F433889

General Info

Members Datasets Scaffolds Average Seq Length
397 273 794 181

Family's Representative Sequence

Representative Sequence 3300050493|nmdc:mga0k408_187269_c1|nmdc:mga0k408_187269_c1_271_1002
Length 215
Sequence MIFSENRRPLFRIMLWPKACELAKLVASATILNPLAPPASTKIGEILANAVAKPAKGNARLDLFKFVPFRLNRLAAEVSSALSAEYQVRYGLDIPEWRVLATLGFRDHACSAQYIAHCTRTHKSTISRAVTTLMKRQMIERVENADDRREFRLRMTTKGKALYEELIPNLLRREQEILSCLSAQERKNLAALFGKIEASLDLVQTSAEADAKEAY

Samples

Sample ID Description Type Environment
1 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
117 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
118 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
119 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
120 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
121 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
122 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
123 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
124 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
125 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
126 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
127 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
128 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
129 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
132 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
133 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
134 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
137 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
138 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
139 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
140 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
141 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
142 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
143 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
144 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
145 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
146 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
147 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
148 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
149 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
150 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
151 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
152 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
153 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
154 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
156 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
157 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
161 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
162 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
163 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
164 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
165 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
166 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
167 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
168 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
169 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
170 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
171 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
172 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
173 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
174 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
175 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
176 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
177 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
178 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
179 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
180 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
181 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
182 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
183 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
184 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
185 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
186 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
187 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
188 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
189 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
190 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
191 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
192 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
193 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
194 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
195 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
196 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
197 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
198 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
199 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
200 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
201 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
202 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
203 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
204 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
205 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
206 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
207 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
208 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
209 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
210 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
211 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
212 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
213 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
214 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
215 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
216 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
217 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
218 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
219 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
220 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
221 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
222 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
223 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
224 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
225 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
226 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
227 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
228 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
229 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
230 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
231 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
232 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
233 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
234 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
235 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
236 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
237 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
238 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
239 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
240 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
241 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
242 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
243 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
244 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
247 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
248 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
249 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
250 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
251 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
252 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
253 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
254 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
255 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
256 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
257 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
258 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
259 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
260 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
261 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
262 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
263 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
264 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
265 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
266 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
267 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
268 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
269 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
270 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
271 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
272 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
273 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.73
Metatranscriptomes 0
Isolates 2.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.05
Nodule 2.02
Rhizoplane 6.3
Rhizosphere 81.36
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0k408_187269_c1 3300050493 Bacteria 1234
2 JGI24738J21930_10081871 3300002075 Bacteria 676
3 JGI25404J52841_10022235 3300003659 Bacteria 1370
4 Ga0065715_10410964 3300005293 Bacteria 870
5 Ga0070670_100592927 3300005331 Bacteria 991
6 Ga0070680_100052242 3300005336 Bacteria 3336
7 Ga0070682_100284369 3300005337 Bacteria 1207
8 Ga0068868_100436140 3300005338 Bacteria 1137
9 Ga0070660_100009783 3300005339 Bacteria 6755
10 Ga0070691_10037778 3300005341 Bacteria 2279
11 Ga0070661_100366139 3300005344 Bacteria 1134
12 Ga0070675_100142286 3300005354 Bacteria 2051
13 Ga0070671_100274233 3300005355 Bacteria 1434
14 Ga0070674_100084727 3300005356 Bacteria 2273
15 Ga0070673_100964629 3300005364 Bacteria 793
16 Ga0070659_100666801 3300005366 Bacteria 898
17 Ga0070714_100313687 3300005435 Bacteria 1465
18 Ga0070713_100038244 3300005436 Bacteria 3886
19 Ga0070713_100351960 3300005436 Bacteria 1367
20 Ga0070700_100073138 3300005441 Bacteria 2193
21 Ga0070700_101049794 3300005441 Bacteria 673
22 Ga0070708_100779930 3300005445 Bacteria 899
23 Ga0070663_100022315 3300005455 Bacteria 4230
24 Ga0070663_100045675 3300005455 Bacteria 3096
25 Ga0070663_100077282 3300005455 Bacteria 2436
26 Ga0070663_100107908 3300005455 Bacteria 2088
27 Ga0070663_100247518 3300005455 Bacteria 1410
28 Ga0070663_100356163 3300005455 Bacteria 1186
29 Ga0070678_100027180 3300005456 Bacteria 3882
30 Ga0070678_100130340 3300005456 Bacteria 1997
31 Ga0070662_100070598 3300005457 Bacteria 2574
32 Ga0070681_10020406 3300005458 Bacteria 6641
33 Ga0070681_10024092 3300005458 Bacteria 6127
34 Ga0068867_100281966 3300005459 Bacteria 1363
35 Ga0068867_100443147 3300005459 Bacteria 1105
36 Ga0070698_100249502 3300005471 Bacteria 1708
37 Ga0070679_100140520 3300005530 Bacteria 2394
38 Ga0070684_100048558 3300005535 Bacteria 3682
39 Ga0070697_101180672 3300005536 Bacteria 682
40 Ga0068853_100007556 3300005539 Bacteria 8700
41 Ga0068853_100252531 3300005539 Bacteria 1618
42 Ga0068853_100406096 3300005539 Bacteria 1276
43 Ga0068853_100467990 3300005539 Bacteria 1187
44 Ga0068853_101003069 3300005539 Bacteria 804
45 Ga0070665_100011218 3300005548 Bacteria 9061
46 Ga0070665_100082768 3300005548 Bacteria 3214
47 Ga0070665_100155855 3300005548 Bacteria 2286
48 Ga0070665_100163739 3300005548 Bacteria 2226
49 Ga0070665_100603409 3300005548 Bacteria 1111
50 Ga0070664_100582413 3300005564 Bacteria 1037
51 Ga0070664_100851413 3300005564 Bacteria 854
52 Ga0068857_100012153 3300005577 Bacteria 7490
53 Ga0068854_100522597 3300005578 Bacteria 1003
54 Ga0068856_101008444 3300005614 Bacteria 851
55 Ga0070702_100109992 3300005615 Bacteria 1707
56 Ga0068852_100049008 3300005616 Bacteria 3612
57 Ga0068852_100243559 3300005616 Bacteria 1720
58 Ga0068852_100453038 3300005616 Bacteria 1270
59 Ga0068859_100052455 3300005617 Bacteria 4100
60 Ga0068859_100194158 3300005617 Bacteria 2114
61 Ga0068864_100665624 3300005618 Bacteria 1015
62 Ga0068861_100085153 3300005719 Bacteria 2482
63 Ga0068861_100689300 3300005719 Bacteria 948
64 Ga0068851_10012271 3300005834 Bacteria 4035
65 Ga0068851_10304449 3300005834 Bacteria 917
66 Ga0068863_100460623 3300005841 Bacteria 1249
67 Ga0068863_101067052 3300005841 Bacteria 812
68 Ga0068858_100171532 3300005842 Bacteria 2045
69 Ga0068858_100279545 3300005842 Bacteria 1589
70 Ga0068858_100708057 3300005842 Bacteria 980
71 Ga0068858_100827283 3300005842 Bacteria 904
72 Ga0068862_100243746 3300005844 Bacteria 1635
73 Ga0068862_100465977 3300005844 Bacteria 1193
74 Ga0081538_10048665 3300005981 Bacteria 2581
75 Ga0081538_10056728 3300005981 Bacteria 2291
76 Ga0081540_1003142 3300005983 Bacteria 13197
77 Ga0081540_1006347 3300005983 Bacteria 8636
78 Ga0081540_1032727 3300005983 Bacteria 2834
79 Ga0081540_1047121 3300005983 Bacteria 2170
80 Ga0075365_10281454 3300006038 Bacteria 1170
81 Ga0075363_100003491 3300006048 Bacteria 6694
82 Ga0075364_10091336 3300006051 Bacteria 2020
83 Ga0075432_10238181 3300006058 Bacteria 734
84 Ga0070716_100262730 3300006173 Bacteria 1182
85 Ga0075362_10141874 3300006177 Bacteria 1148
86 Ga0075367_10002314 3300006178 Bacteria 8656
87 Ga0075367_10089310 3300006178 Bacteria 1873
88 Ga0075367_10190850 3300006178 Bacteria 1278
89 Ga0075369_10036501 3300006186 Bacteria 2091
90 Ga0075369_10060624 3300006186 Bacteria 1650
91 Ga0075366_10025892 3300006195 Bacteria 3431
92 Ga0075366_10114107 3300006195 Bacteria 1627
93 Ga0075370_10015254 3300006353 Bacteria 4109
94 Ga0075370_10179793 3300006353 Bacteria 1244
95 Ga0068871_100166607 3300006358 Bacteria 1887
96 Ga0075428_100154775 3300006844 Bacteria 2491
97 Ga0068865_100017682 3300006881 Bacteria 4589
98 Ga0097620_100052457 3300006931 Bacteria 4100
99 Ga0097620_100137735 3300006931 Bacteria 2515
100 Ga0097620_100194183 3300006931 Bacteria 2114
101 Ga0111539_10095400 3300009094 Bacteria 3493
102 Ga0114129_11217745 3300009147 Bacteria 937
103 Ga0105243_10035721 3300009148 Bacteria 3853
104 Ga0105243_10893310 3300009148 Bacteria 883
105 Ga0105241_10303134 3300009174 Bacteria 1372
106 Ga0105242_10187680 3300009176 Bacteria 1828
107 Ga0105242_11430565 3300009176 Bacteria 720
108 Ga0105248_10233854 3300009177 Bacteria 2069
109 Ga0105237_10149559 3300009545 Bacteria 2331
110 Ga0105237_10168697 3300009545 Bacteria 2188
111 Ga0105238_10086651 3300009551 Bacteria 3119
112 Ga0105239_10019844 3300010375 Bacteria 7417
113 Ga0105239_10165739 3300010375 Bacteria 2470
114 Ga0105246_10340721 3300011119 Bacteria 1225
115 Ga0105246_10426592 3300011119 Bacteria 1108
116 Ga0157370_10216068 3300013104 Bacteria 1776
117 Ga0157369_10071598 3300013105 Bacteria 3721
118 Ga0157378_10289454 3300013297 Bacteria 1582
119 Ga0157375_10644913 3300013308 Bacteria 1215
120 Ga0157375_10939641 3300013308 Bacteria 1007
121 Ga0157375_11421004 3300013308 Bacteria 818
122 Ga0157380_10245118 3300014326 Bacteria 1618
123 Ga0157379_10142098 3300014968 Bacteria 2164
124 Ga0163161_10838422 3300017792 Bacteria 775
125 Ga0207656_10009540 3300025321 Bacteria 3606
126 Ga0207645_10248388 3300025907 Bacteria 1177
127 Ga0207705_10339689 3300025909 Bacteria 1156
128 Ga0207707_10001050 3300025912 Bacteria 26502
129 Ga0207671_10017229 3300025914 Bacteria 5580
130 Ga0207671_10120698 3300025914 Bacteria 2003
131 Ga0207693_10042933 3300025915 Bacteria 3559
132 Ga0207660_10008627 3300025917 Bacteria 6593
133 Ga0207649_10271431 3300025920 Bacteria 1229
134 Ga0207652_10089128 3300025921 Bacteria 2708
135 Ga0207646_10420902 3300025922 Bacteria 1206
136 Ga0207681_10307526 3300025923 Bacteria 1256
137 Ga0207687_10024723 3300025927 Bacteria 4015
138 Ga0207687_10169337 3300025927 Bacteria 1683
139 Ga0207700_10004470 3300025928 Bacteria 8250
140 Ga0207700_10024372 3300025928 Bacteria 4187
141 Ga0207664_10198828 3300025929 Bacteria 1729
142 Ga0207664_10229781 3300025929 Bacteria 1612
143 Ga0207664_10443991 3300025929 Bacteria 1157
144 Ga0207706_10075238 3300025933 Bacteria 2969
145 Ga0207706_10475095 3300025933 Bacteria 1080
146 Ga0207686_10132684 3300025934 Bacteria 1710
147 Ga0207686_10716299 3300025934 Bacteria 796
148 Ga0207709_10011375 3300025935 Bacteria 4909
149 Ga0207709_10118646 3300025935 Bacteria 1782
150 Ga0207669_10008753 3300025937 Bacteria 4772
151 Ga0207704_10014566 3300025938 Bacteria 3974
152 Ga0207711_10873507 3300025941 Bacteria 836
153 Ga0207689_10046303 3300025942 Bacteria 3595
154 Ga0207661_10766209 3300025944 Bacteria 888
155 Ga0207679_10226208 3300025945 Bacteria 1577
156 Ga0207679_11186801 3300025945 Bacteria 700
157 Ga0207712_10033048 3300025961 Bacteria 3495
158 Ga0207668_10390102 3300025972 Bacteria 1174
159 Ga0207640_10216320 3300025981 Bacteria 1464
160 Ga0207640_10926028 3300025981 Bacteria 763
161 Ga0207677_10286338 3300026023 Bacteria 1355
162 Ga0207703_10060703 3300026035 Bacteria 3092
163 Ga0207639_10088791 3300026041 Bacteria 2468
164 Ga0207639_10166038 3300026041 Bacteria 1865
165 Ga0207639_10571828 3300026041 Bacteria 1040
166 Ga0207678_10031422 3300026067 Bacteria 4632
167 Ga0207678_10048031 3300026067 Bacteria 3690
168 Ga0207678_10171594 3300026067 Bacteria 1852
169 Ga0207678_10178225 3300026067 Bacteria 1815
170 Ga0207678_10494415 3300026067 Bacteria 1066
171 Ga0207678_10545993 3300026067 Bacteria 1013
172 Ga0207702_11234502 3300026078 Bacteria 742
173 Ga0207676_10703607 3300026095 Bacteria 979
174 Ga0207674_10016517 3300026116 Bacteria 8077
175 Ga0207675_100104446 3300026118 Bacteria 2670
176 Ga0207683_10422406 3300026121 Bacteria 1228
177 Ga0207698_10081852 3300026142 Bacteria 2608
178 Ga0207698_10082098 3300026142 Bacteria 2604
179 Ga0207698_10514272 3300026142 Bacteria 1167
180 Ga0268266_10002006 3300028379 Bacteria 22754
181 Ga0268266_10002738 3300028379 Bacteria 18434
182 Ga0268266_10425305 3300028379 Bacteria 1259
183 Ga0268266_10482106 3300028379 Bacteria 1182
184 Ga0268265_10205861 3300028380 Bacteria 1710
185 Ga0268265_10250093 3300028380 Bacteria 1569
186 Ga0268265_10773774 3300028380 Bacteria 933
187 Ga0268265_11337056 3300028380 Bacteria 717
188 Ga0265326_10008483 3300028558 Bacteria 3098
189 Ga0265319_1001409 3300028563 Bacteria 14410
190 Ga0265334_10006596 3300028573 Bacteria 4995
191 Ga0265318_10002397 3300028577 Bacteria 10036
192 Ga0265323_10001183 3300028653 Bacteria 13288
193 Ga0265336_10000459 3300028666 Bacteria 24631
194 Ga0307517_10002574 3300028786 Bacteria 28885
195 Ga0307517_10115520 3300028786 Bacteria 2014
196 Ga0265338_10002741 3300028800 Bacteria 25847
197 Ga0265324_10085558 3300029957 Bacteria 1072
198 Ga0265330_10015957 3300031235 Bacteria 3471
199 Ga0265328_10178813 3300031239 Bacteria 802
200 Ga0265331_10018556 3300031250 Bacteria 3605
201 Ga0265316_10454402 3300031344 Bacteria 918
202 Ga0307513_10240214 3300031456 Bacteria 1617
203 Ga0307513_10296388 3300031456 Bacteria 1386
204 Ga0307408_100116061 3300031548 Bacteria 2066
205 Ga0265314_10056061 3300031711 Bacteria 2715
206 Ga0265342_10020456 3300031712 Bacteria 4244
207 Ga0307410_10160018 3300031852 Bacteria 1686
208 Ga0307409_100786527 3300031995 Bacteria 958
209 Ga0307416_100872145 3300032002 Bacteria 999
210 Ga0307414_11031013 3300032004 Bacteria 758
211 Ga0307411_10079809 3300032005 Bacteria 2248
212 Ga0307510_10010125 3300033180 Bacteria 11211
213 Ga0373930_0011290 3300034816 Bacteria 1611
214 Ga0373929_0018975 3300035085 Bacteria 1372
215 Ga0373936_0003033 3300035113 Bacteria 6278
216 Ga0373936_0161980 3300035113 Bacteria 975
217 Ga0373941_0035725 3300035115 Bacteria 1507
218 Ga0373953_0018839 3300035117 Bacteria 2560
219 Ga0373953_0147794 3300035117 Bacteria 1006
220 Ga0373954_0000308 3300035118 Bacteria 17778
221 Ga0373954_0066522 3300035118 Bacteria 1706
222 Ga0373956_0060455 3300035119 Bacteria 1715
223 Ga0373957_0004737 3300035120 Bacteria 4163
224 Ga0373943_0032413 3300035170 Bacteria 2484
225 Ga0373946_0051299 3300035171 Bacteria 1726
226 Ga0373955_0000625 3300035172 Bacteria 15149
227 Ga0373955_0052688 3300035172 Bacteria 2220
228 Ga0373942_0018588 3300035207 Bacteria 1727
229 Ga0373962_0142707 3300035242 Bacteria 779
230 Ga0373924_0001037 3300035410 Bacteria 8827
231 Ga0373931_0020458 3300035691 Bacteria 3312
232 Ga0373935_0000119 3300035692 Bacteria 35716
233 Ga0373927_0000641 3300035695 Bacteria 26496
234 Ga0373927_0228228 3300035695 Bacteria 1223
235 Ga0373933_0003162 3300035724 Bacteria 9197
236 Ga0373947_0001785 3300035725 Bacteria 13162
237 Ga0373937_0013852 3300036401 Bacteria 7107
238 Ga0373937_0014783 3300036401 Bacteria 6892
239 Ga0373925_0002584 3300037068 Bacteria 14399
240 Ga0373925_0053921 3300037068 Bacteria 3007
241 Ga0373925_0483448 3300037068 Bacteria 1016
242 Ga0373925_1361569 3300037068 Bacteria 582
243 Ga0395905_0253741 3300037471 Bacteria 1643
244 Ga0436365_1340371 3300039437 Bacteria 899
245 Ga0451853_3034735 3300041512 Bacteria 845
246 Ga0466966_0403070 3300044684 Bacteria 822
247 Ga0466964_0252429 3300044706 Bacteria 870
248 Ga0466959_0054677 3300045049 Bacteria 2916
249 Ga0466958_0077722 3300045836 Bacteria 2039
250 Ga0495617_019921 3300046452 Bacteria 2267
251 Ga0495592_0001710 3300046454 Bacteria 15422
252 Ga0495592_0009597 3300046454 Bacteria 7283
253 Ga0495603_0045203 3300046455 Bacteria 2626
254 Ga0495629_0000348 3300046459 Bacteria 39364
255 Ga0495629_0000353 3300046459 Bacteria 39092
256 Ga0495641_0000972 3300046461 Bacteria 24598
257 Ga0495651_0003574 3300046462 Bacteria 11925
258 Ga0495653_0002076 3300046463 Bacteria 15760
259 Ga0495653_0704165 3300046463 Bacteria 613
260 Ga0495580_0004944 3300046472 Bacteria 11142
261 Ga0495580_0296820 3300046472 Bacteria 1101
262 Ga0495582_0080328 3300046473 Bacteria 1810
263 Ga0495639_0000177 3300046475 Bacteria 33573
264 Ga0495662_0000461 3300046476 Bacteria 18377
265 Ga0495664_0006586 3300046477 Bacteria 6419
266 Ga0495594_0000079 3300046499 Bacteria 42880
267 Ga0495594_0023235 3300046499 Bacteria 3321
268 Ga0495607_0122695 3300046501 Bacteria 1362
269 Ga0495608_0000368 3300046511 Bacteria 31510
270 Ga0495616_0115685 3300046513 Bacteria 1242
271 Ga0495618_0018215 3300046514 Bacteria 4312
272 Ga0495618_0250039 3300046514 Bacteria 1112
273 Ga0495630_0001616 3300046517 Bacteria 15677
274 Ga0495630_0717232 3300046517 Bacteria 765
275 Ga0495663_0134484 3300046525 Bacteria 836
276 Ga0495666_0384790 3300046526 Bacteria 631
277 Ga0495652_0081837 3300046529 Bacteria 2662
278 Ga0495652_0158696 3300046529 Bacteria 1758
279 Ga0495665_0000570 3300046531 Bacteria 18750
280 Ga0495665_0288038 3300046531 Bacteria 842
281 Ga0495640_0001386 3300046533 Bacteria 19082
282 Ga0495586_0076568 3300046535 Bacteria 1833
283 Ga0495587_0001529 3300046536 Bacteria 15391
284 Ga0495621_0063101 3300046539 Bacteria 1349
285 Ga0495645_0008041 3300046543 Bacteria 7344
286 Ga0495645_0493123 3300046543 Bacteria 767
287 Ga0495622_0002449 3300046557 Bacteria 8997
288 Ga0495667_0000778 3300046559 Bacteria 20484
289 Ga0495667_0015301 3300046559 Bacteria 5181
290 Ga0495656_0004904 3300046615 Bacteria 4606
291 Ga0495656_0017632 3300046615 Bacteria 2727
292 Ga0495656_0018685 3300046615 Bacteria 2667
293 Ga0495668_0035000 3300046616 Bacteria 2815
294 Ga0495634_0000334 3300046642 Bacteria 45432
295 Ga0495634_0014193 3300046642 Bacteria 5747
296 Ga0495611_0024765 3300046648 Bacteria 2612
297 Ga0495625_0188894 3300046660 Bacteria 1366
298 Ga0495625_0495523 3300046660 Bacteria 748
299 Ga0495635_0000372 3300046663 Bacteria 28497
300 Ga0495635_0000477 3300046663 Bacteria 25298
301 Ga0495659_0060726 3300046664 Bacteria 1395
302 Ga0495599_0003226 3300046678 Bacteria 9493
303 Ga0495599_0233312 3300046678 Bacteria 1123
304 Ga0495623_0043995 3300046679 Bacteria 2838
305 Ga0495646_0002558 3300046680 Bacteria 11178
306 Ga0495647_0003566 3300046681 Bacteria 4989
307 Ga0495658_0000416 3300046683 Bacteria 23941
308 Ga0495669_0013307 3300046684 Bacteria 3504
309 Ga0495669_0030494 3300046684 Bacteria 2367
310 Ga0495613_0005732 3300046689 Bacteria 9304
311 Ga0495624_0001221 3300046690 Bacteria 20262
312 Ga0495670_0145764 3300046691 Bacteria 1240
313 Ga0495589_0221158 3300046794 Bacteria 889
314 Ga0495581_0000477 3300047315 Bacteria 20433
315 Ga0495581_0153686 3300047315 Bacteria 1344
316 Ga0495604_0014529 3300047317 Bacteria 6279
317 Ga0495604_0367477 3300047317 Bacteria 953
318 Ga0495636_0060704 3300047318 Bacteria 1598
319 Ga0495636_0172139 3300047318 Bacteria 979
320 Ga0495636_0196690 3300047318 Bacteria 919
321 Ga0495674_0000533 3300047319 Bacteria 35160
322 Ga0495674_0226505 3300047319 Bacteria 1544
323 Ga0495680_0002581 3300047322 Bacteria 18442
324 Ga0495680_0474926 3300047322 Bacteria 852
325 Ga0495675_0044173 3300047444 Bacteria 2838
326 Ga0495673_0174997 3300047469 Bacteria 816
327 Ga0495684_0001014 3300047471 Bacteria 22867
328 Ga0495593_0001154 3300047673 Bacteria 15412
329 Ga0495593_0004444 3300047673 Bacteria 8330
330 Ga0495602_0002140 3300048088 Bacteria 19931
331 Ga0495602_0181142 3300048088 Bacteria 1625
332 Ga0495614_0005404 3300048089 Bacteria 5764
333 Ga0495614_0274160 3300048089 Bacteria 776
334 Ga0495615_0003787 3300048090 Bacteria 2571
335 Ga0496100_0182447 3300048903 Bacteria 1518
336 Ga0496101_0075445 3300048904 Bacteria 2482
337 Ga0496101_0497205 3300048904 Bacteria 963
338 Ga0496102_0096464 3300048905 Bacteria 2741
339 Ga0496102_0131752 3300048905 Bacteria 2341
340 Ga0496103_0011840 3300048906 Bacteria 5177
341 Ga0496103_0735234 3300048906 Bacteria 624
342 Ga0496104_0063943 3300048907 Bacteria 3490
343 Ga0496105_0023168 3300048908 Bacteria 5034
344 Ga0496106_0172617 3300048909 Bacteria 1714
345 Ga0496108_0052485 3300048911 Bacteria 3417
346 Ga0496108_0488544 3300048911 Bacteria 1075
347 Ga0496109_0095294 3300048912 Bacteria 2755
348 Ga0496109_0151874 3300048912 Bacteria 2168
349 Ga0496110_0319369 3300048913 Bacteria 1414
350 Ga0496110_1166490 3300048913 Bacteria 679
351 Ga0496111_0069157 3300048914 Bacteria 2567
352 Ga0496112_0026725 3300048915 Bacteria 5560
353 Ga0496112_0267929 3300048915 Bacteria 1656
354 Ga0496113_0179428 3300048916 Bacteria 1678
355 Ga0496114_0092048 3300048917 Bacteria 2576
356 Ga0496114_0218270 3300048917 Bacteria 1673
357 Ga0496114_1237815 3300048917 Bacteria 633
358 Ga0496115_0061669 3300048918 Bacteria 3023
359 Ga0496115_0756406 3300048918 Bacteria 759
360 Ga0496119_0106311 3300048922 Bacteria 1566
361 Ga0496119_0150832 3300048922 Bacteria 1246
362 Ga0496121_0362399 3300048924 Bacteria 962
363 Ga0496125_0068442 3300048928 Bacteria 2793
364 Ga0496126_0984848 3300048929 Bacteria 634
365 Ga0501038_0214211 3300049574 Bacteria 1540
366 Ga0501042_0447434 3300049578 Bacteria 937
367 Ga0501067_0133458 3300049583 Bacteria 1382
368 Ga0501076_0180664 3300049592 Bacteria 1720
369 nmdc:mga0yw44_272192_c1 3300050492 Bacteria 1131
370 nmdc:mga08y16_425849_c1 3300050511 Bacteria 1356
371 Ga0495601_0063470 3300053077 Bacteria 2348
372 Ga0495601_0082883 3300053077 Bacteria 2059
373 Ga0495612_0093142 3300053078 Bacteria 1278
374 Ga0500635_0034855 3300053080 Bacteria 1651
375 Ga0495595_0001247 3300053084 Bacteria 9910
376 Ga0495619_0000563 3300053085 Bacteria 24565
377 Ga0500641_0006410 3300053096 Bacteria 4177
378 Ga0500572_000057 3300053111 Bacteria 33904
379 Ga0500559_0000219 3300053136 Bacteria 45843
380 Ga0500603_006249 3300053150 Bacteria 2585
381 Ga0500620_033906 3300053155 Bacteria 1636
382 Ga0500638_001732 3300053162 Bacteria 7123
383 Ga0500638_081847 3300053162 Bacteria 1532
384 Ga0500637_0000168 3300053178 Bacteria 24363
385 Ga0500576_026268 3300053725 Bacteria 2656
386 Ga0500596_001061 3300053735 Bacteria 5538
387 Ga0500661_000293 3300055283 Bacteria 9112
388 Ga0500661_050014 3300055283 Bacteria 746
389 2513695020 2513237101 Bacteria 7952346
390 2723841917 2721755755 Bacteria 8322773
391 2874610484 2874604998 Bacteria 7834745
392 2876817417 2876808645 Bacteria 8824342
393 2879115126 2879110137 Bacteria 8907982
394 2922388772 2922386360 Bacteria 7017218
395 8006969385 8006964411 Bacteria 8966052
396 8007000678 8006994254 Bacteria 8309700
397 8056678571 8056673599 Bacteria 7871253
398 nmdc:mga0k408_187269_c1
399 JGI24738J21930_10081871
400 JGI25404J52841_10022235
401 Ga0065715_10410964
402 Ga0070670_100592927
403 Ga0070680_100052242
404 Ga0070682_100284369
405 Ga0068868_100436140
406 Ga0070660_100009783
407 Ga0070691_10037778
408 Ga0070661_100366139
409 Ga0070675_100142286
410 Ga0070671_100274233
411 Ga0070674_100084727
412 Ga0070673_100964629
413 Ga0070659_100666801
414 Ga0070714_100313687
415 Ga0070713_100038244
416 Ga0070713_100351960
417 Ga0070700_100073138
418 Ga0070700_101049794
419 Ga0070708_100779930
420 Ga0070663_100022315
421 Ga0070663_100045675
422 Ga0070663_100077282
423 Ga0070663_100107908
424 Ga0070663_100247518
425 Ga0070663_100356163
426 Ga0070678_100027180
427 Ga0070678_100130340
428 Ga0070662_100070598
429 Ga0070681_10020406
430 Ga0070681_10024092
431 Ga0068867_100281966
432 Ga0068867_100443147
433 Ga0070698_100249502
434 Ga0070679_100140520
435 Ga0070684_100048558
436 Ga0070697_101180672
437 Ga0068853_100007556
438 Ga0068853_100252531
439 Ga0068853_100406096
440 Ga0068853_100467990
441 Ga0068853_101003069
442 Ga0070665_100011218
443 Ga0070665_100082768
444 Ga0070665_100155855
445 Ga0070665_100163739
446 Ga0070665_100603409
447 Ga0070664_100582413
448 Ga0070664_100851413
449 Ga0068857_100012153
450 Ga0068854_100522597
451 Ga0068856_101008444
452 Ga0070702_100109992
453 Ga0068852_100049008
454 Ga0068852_100243559
455 Ga0068852_100453038
456 Ga0068859_100052455
457 Ga0068859_100194158
458 Ga0068864_100665624
459 Ga0068861_100085153
460 Ga0068861_100689300
461 Ga0068851_10012271
462 Ga0068851_10304449
463 Ga0068863_100460623
464 Ga0068863_101067052
465 Ga0068858_100171532
466 Ga0068858_100279545
467 Ga0068858_100708057
468 Ga0068858_100827283
469 Ga0068862_100243746
470 Ga0068862_100465977
471 Ga0081538_10048665
472 Ga0081538_10056728
473 Ga0081540_1003142
474 Ga0081540_1006347
475 Ga0081540_1032727
476 Ga0081540_1047121
477 Ga0075365_10281454
478 Ga0075363_100003491
479 Ga0075364_10091336
480 Ga0075432_10238181
481 Ga0070716_100262730
482 Ga0075362_10141874
483 Ga0075367_10002314
484 Ga0075367_10089310
485 Ga0075367_10190850
486 Ga0075369_10036501
487 Ga0075369_10060624
488 Ga0075366_10025892
489 Ga0075366_10114107
490 Ga0075370_10015254
491 Ga0075370_10179793
492 Ga0068871_100166607
493 Ga0075428_100154775
494 Ga0068865_100017682
495 Ga0097620_100052457
496 Ga0097620_100137735
497 Ga0097620_100194183
498 Ga0111539_10095400
499 Ga0114129_11217745
500 Ga0105243_10035721
501 Ga0105243_10893310
502 Ga0105241_10303134
503 Ga0105242_10187680
504 Ga0105242_11430565
505 Ga0105248_10233854
506 Ga0105237_10149559
507 Ga0105237_10168697
508 Ga0105238_10086651
509 Ga0105239_10019844
510 Ga0105239_10165739
511 Ga0105246_10340721
512 Ga0105246_10426592
513 Ga0157370_10216068
514 Ga0157369_10071598
515 Ga0157378_10289454
516 Ga0157375_10644913
517 Ga0157375_10939641
518 Ga0157375_11421004
519 Ga0157380_10245118
520 Ga0157379_10142098
521 Ga0163161_10838422
522 Ga0207656_10009540
523 Ga0207645_10248388
524 Ga0207705_10339689
525 Ga0207707_10001050
526 Ga0207671_10017229
527 Ga0207671_10120698
528 Ga0207693_10042933
529 Ga0207660_10008627
530 Ga0207649_10271431
531 Ga0207652_10089128
532 Ga0207646_10420902
533 Ga0207681_10307526
534 Ga0207687_10024723
535 Ga0207687_10169337
536 Ga0207700_10004470
537 Ga0207700_10024372
538 Ga0207664_10198828
539 Ga0207664_10229781
540 Ga0207664_10443991
541 Ga0207706_10075238
542 Ga0207706_10475095
543 Ga0207686_10132684
544 Ga0207686_10716299
545 Ga0207709_10011375
546 Ga0207709_10118646
547 Ga0207669_10008753
548 Ga0207704_10014566
549 Ga0207711_10873507
550 Ga0207689_10046303
551 Ga0207661_10766209
552 Ga0207679_10226208
553 Ga0207679_11186801
554 Ga0207712_10033048
555 Ga0207668_10390102
556 Ga0207640_10216320
557 Ga0207640_10926028
558 Ga0207677_10286338
559 Ga0207703_10060703
560 Ga0207639_10088791
561 Ga0207639_10166038
562 Ga0207639_10571828
563 Ga0207678_10031422
564 Ga0207678_10048031
565 Ga0207678_10171594
566 Ga0207678_10178225
567 Ga0207678_10494415
568 Ga0207678_10545993
569 Ga0207702_11234502
570 Ga0207676_10703607
571 Ga0207674_10016517
572 Ga0207675_100104446
573 Ga0207683_10422406
574 Ga0207698_10081852
575 Ga0207698_10082098
576 Ga0207698_10514272
577 Ga0268266_10002006
578 Ga0268266_10002738
579 Ga0268266_10425305
580 Ga0268266_10482106
581 Ga0268265_10205861
582 Ga0268265_10250093
583 Ga0268265_10773774
584 Ga0268265_11337056
585 Ga0265326_10008483
586 Ga0265319_1001409
587 Ga0265334_10006596
588 Ga0265318_10002397
589 Ga0265323_10001183
590 Ga0265336_10000459
591 Ga0307517_10002574
592 Ga0307517_10115520
593 Ga0265338_10002741
594 Ga0265324_10085558
595 Ga0265330_10015957
596 Ga0265328_10178813
597 Ga0265331_10018556
598 Ga0265316_10454402
599 Ga0307513_10240214
600 Ga0307513_10296388
601 Ga0307408_100116061
602 Ga0265314_10056061
603 Ga0265342_10020456
604 Ga0307410_10160018
605 Ga0307409_100786527
606 Ga0307416_100872145
607 Ga0307414_11031013
608 Ga0307411_10079809
609 Ga0307510_10010125
610 Ga0373930_0011290
611 Ga0373929_0018975
612 Ga0373936_0003033
613 Ga0373936_0161980
614 Ga0373941_0035725
615 Ga0373953_0018839
616 Ga0373953_0147794
617 Ga0373954_0000308
618 Ga0373954_0066522
619 Ga0373956_0060455
620 Ga0373957_0004737
621 Ga0373943_0032413
622 Ga0373946_0051299
623 Ga0373955_0000625
624 Ga0373955_0052688
625 Ga0373942_0018588
626 Ga0373962_0142707
627 Ga0373924_0001037
628 Ga0373931_0020458
629 Ga0373935_0000119
630 Ga0373927_0000641
631 Ga0373927_0228228
632 Ga0373933_0003162
633 Ga0373947_0001785
634 Ga0373937_0013852
635 Ga0373937_0014783
636 Ga0373925_0002584
637 Ga0373925_0053921
638 Ga0373925_0483448
639 Ga0373925_1361569
640 Ga0395905_0253741
641 Ga0436365_1340371
642 Ga0451853_3034735
643 Ga0466966_0403070
644 Ga0466964_0252429
645 Ga0466959_0054677
646 Ga0466958_0077722
647 Ga0495617_019921
648 Ga0495592_0001710
649 Ga0495592_0009597
650 Ga0495603_0045203
651 Ga0495629_0000348
652 Ga0495629_0000353
653 Ga0495641_0000972
654 Ga0495651_0003574
655 Ga0495653_0002076
656 Ga0495653_0704165
657 Ga0495580_0004944
658 Ga0495580_0296820
659 Ga0495582_0080328
660 Ga0495639_0000177
661 Ga0495662_0000461
662 Ga0495664_0006586
663 Ga0495594_0000079
664 Ga0495594_0023235
665 Ga0495607_0122695
666 Ga0495608_0000368
667 Ga0495616_0115685
668 Ga0495618_0018215
669 Ga0495618_0250039
670 Ga0495630_0001616
671 Ga0495630_0717232
672 Ga0495663_0134484
673 Ga0495666_0384790
674 Ga0495652_0081837
675 Ga0495652_0158696
676 Ga0495665_0000570
677 Ga0495665_0288038
678 Ga0495640_0001386
679 Ga0495586_0076568
680 Ga0495587_0001529
681 Ga0495621_0063101
682 Ga0495645_0008041
683 Ga0495645_0493123
684 Ga0495622_0002449
685 Ga0495667_0000778
686 Ga0495667_0015301
687 Ga0495656_0004904
688 Ga0495656_0017632
689 Ga0495656_0018685
690 Ga0495668_0035000
691 Ga0495634_0000334
692 Ga0495634_0014193
693 Ga0495611_0024765
694 Ga0495625_0188894
695 Ga0495625_0495523
696 Ga0495635_0000372
697 Ga0495635_0000477
698 Ga0495659_0060726
699 Ga0495599_0003226
700 Ga0495599_0233312
701 Ga0495623_0043995
702 Ga0495646_0002558
703 Ga0495647_0003566
704 Ga0495658_0000416
705 Ga0495669_0013307
706 Ga0495669_0030494
707 Ga0495613_0005732
708 Ga0495624_0001221
709 Ga0495670_0145764
710 Ga0495589_0221158
711 Ga0495581_0000477
712 Ga0495581_0153686
713 Ga0495604_0014529
714 Ga0495604_0367477
715 Ga0495636_0060704
716 Ga0495636_0172139
717 Ga0495636_0196690
718 Ga0495674_0000533
719 Ga0495674_0226505
720 Ga0495680_0002581
721 Ga0495680_0474926
722 Ga0495675_0044173
723 Ga0495673_0174997
724 Ga0495684_0001014
725 Ga0495593_0001154
726 Ga0495593_0004444
727 Ga0495602_0002140
728 Ga0495602_0181142
729 Ga0495614_0005404
730 Ga0495614_0274160
731 Ga0495615_0003787
732 Ga0496100_0182447
733 Ga0496101_0075445
734 Ga0496101_0497205
735 Ga0496102_0096464
736 Ga0496102_0131752
737 Ga0496103_0011840
738 Ga0496103_0735234
739 Ga0496104_0063943
740 Ga0496105_0023168
741 Ga0496106_0172617
742 Ga0496108_0052485
743 Ga0496108_0488544
744 Ga0496109_0095294
745 Ga0496109_0151874
746 Ga0496110_0319369
747 Ga0496110_1166490
748 Ga0496111_0069157
749 Ga0496112_0026725
750 Ga0496112_0267929
751 Ga0496113_0179428
752 Ga0496114_0092048
753 Ga0496114_0218270
754 Ga0496114_1237815
755 Ga0496115_0061669
756 Ga0496115_0756406
757 Ga0496119_0106311
758 Ga0496119_0150832
759 Ga0496121_0362399
760 Ga0496125_0068442
761 Ga0496126_0984848
762 Ga0501038_0214211
763 Ga0501042_0447434
764 Ga0501067_0133458
765 Ga0501076_0180664
766 nmdc:mga0yw44_272192_c1
767 nmdc:mga08y16_425849_c1
768 Ga0495601_0063470
769 Ga0495601_0082883
770 Ga0495612_0093142
771 Ga0500635_0034855
772 Ga0495595_0001247
773 Ga0495619_0000563
774 Ga0500641_0006410
775 Ga0500572_000057
776 Ga0500559_0000219
777 Ga0500603_006249
778 Ga0500620_033906
779 Ga0500638_001732
780 Ga0500638_081847
781 Ga0500637_0000168
782 Ga0500576_026268
783 Ga0500596_001061
784 Ga0500661_000293
785 Ga0500661_050014
786 2513695020
787 2723841917
788 2874610484
789 2876817417
790 2879115126
791 2922388772
792 8006969385
793 8007000678
794 8056678571

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12802

MarR_2

MarR family

90

150

0.98

PF13463

HTH_27

Winged helix DNA-binding domain

92

159

0.97

PF01047

MarR

MarR family

92

151

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ija-assembly1.cif.gz_B structure of s. aureus methicillin resistance factor mecr2 0.9558 60 119
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9164 60 120
2heo-assembly1.cif.gz_A general structure-based approach to the design of protein ligands: application to the design of kv1.2 potassium channel blockers. 0.9108 57 119
2l02-assembly1.cif.gz_A solution nmr structure of protein bt2368 from bacteroides thetaiotaomicron, northeast structural genomics consortium target btr375 0.9076 59 119
5j6x-assembly2.cif.gz_B crystal structure of the apo-zalpha of zebrafish pkz 0.9014 60 119
ID Description Score Start End Superfamily
4ijaB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9395 60 120 1.10.10.10
2xrnA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9247 60 119 1.10.10.10
af_P71977_12_75_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9218 59 119 1.10.10.10
af_P77569_1_73_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9185 60 120 1.10.10.10
4lb5A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9164 60 120 1.10.10.10
ID Description Score Start End GO Terms
AF-C6D109-F1-model_v4 deleted 0.9314 49 160
AF-A0A6N9T8Q8-F1-model_v4 MarR family transcriptional regulator 0.9284 37 165 GO:0003677
GO:0003700
GO:0006950
AF-A0A6N9T8Q8-F1-model_v4 MarR family transcriptional regulator 0.9019 37 165 GO:0003677
GO:0003700
GO:0006950
AF-A0A536WN11-F1-model_v4 MarR family transcriptional regulator 0.9001 42 163 GO:0003677
GO:0003700
GO:0006950
AF-A0A2I1DP50-F1-model_v4 MarR family transcriptional regulator 0.8927 44 164 GO:0003677
GO:0003700

Map