F433856

General Info

Members Datasets Scaffolds Average Seq Length
397 189 794 186

Family's Representative Sequence

Representative Sequence 3300046528|Ga0495642_0254989|Ga0495642_0254989_51_689
Length 212
Sequence MRSNPQPDRIISAQKIFLRRGTLEASLLTDLLSRWPLIQQLRTGADGTGSEAMSEHTRKLRPKHDGAEVTPSICPYCGVGCGQLVYHKNGKLISIEGDPNSPISRGHLCPKGADTYELHTHPGRLKKVKYRRPYSKQWEDLDLETAMDMVADRLWESRERTFQETRDGESLMQTTAIAHLGGATLDNEENYLIKKLFTGGLGMVCISNQARI

Samples

Sample ID Description Type Environment
1 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
78 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
82 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
88 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
127 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
128 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
129 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
130 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
131 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
132 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
134 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
142 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
143 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
144 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
145 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
146 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
147 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
152 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
153 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
154 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
155 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
156 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
157 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
158 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
159 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
160 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
166 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
167 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
168 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
169 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
170 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
171 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
172 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
173 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
174 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
175 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
176 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
177 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
178 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
179 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
180 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
181 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
182 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
183 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
184 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.71
Metatranscriptomes 5.29
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.28
Rhizosphere 95.21
Stem 0
Stem Tuber 0
Unclassified 6.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495642_0254989 3300046528 Bacteria 767
2 Ga0058863_11903939 3300004799 Bacteria 2457
3 Ga0058861_11682047 3300004800 Bacteria 1636
4 Ga0058862_12760179 3300004803 Bacteria 3551
5 Ga0065715_10148879 3300005293 Bacteria 1753
6 Ga0070658_10085651 3300005327 Bacteria 2592
7 Ga0070683_100166457 3300005329 Bacteria 2092
8 Ga0070683_100508611 3300005329 Bacteria 1151
9 Ga0070690_100409716 3300005330 Bacteria 997
10 Ga0070670_100388773 3300005331 Bacteria 1230
11 Ga0070680_100024417 3300005336 Bacteria 4829
12 Ga0070680_100044221 3300005336 Bacteria 3619
13 Ga0068868_100012438 3300005338 Bacteria 6222
14 Ga0070660_100002780 3300005339 Bacteria 12015
15 Ga0070661_100010895 3300005344 Bacteria 6333
16 Ga0070661_100457331 3300005344 Bacteria 1016
17 Ga0070675_100073788 3300005354 Bacteria 2833
18 Ga0070667_100501011 3300005367 Bacteria 1113
19 Ga0070709_10027662 3300005434 Bacteria 3373
20 Ga0070709_10402190 3300005434 Bacteria 1022
21 Ga0070714_100193458 3300005435 Bacteria 1857
22 Ga0070714_100375745 3300005435 Unclassified 1339
23 Ga0070714_100521457 3300005435 Unclassified 1135
24 Ga0070714_101018866 3300005435 Bacteria 806
25 Ga0070713_100005930 3300005436 Bacteria 8400
26 Ga0070713_100013782 3300005436 Bacteria 5981
27 Ga0070713_100033246 3300005436 Bacteria 4129
28 Ga0070713_100722361 3300005436 Bacteria 952
29 Ga0070710_10005337 3300005437 Bacteria 6097
30 Ga0070711_100023789 3300005439 Bacteria 3990
31 Ga0070711_100086945 3300005439 Bacteria 2243
32 Ga0070711_100124519 3300005439 Bacteria 1911
33 Ga0070681_10017810 3300005458 Bacteria 7098
34 Ga0070681_10114272 3300005458 Bacteria 2639
35 Ga0070681_10119098 3300005458 Bacteria 2576
36 Ga0070681_10164593 3300005458 Bacteria 2141
37 Ga0070706_100000797 3300005467 Bacteria 35157
38 Ga0070706_100003249 3300005467 Bacteria 16066
39 Ga0070707_100033913 3300005468 Unclassified 4868
40 Ga0070707_100060124 3300005468 Bacteria 3644
41 Ga0070698_100002901 3300005471 Bacteria 18875
42 Ga0070699_100086276 3300005518 Bacteria 2739
43 Ga0070699_100100338 3300005518 Bacteria 2537
44 Ga0070679_100007551 3300005530 Bacteria 10169
45 Ga0070679_100034548 3300005530 Bacteria 5011
46 Ga0070679_100057177 3300005530 Unclassified 3888
47 Ga0070679_100362701 3300005530 Bacteria 1396
48 Ga0070684_100420140 3300005535 Bacteria 1234
49 Ga0070684_100970944 3300005535 Bacteria 797
50 Ga0070697_100000161 3300005536 Bacteria 54619
51 Ga0070697_100000636 3300005536 Bacteria 26617
52 Ga0070697_100722169 3300005536 Unclassified 880
53 Ga0068853_100127330 3300005539 Bacteria 2276
54 Ga0070686_100092008 3300005544 Bacteria 2030
55 Ga0070696_100398437 3300005546 Bacteria 1076
56 Ga0070696_100441541 3300005546 Bacteria 1025
57 Ga0070704_100062884 3300005549 Bacteria 2662
58 Ga0068855_100009164 3300005563 Bacteria 11952
59 Ga0068855_100017153 3300005563 Bacteria 8711
60 Ga0068855_100078075 3300005563 Bacteria 3841
61 Ga0068855_100160758 3300005563 Bacteria 2549
62 Ga0068855_100248693 3300005563 Bacteria 1984
63 Ga0070664_100547255 3300005564 Bacteria 1070
64 Ga0068857_100008468 3300005577 Bacteria 8890
65 Ga0068857_100073842 3300005577 Bacteria 3039
66 Ga0068857_100091595 3300005577 Bacteria 2722
67 Ga0068857_100115159 3300005577 Bacteria 2418
68 Ga0068857_100878059 3300005577 Unclassified 859
69 Ga0068854_100038033 3300005578 Bacteria 3382
70 Ga0068854_100109680 3300005578 Bacteria 2080
71 Ga0068854_100252772 3300005578 Bacteria 1408
72 Ga0068856_100000875 3300005614 Bacteria 32269
73 Ga0068856_100004375 3300005614 Bacteria 14073
74 Ga0068856_100086873 3300005614 Bacteria 3108
75 Ga0068856_100429688 3300005614 Bacteria 1341
76 Ga0068856_100757781 3300005614 Bacteria 991
77 Ga0068856_100826774 3300005614 Bacteria 946
78 Ga0068852_100000567 3300005616 Bacteria 24351
79 Ga0068863_100007685 3300005841 Bacteria 10545
80 Ga0068860_100007988 3300005843 Bacteria 10547
81 Ga0081540_1000160 3300005983 Bacteria 69415
82 Ga0081540_1109200 3300005983 Bacteria 1174
83 Ga0070717_10001450 3300006028 Bacteria 16361
84 Ga0070717_10011779 3300006028 Bacteria 6654
85 Ga0070717_10078681 3300006028 Bacteria 2764
86 Ga0070717_10099051 3300006028 Bacteria 2472
87 Ga0070716_100002450 3300006173 Bacteria 8558
88 Ga0070716_100021752 3300006173 Bacteria 3382
89 Ga0070716_100042061 3300006173 Bacteria 2549
90 Ga0070716_100405472 3300006173 Bacteria 982
91 Ga0070712_100055355 3300006175 Bacteria 2778
92 Ga0070712_100086357 3300006175 Bacteria 2286
93 Ga0070712_100376940 3300006175 Bacteria 1167
94 Ga0070712_100580590 3300006175 Bacteria 947
95 Ga0070712_100617245 3300006175 Bacteria 919
96 Ga0070712_100634414 3300006175 Unclassified 907
97 Ga0097621_100008208 3300006237 Bacteria 7510
98 Ga0097621_100407201 3300006237 Bacteria 1219
99 Ga0068871_100028586 3300006358 Bacteria 4372
100 Ga0068871_100036124 3300006358 Bacteria 3932
101 Ga0068871_101067715 3300006358 Bacteria 754
102 Ga0075428_100029692 3300006844 Bacteria 6049
103 Ga0075430_100000745 3300006846 Bacteria 25013
104 Ga0075431_100005754 3300006847 Bacteria 12255
105 Ga0075434_100041903 3300006871 Bacteria 4537
106 Ga0075429_100013678 3300006880 Bacteria 7038
107 Ga0075436_100000239 3300006914 Bacteria 34402
108 Ga0075436_100005216 3300006914 Bacteria 8944
109 Ga0075436_100082977 3300006914 Bacteria 2224
110 Ga0075436_100151650 3300006914 Bacteria 1631
111 Ga0075436_100235917 3300006914 Bacteria 1300
112 Ga0075436_100452978 3300006914 Bacteria 934
113 Ga0075436_100468243 3300006914 Bacteria 919
114 Ga0075435_100000273 3300007076 Bacteria 32094
115 Ga0075435_100006896 3300007076 Bacteria 8060
116 Ga0075435_100014951 3300007076 Bacteria 5822
117 Ga0075435_100302064 3300007076 Bacteria 1369
118 Ga0099794_10079505 3300007265 Bacteria 1615
119 Ga0099794_10170826 3300007265 Bacteria 1108
120 Ga0105240_10004821 3300009093 Bacteria 20330
121 Ga0105240_10092509 3300009093 Bacteria 3692
122 Ga0105240_10165455 3300009093 Bacteria 2624
123 Ga0105240_10169530 3300009093 Bacteria 2586
124 Ga0105240_10187771 3300009093 Bacteria 2433
125 Ga0105240_10251937 3300009093 Bacteria 2041
126 Ga0105240_10328021 3300009093 Bacteria 1743
127 Ga0105240_10672519 3300009093 Bacteria 1133
128 Ga0111539_10484478 3300009094 Bacteria 1441
129 Ga0105245_10005309 3300009098 Bacteria 11320
130 Ga0105245_10184932 3300009098 Bacteria 1993
131 Ga0114129_10063552 3300009147 Bacteria 5154
132 Ga0105241_10000090 3300009174 Bacteria 67797
133 Ga0105241_10008829 3300009174 Bacteria 7407
134 Ga0105241_10045018 3300009174 Bacteria 3346
135 Ga0105241_10220149 3300009174 Bacteria 1595
136 Ga0105242_10003716 3300009176 Bacteria 11867
137 Ga0105242_10093647 3300009176 Bacteria 2533
138 Ga0105248_10024923 3300009177 Bacteria 6649
139 Ga0105248_10037068 3300009177 Bacteria 5453
140 Ga0105237_10005259 3300009545 Bacteria 14644
141 Ga0105237_10196430 3300009545 Bacteria 2017
142 Ga0105237_10912679 3300009545 Bacteria 885
143 Ga0105237_11038248 3300009545 Bacteria 826
144 Ga0105238_10000085 3300009551 Bacteria 105043
145 Ga0105238_10066919 3300009551 Bacteria 3593
146 Ga0105238_10107033 3300009551 Bacteria 2777
147 Ga0105238_10291243 3300009551 Bacteria 1615
148 Ga0105238_10601668 3300009551 Bacteria 1107
149 Ga0105238_10842454 3300009551 Bacteria 934
150 Ga0105239_10002114 3300010375 Bacteria 25649
151 Ga0105239_10134056 3300010375 Bacteria 2757
152 Ga0105239_10455909 3300010375 Bacteria 1451
153 Ga0105239_10980007 3300010375 Bacteria 972
154 Ga0105246_10630865 3300011119 Bacteria 930
155 Ga0105246_10693815 3300011119 Bacteria 891
156 Ga0157373_10002325 3300013100 Bacteria 14414
157 Ga0157373_10819545 3300013100 Bacteria 687
158 Ga0157370_10006463 3300013104 Bacteria 12927
159 Ga0157370_10091253 3300013104 Bacteria 2860
160 Ga0157370_10102333 3300013104 Bacteria 2682
161 Ga0157370_10116341 3300013104 Bacteria 2498
162 Ga0157370_11094260 3300013104 Bacteria 720
163 Ga0157369_10005853 3300013105 Bacteria 14285
164 Ga0157369_10018963 3300013105 Bacteria 7705
165 Ga0157369_10020432 3300013105 Bacteria 7402
166 Ga0157369_10021226 3300013105 Bacteria 7261
167 Ga0157369_10044752 3300013105 Bacteria 4816
168 Ga0157369_10152264 3300013105 Bacteria 2444
169 Ga0157369_10377760 3300013105 Unclassified 1471
170 Ga0157374_10054064 3300013296 Bacteria 3745
171 Ga0157374_10062756 3300013296 Bacteria 3484
172 Ga0157374_11362578 3300013296 Unclassified 732
173 Ga0157378_10000469 3300013297 Bacteria 38497
174 Ga0157378_10000695 3300013297 Bacteria 31659
175 Ga0163162_10077082 3300013306 Bacteria 3397
176 Ga0157372_10002806 3300013307 Bacteria 18822
177 Ga0157372_10017805 3300013307 Bacteria 7629
178 Ga0157372_10052397 3300013307 Bacteria 4543
179 Ga0157372_10079368 3300013307 Bacteria 3712
180 Ga0157372_10160595 3300013307 Bacteria 2597
181 Ga0157372_10288274 3300013307 Bacteria 1909
182 Ga0157372_10349148 3300013307 Bacteria 1723
183 Ga0157372_10539069 3300013307 Bacteria 1360
184 Ga0157372_11133212 3300013307 Bacteria 905
185 Ga0157375_10241951 3300013308 Bacteria 1964
186 Ga0157375_11474968 3300013308 Bacteria 802
187 Ga0163163_10013998 3300014325 Bacteria 7360
188 Ga0157379_10118150 3300014968 Bacteria 2385
189 Ga0157376_10074739 3300014969 Bacteria 2890
190 Ga0182005_1023852 3300015265 Bacteria 1671
191 Ga0197907_11125719 3300020069 Unclassified 2134
192 Ga0197907_11146815 3300020069 Bacteria 2619
193 Ga0206356_10350541 3300020070 Bacteria 3018
194 Ga0206356_10737634 3300020070 Unclassified 724
195 Ga0206349_1091959 3300020075 Bacteria 1866
196 Ga0206355_1313323 3300020076 Bacteria 1827
197 Ga0206350_11431835 3300020080 Unclassified 1716
198 Ga0206350_11477667 3300020080 Bacteria 3956
199 Ga0206354_10018810 3300020081 Bacteria 3685
200 Ga0206353_11443818 3300020082 Bacteria 1644
201 Ga0154015_1343831 3300020610 Bacteria 1758
202 Ga0224712_10000733 3300022467 Bacteria 6816
203 Ga0224712_10001177 3300022467 Bacteria 5857
204 Ga0228598_1008742 3300024227 Bacteria 2038
205 Ga0207692_10066150 3300025898 Bacteria 1888
206 Ga0207699_10024372 3300025906 Bacteria 3308
207 Ga0207699_10188734 3300025906 Bacteria 1390
208 Ga0207699_10247249 3300025906 Bacteria 1228
209 Ga0207705_10087304 3300025909 Bacteria 2281
210 Ga0207684_10003023 3300025910 Bacteria 16666
211 Ga0207684_10005482 3300025910 Bacteria 11686
212 Ga0207684_10747876 3300025910 Bacteria 829
213 Ga0207654_10000420 3300025911 Bacteria 24297
214 Ga0207654_10010238 3300025911 Bacteria 4772
215 Ga0207654_10670819 3300025911 Bacteria 743
216 Ga0207707_10013937 3300025912 Bacteria 7009
217 Ga0207707_10064257 3300025912 Bacteria 3194
218 Ga0207707_10138041 3300025912 Bacteria 2132
219 Ga0207707_10233323 3300025912 Bacteria 1601
220 Ga0207707_10563024 3300025912 Bacteria 967
221 Ga0207695_10000154 3300025913 Bacteria 206200
222 Ga0207695_10008214 3300025913 Bacteria 13111
223 Ga0207695_10012094 3300025913 Bacteria 10374
224 Ga0207695_10022657 3300025913 Bacteria 7121
225 Ga0207695_10211819 3300025913 Bacteria 1848
226 Ga0207695_10220772 3300025913 Bacteria 1803
227 Ga0207695_11014174 3300025913 Bacteria 710
228 Ga0207671_10000178 3300025914 Bacteria 96763
229 Ga0207671_10135257 3300025914 Bacteria 1895
230 Ga0207671_10588974 3300025914 Bacteria 886
231 Ga0207693_10006159 3300025915 Bacteria 9950
232 Ga0207693_10009897 3300025915 Bacteria 7754
233 Ga0207693_10493419 3300025915 Bacteria 956
234 Ga0207693_10538572 3300025915 Bacteria 911
235 Ga0207663_10048383 3300025916 Bacteria 2631
236 Ga0207663_10171375 3300025916 Bacteria 1542
237 Ga0207663_10958014 3300025916 Bacteria 685
238 Ga0207657_10003281 3300025919 Bacteria 17313
239 Ga0207649_10007234 3300025920 Bacteria 6031
240 Ga0207649_10390939 3300025920 Bacteria 1039
241 Ga0207652_10015723 3300025921 Bacteria 6164
242 Ga0207652_10105596 3300025921 Bacteria 2492
243 Ga0207652_10133172 3300025921 Unclassified 2218
244 Ga0207646_10057206 3300025922 Bacteria 3484
245 Ga0207646_10183949 3300025922 Bacteria 1887
246 Ga0207694_10000116 3300025924 Bacteria 84418
247 Ga0207694_10081234 3300025924 Bacteria 2546
248 Ga0207694_10216622 3300025924 Bacteria 1561
249 Ga0207694_10982305 3300025924 Bacteria 714
250 Ga0207650_10507311 3300025925 Bacteria 1008
251 Ga0207659_10204588 3300025926 Bacteria 1579
252 Ga0207700_10093106 3300025928 Bacteria 2384
253 Ga0207700_10135961 3300025928 Bacteria 2013
254 Ga0207700_10264181 3300025928 Bacteria 1475
255 Ga0207700_10722935 3300025928 Bacteria 889
256 Ga0207664_10100627 3300025929 Bacteria 2387
257 Ga0207664_10202614 3300025929 Bacteria 1714
258 Ga0207664_10308345 3300025929 Bacteria 1394
259 Ga0207664_10672990 3300025929 Bacteria 930
260 Ga0207664_11164344 3300025929 Bacteria 688
261 Ga0207706_10472472 3300025933 Bacteria 1084
262 Ga0207686_10404566 3300025934 Bacteria 1040
263 Ga0207665_10003702 3300025939 Bacteria 10209
264 Ga0207665_10036130 3300025939 Bacteria 3284
265 Ga0207665_10048569 3300025939 Bacteria 2849
266 Ga0207665_10119953 3300025939 Bacteria 1857
267 Ga0207665_10294943 3300025939 Bacteria 1210
268 Ga0207665_10502213 3300025939 Bacteria 937
269 Ga0207711_10027742 3300025941 Bacteria 4758
270 Ga0207711_10073837 3300025941 Bacteria 2965
271 Ga0207661_10122651 3300025944 Bacteria 2215
272 Ga0207661_10290682 3300025944 Bacteria 1463
273 Ga0207679_11042319 3300025945 Bacteria 750
274 Ga0207667_10013337 3300025949 Bacteria 9409
275 Ga0207667_10028524 3300025949 Bacteria 6062
276 Ga0207667_10071059 3300025949 Bacteria 3621
277 Ga0207667_10216878 3300025949 Bacteria 1961
278 Ga0207667_10962111 3300025949 Bacteria 843
279 Ga0207667_11233411 3300025949 Unclassified 726
280 Ga0207640_10163150 3300025981 Bacteria 1651
281 Ga0207703_10913652 3300026035 Bacteria 841
282 Ga0207639_10000204 3300026041 Bacteria 44859
283 Ga0207702_10030792 3300026078 Bacteria 4470
284 Ga0207702_10074826 3300026078 Bacteria 2924
285 Ga0207702_10242691 3300026078 Bacteria 1688
286 Ga0207641_10264934 3300026088 Bacteria 1610
287 Ga0207648_10194519 3300026089 Unclassified 1798
288 Ga0207674_10045477 3300026116 Bacteria 4515
289 Ga0207674_10200263 3300026116 Bacteria 1946
290 Ga0207683_10305602 3300026121 Bacteria 1455
291 Ga0207698_10005598 3300026142 Bacteria 7775
292 Ga0209588_1079875 3300027671 Bacteria 1056
293 Ga0207428_10094748 3300027907 Bacteria 2314
294 Ga0268264_10034544 3300028381 Bacteria 4160
295 Ga0268264_10765436 3300028381 Bacteria 963
296 Ga0265325_10230687 3300031241 Bacteria 844
297 Ga0265327_10063159 3300031251 Bacteria 1882
298 Ga0373923_0210749 3300035111 Bacteria 901
299 Ga0373936_0003928 3300035113 Bacteria 5597
300 Ga0373943_0031651 3300035170 Bacteria 2511
301 Ga0373931_0121702 3300035691 Bacteria 1492
302 Ga0373935_0007873 3300035692 Bacteria 6390
303 Ga0373935_0132496 3300035692 Bacteria 1676
304 Ga0373935_0551916 3300035692 Unclassified 840
305 Ga0373927_0052059 3300035695 Bacteria 2648
306 Ga0373927_0079167 3300035695 Bacteria 2129
307 Ga0373927_0427554 3300035695 Bacteria 874
308 Ga0373947_0006416 3300035725 Bacteria 6835
309 Ga0373947_0614096 3300035725 Bacteria 741
310 Ga0373937_1171607 3300036401 Bacteria 717
311 Ga0373925_0053170 3300037068 Bacteria 3026
312 Ga0395900_0107641 3300037418 Bacteria 2864
313 Ga0395900_0466663 3300037418 Bacteria 1216
314 Ga0395905_0202662 3300037471 Unclassified 1860
315 Ga0436364_1017896 3300037853 Bacteria 1456
316 Ga0395901_0544156 3300038443 Unclassified 1177
317 Ga0395901_0702398 3300038443 Bacteria 1009
318 Ga0436363_0024374 3300039450 Bacteria 2422
319 Ga0436362_0303813 3300039453 Bacteria 1259
320 Ga0466961_0034824 3300044693 Bacteria 3233
321 Ga0466963_0011915 3300044694 Bacteria 5310
322 Ga0466964_0323426 3300044706 Unclassified 784
323 Ga0466957_0280551 3300044842 Bacteria 1115
324 Ga0466959_0100692 3300045049 Bacteria 2068
325 Ga0451576_0981879 3300045051 Bacteria 885
326 Ga0466958_0260738 3300045836 Bacteria 1109
327 Ga0466967_0560278 3300045976 Bacteria 1125
328 Ga0466967_0771202 3300045976 Bacteria 954
329 Ga0466967_1025599 3300045976 Bacteria 822
330 Ga0495580_0003012 3300046472 Bacteria 14440
331 Ga0495580_0005696 3300046472 Bacteria 10247
332 Ga0495580_0047599 3300046472 Bacteria 3039
333 Ga0495580_0073503 3300046472 Bacteria 2387
334 Ga0495580_0169723 3300046472 Bacteria 1509
335 Ga0495582_0002062 3300046473 Bacteria 11246
336 Ga0495584_0031437 3300046491 Bacteria 2687
337 Ga0495666_0078095 3300046526 Bacteria 1568
338 Ga0495666_0185441 3300046526 Bacteria 960
339 Ga0495665_0035047 3300046531 Bacteria 2682
340 Ga0495623_0095668 3300046679 Unclassified 1816
341 Ga0495623_0104611 3300046679 Bacteria 1721
342 Ga0495669_0005674 3300046684 Bacteria 5205
343 Ga0495669_0013344 3300046684 Bacteria 3500
344 Ga0495624_0462971 3300046690 Bacteria 759
345 Ga0495674_0523866 3300047319 Bacteria 946
346 Ga0495602_0340256 3300048088 Bacteria 1085
347 Ga0496102_0006964 3300048905 Bacteria 9647
348 Ga0496102_0684167 3300048905 Bacteria 949
349 Ga0496104_0314404 3300048907 Bacteria 1479
350 Ga0496104_0441047 3300048907 Bacteria 1214
351 Ga0496104_0444624 3300048907 Bacteria 1208
352 Ga0496107_0018063 3300048910 Bacteria 4962
353 Ga0496109_0043645 3300048912 Bacteria 4065
354 Ga0496109_0431273 3300048912 Bacteria 1245
355 Ga0496112_0013070 3300048915 Bacteria 7659
356 Ga0496112_0028813 3300048915 Bacteria 5364
357 Ga0496112_0041120 3300048915 Bacteria 4522
358 Ga0496112_0054336 3300048915 Unclassified 3935
359 Ga0496112_0107673 3300048915 Bacteria 2757
360 Ga0496112_0368966 3300048915 Bacteria 1377
361 Ga0496113_0449519 3300048916 Unclassified 1035
362 Ga0496113_0985071 3300048916 Bacteria 664
363 Ga0496113_0992064 3300048916 Bacteria 662
364 Ga0501068_0480794 3300049584 Bacteria 805
365 Ga0501071_0172807 3300049587 Bacteria 1618
366 Ga0501073_0029356 3300049589 Bacteria 3931
367 Ga0501074_0313528 3300049590 Bacteria 1114
368 Ga0501201_014565 3300049651 Bacteria 795
369 Ga0501080_0104116 3300049742 Bacteria 2632
370 Ga0501083_0432529 3300049744 Bacteria 856
371 nmdc:mga05p37_3922_c1 3300050507 Bacteria 17427
372 nmdc:mga09592_48092_c1 3300050508 Bacteria 3595
373 nmdc:mga0qj67_83962_c1 3300050509 Bacteria 2554
374 nmdc:mga06r32_161806_c1 3300050510 Bacteria 2221
375 nmdc:mga0n895_303_c1 3300050512 Bacteria 32623
376 nmdc:mga0n895_40126_c1 3300050512 Bacteria 4546
377 nmdc:mga0n895_432358_c1 3300050512 Bacteria 1330
378 nmdc:mga0rr50_14220_c1 3300050513 Bacteria 5212
379 nmdc:mga0rr50_252_c1 3300050513 Bacteria 29099
380 nmdc:mga0rr50_41595_c1 3300050513 Bacteria 3350
381 nmdc:mga08x19_1031_c1 3300050514 Bacteria 17404
382 nmdc:mga08x19_107769_c1 3300050514 Bacteria 1855
383 nmdc:mga08x19_1355_c1 3300050514 Bacteria 15184
384 nmdc:mga08x19_21348_c1 3300050514 Bacteria 3996
385 nmdc:mga08x19_32598_c1 3300050514 Bacteria 3285
386 nmdc:mga08x19_41193_c1 3300050514 Bacteria 2941
387 nmdc:mga08x19_424249_c1 3300050514 Bacteria 934
388 nmdc:mga0a205_27275_c1 3300050515 Bacteria 5454
389 nmdc:mga0a205_780996_c1 3300050515 Bacteria 803
390 Ga0495612_0091226 3300053078 Bacteria 1290
391 Ga0501084_0505702 3300054114 Bacteria 1021
392 Ga0587082_024870 3300059504 Unclassified 1003
393 Ga0587089_003209 3300059509 Unclassified 1721
394 Ga0587128_041074 3300059630 Bacteria 809
395 Ga0587072_007499 3300059643 Bacteria 1699
396 Ga0587075_049091 3300059644 Unclassified 731
397 Ga0466962_0055832 3300061719 Bacteria 1887
398 Ga0495642_0254989
399 Ga0058863_11903939
400 Ga0058861_11682047
401 Ga0058862_12760179
402 Ga0065715_10148879
403 Ga0070658_10085651
404 Ga0070683_100166457
405 Ga0070683_100508611
406 Ga0070690_100409716
407 Ga0070670_100388773
408 Ga0070680_100024417
409 Ga0070680_100044221
410 Ga0068868_100012438
411 Ga0070660_100002780
412 Ga0070661_100010895
413 Ga0070661_100457331
414 Ga0070675_100073788
415 Ga0070667_100501011
416 Ga0070709_10027662
417 Ga0070709_10402190
418 Ga0070714_100193458
419 Ga0070714_100375745
420 Ga0070714_100521457
421 Ga0070714_101018866
422 Ga0070713_100005930
423 Ga0070713_100013782
424 Ga0070713_100033246
425 Ga0070713_100722361
426 Ga0070710_10005337
427 Ga0070711_100023789
428 Ga0070711_100086945
429 Ga0070711_100124519
430 Ga0070681_10017810
431 Ga0070681_10114272
432 Ga0070681_10119098
433 Ga0070681_10164593
434 Ga0070706_100000797
435 Ga0070706_100003249
436 Ga0070707_100033913
437 Ga0070707_100060124
438 Ga0070698_100002901
439 Ga0070699_100086276
440 Ga0070699_100100338
441 Ga0070679_100007551
442 Ga0070679_100034548
443 Ga0070679_100057177
444 Ga0070679_100362701
445 Ga0070684_100420140
446 Ga0070684_100970944
447 Ga0070697_100000161
448 Ga0070697_100000636
449 Ga0070697_100722169
450 Ga0068853_100127330
451 Ga0070686_100092008
452 Ga0070696_100398437
453 Ga0070696_100441541
454 Ga0070704_100062884
455 Ga0068855_100009164
456 Ga0068855_100017153
457 Ga0068855_100078075
458 Ga0068855_100160758
459 Ga0068855_100248693
460 Ga0070664_100547255
461 Ga0068857_100008468
462 Ga0068857_100073842
463 Ga0068857_100091595
464 Ga0068857_100115159
465 Ga0068857_100878059
466 Ga0068854_100038033
467 Ga0068854_100109680
468 Ga0068854_100252772
469 Ga0068856_100000875
470 Ga0068856_100004375
471 Ga0068856_100086873
472 Ga0068856_100429688
473 Ga0068856_100757781
474 Ga0068856_100826774
475 Ga0068852_100000567
476 Ga0068863_100007685
477 Ga0068860_100007988
478 Ga0081540_1000160
479 Ga0081540_1109200
480 Ga0070717_10001450
481 Ga0070717_10011779
482 Ga0070717_10078681
483 Ga0070717_10099051
484 Ga0070716_100002450
485 Ga0070716_100021752
486 Ga0070716_100042061
487 Ga0070716_100405472
488 Ga0070712_100055355
489 Ga0070712_100086357
490 Ga0070712_100376940
491 Ga0070712_100580590
492 Ga0070712_100617245
493 Ga0070712_100634414
494 Ga0097621_100008208
495 Ga0097621_100407201
496 Ga0068871_100028586
497 Ga0068871_100036124
498 Ga0068871_101067715
499 Ga0075428_100029692
500 Ga0075430_100000745
501 Ga0075431_100005754
502 Ga0075434_100041903
503 Ga0075429_100013678
504 Ga0075436_100000239
505 Ga0075436_100005216
506 Ga0075436_100082977
507 Ga0075436_100151650
508 Ga0075436_100235917
509 Ga0075436_100452978
510 Ga0075436_100468243
511 Ga0075435_100000273
512 Ga0075435_100006896
513 Ga0075435_100014951
514 Ga0075435_100302064
515 Ga0099794_10079505
516 Ga0099794_10170826
517 Ga0105240_10004821
518 Ga0105240_10092509
519 Ga0105240_10165455
520 Ga0105240_10169530
521 Ga0105240_10187771
522 Ga0105240_10251937
523 Ga0105240_10328021
524 Ga0105240_10672519
525 Ga0111539_10484478
526 Ga0105245_10005309
527 Ga0105245_10184932
528 Ga0114129_10063552
529 Ga0105241_10000090
530 Ga0105241_10008829
531 Ga0105241_10045018
532 Ga0105241_10220149
533 Ga0105242_10003716
534 Ga0105242_10093647
535 Ga0105248_10024923
536 Ga0105248_10037068
537 Ga0105237_10005259
538 Ga0105237_10196430
539 Ga0105237_10912679
540 Ga0105237_11038248
541 Ga0105238_10000085
542 Ga0105238_10066919
543 Ga0105238_10107033
544 Ga0105238_10291243
545 Ga0105238_10601668
546 Ga0105238_10842454
547 Ga0105239_10002114
548 Ga0105239_10134056
549 Ga0105239_10455909
550 Ga0105239_10980007
551 Ga0105246_10630865
552 Ga0105246_10693815
553 Ga0157373_10002325
554 Ga0157373_10819545
555 Ga0157370_10006463
556 Ga0157370_10091253
557 Ga0157370_10102333
558 Ga0157370_10116341
559 Ga0157370_11094260
560 Ga0157369_10005853
561 Ga0157369_10018963
562 Ga0157369_10020432
563 Ga0157369_10021226
564 Ga0157369_10044752
565 Ga0157369_10152264
566 Ga0157369_10377760
567 Ga0157374_10054064
568 Ga0157374_10062756
569 Ga0157374_11362578
570 Ga0157378_10000469
571 Ga0157378_10000695
572 Ga0163162_10077082
573 Ga0157372_10002806
574 Ga0157372_10017805
575 Ga0157372_10052397
576 Ga0157372_10079368
577 Ga0157372_10160595
578 Ga0157372_10288274
579 Ga0157372_10349148
580 Ga0157372_10539069
581 Ga0157372_11133212
582 Ga0157375_10241951
583 Ga0157375_11474968
584 Ga0163163_10013998
585 Ga0157379_10118150
586 Ga0157376_10074739
587 Ga0182005_1023852
588 Ga0197907_11125719
589 Ga0197907_11146815
590 Ga0206356_10350541
591 Ga0206356_10737634
592 Ga0206349_1091959
593 Ga0206355_1313323
594 Ga0206350_11431835
595 Ga0206350_11477667
596 Ga0206354_10018810
597 Ga0206353_11443818
598 Ga0154015_1343831
599 Ga0224712_10000733
600 Ga0224712_10001177
601 Ga0228598_1008742
602 Ga0207692_10066150
603 Ga0207699_10024372
604 Ga0207699_10188734
605 Ga0207699_10247249
606 Ga0207705_10087304
607 Ga0207684_10003023
608 Ga0207684_10005482
609 Ga0207684_10747876
610 Ga0207654_10000420
611 Ga0207654_10010238
612 Ga0207654_10670819
613 Ga0207707_10013937
614 Ga0207707_10064257
615 Ga0207707_10138041
616 Ga0207707_10233323
617 Ga0207707_10563024
618 Ga0207695_10000154
619 Ga0207695_10008214
620 Ga0207695_10012094
621 Ga0207695_10022657
622 Ga0207695_10211819
623 Ga0207695_10220772
624 Ga0207695_11014174
625 Ga0207671_10000178
626 Ga0207671_10135257
627 Ga0207671_10588974
628 Ga0207693_10006159
629 Ga0207693_10009897
630 Ga0207693_10493419
631 Ga0207693_10538572
632 Ga0207663_10048383
633 Ga0207663_10171375
634 Ga0207663_10958014
635 Ga0207657_10003281
636 Ga0207649_10007234
637 Ga0207649_10390939
638 Ga0207652_10015723
639 Ga0207652_10105596
640 Ga0207652_10133172
641 Ga0207646_10057206
642 Ga0207646_10183949
643 Ga0207694_10000116
644 Ga0207694_10081234
645 Ga0207694_10216622
646 Ga0207694_10982305
647 Ga0207650_10507311
648 Ga0207659_10204588
649 Ga0207700_10093106
650 Ga0207700_10135961
651 Ga0207700_10264181
652 Ga0207700_10722935
653 Ga0207664_10100627
654 Ga0207664_10202614
655 Ga0207664_10308345
656 Ga0207664_10672990
657 Ga0207664_11164344
658 Ga0207706_10472472
659 Ga0207686_10404566
660 Ga0207665_10003702
661 Ga0207665_10036130
662 Ga0207665_10048569
663 Ga0207665_10119953
664 Ga0207665_10294943
665 Ga0207665_10502213
666 Ga0207711_10027742
667 Ga0207711_10073837
668 Ga0207661_10122651
669 Ga0207661_10290682
670 Ga0207679_11042319
671 Ga0207667_10013337
672 Ga0207667_10028524
673 Ga0207667_10071059
674 Ga0207667_10216878
675 Ga0207667_10962111
676 Ga0207667_11233411
677 Ga0207640_10163150
678 Ga0207703_10913652
679 Ga0207639_10000204
680 Ga0207702_10030792
681 Ga0207702_10074826
682 Ga0207702_10242691
683 Ga0207641_10264934
684 Ga0207648_10194519
685 Ga0207674_10045477
686 Ga0207674_10200263
687 Ga0207683_10305602
688 Ga0207698_10005598
689 Ga0209588_1079875
690 Ga0207428_10094748
691 Ga0268264_10034544
692 Ga0268264_10765436
693 Ga0265325_10230687
694 Ga0265327_10063159
695 Ga0373923_0210749
696 Ga0373936_0003928
697 Ga0373943_0031651
698 Ga0373931_0121702
699 Ga0373935_0007873
700 Ga0373935_0132496
701 Ga0373935_0551916
702 Ga0373927_0052059
703 Ga0373927_0079167
704 Ga0373927_0427554
705 Ga0373947_0006416
706 Ga0373947_0614096
707 Ga0373937_1171607
708 Ga0373925_0053170
709 Ga0395900_0107641
710 Ga0395900_0466663
711 Ga0395905_0202662
712 Ga0436364_1017896
713 Ga0395901_0544156
714 Ga0395901_0702398
715 Ga0436363_0024374
716 Ga0436362_0303813
717 Ga0466961_0034824
718 Ga0466963_0011915
719 Ga0466964_0323426
720 Ga0466957_0280551
721 Ga0466959_0100692
722 Ga0451576_0981879
723 Ga0466958_0260738
724 Ga0466967_0560278
725 Ga0466967_0771202
726 Ga0466967_1025599
727 Ga0495580_0003012
728 Ga0495580_0005696
729 Ga0495580_0047599
730 Ga0495580_0073503
731 Ga0495580_0169723
732 Ga0495582_0002062
733 Ga0495584_0031437
734 Ga0495666_0078095
735 Ga0495666_0185441
736 Ga0495665_0035047
737 Ga0495623_0095668
738 Ga0495623_0104611
739 Ga0495669_0005674
740 Ga0495669_0013344
741 Ga0495624_0462971
742 Ga0495674_0523866
743 Ga0495602_0340256
744 Ga0496102_0006964
745 Ga0496102_0684167
746 Ga0496104_0314404
747 Ga0496104_0441047
748 Ga0496104_0444624
749 Ga0496107_0018063
750 Ga0496109_0043645
751 Ga0496109_0431273
752 Ga0496112_0013070
753 Ga0496112_0028813
754 Ga0496112_0041120
755 Ga0496112_0054336
756 Ga0496112_0107673
757 Ga0496112_0368966
758 Ga0496113_0449519
759 Ga0496113_0985071
760 Ga0496113_0992064
761 Ga0501068_0480794
762 Ga0501071_0172807
763 Ga0501073_0029356
764 Ga0501074_0313528
765 Ga0501201_014565
766 Ga0501080_0104116
767 Ga0501083_0432529
768 nmdc:mga05p37_3922_c1
769 nmdc:mga09592_48092_c1
770 nmdc:mga0qj67_83962_c1
771 nmdc:mga06r32_161806_c1
772 nmdc:mga0n895_303_c1
773 nmdc:mga0n895_40126_c1
774 nmdc:mga0n895_432358_c1
775 nmdc:mga0rr50_14220_c1
776 nmdc:mga0rr50_252_c1
777 nmdc:mga0rr50_41595_c1
778 nmdc:mga08x19_1031_c1
779 nmdc:mga08x19_107769_c1
780 nmdc:mga08x19_1355_c1
781 nmdc:mga08x19_21348_c1
782 nmdc:mga08x19_32598_c1
783 nmdc:mga08x19_41193_c1
784 nmdc:mga08x19_424249_c1
785 nmdc:mga0a205_27275_c1
786 nmdc:mga0a205_780996_c1
787 Ga0495612_0091226
788 Ga0501084_0505702
789 Ga0587082_024870
790 Ga0587089_003209
791 Ga0587128_041074
792 Ga0587072_007499
793 Ga0587075_049091
794 Ga0466962_0055832

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04879

Molybdop_Fe4S4

Molybdopterin oxidoreductase Fe4S4 domain

67

121

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1gpm-assembly1.cif.gz_D escherichia coli gmp synthetase complexed with amp and pyrophosphate 0.5791 152 185
2vpw-assembly1.cif.gz_E polysulfide reductase with bound menaquinone 0.5784 35 135
7bkb-assembly1.cif.gz_D formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (hexameric, composite structure) 0.5499 41 136
6cz7-assembly1.cif.gz_A the arsenate respiratory reductase (arr) complex from shewanella sp. ana-3 0.5335 36 134
4bxo-assembly1.cif.gz_B architecture and dna recognition elements of the fanconi anemia fancm- faap24 complex 0.5222 125 185
ID Description Score Start End Superfamily
2v45A01 Mainly Beta;Single Sheet;N-terminal domain of TfIIb;ADC-like domains 0.8299 40 96 2.20.25.90
2iv2X01 Mainly Beta;Single Sheet;N-terminal domain of TfIIb;ADC-like domains 0.8271 42 95 2.20.25.90
1kqfA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7917 98 177 3.40.50.740
2iv2X01 Mainly Beta;Single Sheet;N-terminal domain of TfIIb;ADC-like domains 0.789 42 95 2.20.25.90
2v45A01 Mainly Beta;Single Sheet;N-terminal domain of TfIIb;ADC-like domains 0.7706 40 96 2.20.25.90
ID Description Score Start End GO Terms
AF-A0A538NIW9-F1-model_v4 Dehydrogenase 0.8916 27 95 GO:0009055
GO:0009061
GO:0016491
GO:0030151
GO:0030313
GO:0051539
AF-A0A538NIW9-F1-model_v4 Dehydrogenase 0.88 27 95 GO:0009055
GO:0009061
GO:0016491
GO:0030151
GO:0030313
GO:0051539
AF-A0A356Z4Z0-F1-model_v4 Dehydrogenase 0.7881 41 110 GO:0016491
GO:0030313
GO:0046872
GO:0051539
AF-A0A2U8DUU9-F1-model_v4 4Fe-4S Mo/W bis-MGD-type domain-containing protein 0.7862 41 107 GO:0016491
GO:0030313
GO:0046872
GO:0051539
AF-A0A7W1LZ31-F1-model_v4 4Fe-4S Mo/W bis-MGD-type domain-containing protein 0.7756 41 106 GO:0016491
GO:0030313
GO:0046872
GO:0051539

Map