652_10453710
540 Ga0207646_10000648
541 Ga0207646_10102402
542 Ga0207664_10032851
543 Ga0207664_10054734
544 Ga0207664_10065990
545 Ga0207664_10116469
546 Ga0207664_10178574
547 Ga0207664_10199995
548 Ga0207690_10209329
549 Ga0207690_10268825
550 Ga0207690_10276143
551 Ga0207661_10012316
552 Ga0207667_10047802
553 Ga0207667_10062242
554 Ga0207667_10232536
555 Ga0207702_10162640
556 Ga0207702_10260170
557 Ga0207702_10308003
558 Ga0207674_10094124
559 Ga0207698_10091741
560 Ga0207698_10320751
561 Ga0207428_10110782
562 Ga0265326_10010165
563 Ga0265319_1003094
564 Ga0265334_10051253
565 Ga0265318_10000299
566 Ga0265336_10002636
567 Ga0265338_10006281
568 Ga0265338_10011084
569 Ga0265338_10013886
570 Ga0265330_10004771
571 Ga0265332_10023266
572 Ga0265328_10004618
573 Ga0265320_10017880
574 Ga0265325_10002129
575 Ga0265329_10019333
576 Ga0265331_10004413
577 Ga0265327_10041849
578 Ga0265327_10067487
579 Ga0265316_10013380
580 Ga0265313_10006943
581 Ga0265314_10023905
582 Ga0265342_10055057
583 Ga0316583_10019054
584 Ga0316583_10021740
585 Ga0373926_0012103
586 Ga0373935_0009941
587 Ga0373933_0169945
588 Ga0373933_0330592
589 Ga0373947_0004995
590 Ga0373937_0000997
591 Ga0373937_0123761
592 Ga0373925_0021341
593 Ga0395899_0009111
594 Ga0395899_0293255
595 Ga0395900_0019138
596 Ga0395900_0022240
597 Ga0395900_0049680
598 Ga0395900_0081763
599 Ga0395898_0018707
600 Ga0395898_0094285
601 Ga0395898_0114088
602 Ga0395898_0127736
603 Ga0395905_0010080
604 Ga0395905_0216970
605 Ga0395905_0269564
606 Ga0395905_0369752
607 Ga0395901_0007682
608 Ga0395901_0014107
609 Ga0395901_0042869
610 Ga0395901_0114607
611 Ga0395901_0245770
612 Ga0436360_0673449
613 Ga0466969_0005559
614 Ga0466969_0096510
615 Ga0466972_0053438
616 Ga0466965_0189472
617 Ga0466966_0028650
618 Ga0466966_0078239
619 Ga0466966_0169100
620 Ga0466961_0001920
621 Ga0466961_0023904
622 Ga0466961_0031074
623 Ga0466961_0043547
624 Ga0466961_0130785
625 Ga0466963_0000661
626 Ga0466963_0002598
627 Ga0466963_0002622
628 Ga0466963_0004591
629 Ga0466963_0019894
630 Ga0466963_0037756
631 Ga0466963_0041976
632 Ga0466963_0082415
633 Ga0466963_0112935
634 Ga0466963_0268119
635 Ga0466963_0318086
636 Ga0466963_0393291
637 Ga0466964_0013688
638 Ga0466964_0016618
639 Ga0466964_0062934
640 Ga0466964_0094787
641 Ga0466964_0132045
642 Ga0466971_0003326
643 Ga0466971_0008849
644 Ga0466971_0019131
645 Ga0466971_0054061
646 Ga0466968_0012102
647 Ga0466968_0041519
648 Ga0466968_0091656
649 Ga0466970_0065165
650 Ga0466970_0077496
651 Ga0466957_0007808
652 Ga0466957_0016310
653 Ga0466957_0026935
654 Ga0466957_0029628
655 Ga0466957_0052377
656 Ga0466960_0090830
657 Ga0466960_0183949
658 Ga0466959_0001055
659 Ga0466959_0003521
660 Ga0466959_0027976
661 Ga0466959_0042816
662 Ga0466959_0129926
663 Ga0466958_0001804
664 Ga0466958_0004248
665 Ga0466958_0014594
666 Ga0466958_0111802
667 Ga0466958_0122280
668 Ga0466958_0198683
669 Ga0466967_0003466
670 Ga0466967_0009594
671 Ga0466967_0016384
672 Ga0466967_0017841
673 Ga0466967_0026085
674 Ga0466967_0043054
675 Ga0466967_0046460
676 Ga0466967_0054817
677 Ga0466967_0158201
678 Ga0466967_0271987
679 Ga0466967_0272846
680 Ga0466967_0296196
681 Ga0466967_0360017
682 Ga0466967_0456946
683 Ga0466967_0508796
684 Ga0466967_0588386
685 Ga0466967_0635599
686 Ga0495592_0000691
687 Ga0495592_0061660
688 Ga0495603_0043086
689 Ga0495629_0072166
690 Ga0495629_0282006
691 Ga0495641_0074682
692 Ga0495651_0000180
693 Ga0495651_0021173
694 Ga0495651_0034200
695 Ga0495651_0046918
696 Ga0495653_0030958
697 Ga0495653_0058340
698 Ga0495653_0112637
699 Ga0495580_0032041
700 Ga0495639_0035189
701 Ga0495664_0012645
702 Ga0495664_0118700
703 Ga0495608_0010438
704 Ga0495608_0013154
705 Ga0495618_0018563
706 Ga0495618_0106942
707 Ga0495628_0000067
708 Ga0495628_0019818
709 Ga0495628_0228560
710 Ga0495630_0002340
711 Ga0495666_0000995
712 Ga0495652_0000315
713 Ga0495652_0016816
714 Ga0495652_0034383
715 Ga0495665_0074188
716 Ga0495587_0000302
717 Ga0495587_0014755
718 Ga0495645_0008828
719 Ga0495645_0073744
720 Ga0495645_0308313
721 Ga0495667_0087903
722 Ga0495667_0112181
723 Ga0495667_0163284
724 Ga0495656_0003607
725 Ga0495634_0025811
726 Ga0495635_0013240
727 Ga0495635_0019029
728 Ga0495635_0123543
729 Ga0495661_0159537
730 Ga0495657_0004413
731 Ga0495657_0067853
732 Ga0495599_0000274
733 Ga0495599_0018784
734 Ga0495599_0148809
735 Ga0495623_0000144
736 Ga0495623_0163448
737 Ga0495646_0014831
738 Ga0495646_0115986
739 Ga0495647_0008852
740 Ga0495658_0081517
741 Ga0495613_0003479
742 Ga0495624_0008107
743 Ga0495624_0118130
744 Ga0495600_0154558
745 Ga0495600_0181237
746 Ga0495600_0225660
747 Ga0495581_0045488
748 Ga0495581_0250902
749 Ga0495604_0000076
750 Ga0495674_0076548
751 Ga0495674_0099162
752 Ga0495676_0132588
753 Ga0495680_0013134
754 Ga0495680_0023305
755 Ga0495680_0068141
756 Ga0495680_0190681
757 Ga0495680_0205788
758 Ga0495675_0000170
759 Ga0495684_0157542
760 Ga0495593_0002986
761 Ga0495602_0000247
762 Ga0495602_0038704
763 Ga0495614_0000768
764 Ga0496101_0247840
765 Ga0496102_0070869
766 Ga0496103_0141992
767 Ga0496107_0018844
768 Ga0496107_0168398
769 Ga0496108_0149761
770 Ga0496108_0262042
771 Ga0496109_0208766
772 Ga0496109_0466268
773 Ga0496112_0044610
774 Ga0496112_0116533
775 Ga0496112_0180306
776 Ga0496112_0350591
777 Ga0496113_0045672
778 Ga0496113_0226288
779 Ga0501067_0000348
780 Ga0501069_0024940
781 nmdc:mga08y16_317834_c1
782 nmdc:mga0n895_187441_c1
783 nmdc:mga0rr50_133846_c1
784 Ga0495601_0000119
785 Ga0495601_0161048
786 Ga0495612_0002013
787 Ga0495612_0062782
788 Ga0495595_0029554
789 Ga0495619_0000915
790 Ga0495619_0078863
791 Ga0495619_0178657
792 Ga0500566_0026782
793 Ga0500641_0150634
794 Ga0466962_0006001
795 Ga0466962_0045134
796 Ga0530510_0013546

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18075

FtsX_ECD

FtsX extracellular domain

57

163

0.9

PF02687

FtsX

FtsX-like permease family

189

293

0.81

Map