F433845

General Info

Members Datasets Scaffolds Average Seq Length
397 232 794 207

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0004111|Ga0466969_0004111_2213_2887
Length 224
Sequence MRTKKTFAAAVLLATAALTLTACGSGESGDKPVAVVSAEPGSDKAGTVLDQPFEKPDLVLTDTHGKKYDLRAETKGKPTLVYFGYTHCPDVCPLTMNNLAVAKKEVDKSKQLTQAQKDSLRIVFVTTDPERDTPSALGAWLKGIDPSIVGLTGDFSTIQAGARTLGISIEAPKKEKDGKIVSTHGTQVIAFSPKTDGGYVVYGQDATVDDYIRDIPKIIKGENP

Samples

Sample ID Description Type Environment
1 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
10 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
13 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
14 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
15 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
16 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
17 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
18 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
19 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
20 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
21 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
22 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
23 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
24 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
25 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
38 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
39 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
40 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
41 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
42 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
43 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
44 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
45 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
46 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
47 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
48 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
49 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
50 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
51 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
52 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
53 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
54 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
55 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
56 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
57 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
58 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
59 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
60 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
61 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
62 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
63 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
64 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
65 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
66 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
67 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
68 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
69 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
70 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
71 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
72 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
73 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
74 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
75 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
76 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
77 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
78 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
79 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
80 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
81 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
82 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
83 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
84 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
85 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
86 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
87 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
88 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
89 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
90 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
91 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
92 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
93 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
94 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
95 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
96 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
97 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
98 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
99 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
100 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
101 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
102 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
103 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
104 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
105 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
106 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
107 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
108 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
109 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
110 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
111 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
112 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
113 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
114 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
115 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
116 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
117 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
118 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
119 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
120 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
121 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
122 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
123 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
124 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
125 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
126 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
127 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
128 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
129 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
130 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
131 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
132 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
133 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
134 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
135 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
136 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
137 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
138 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
139 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
140 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
141 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
142 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
143 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
144 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
145 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
146 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
147 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
148 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
149 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
150 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
165 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
166 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
167 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
168 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
169 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
170 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
171 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
172 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
173 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
174 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
175 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
178 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
179 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
180 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
181 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
182 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
183 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
184 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
185 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
186 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
187 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
188 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
189 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
190 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
191 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
192 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
193 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
194 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
195 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
196 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
197 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
198 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
199 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
200 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
201 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
202 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
203 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
204 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
205 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
206 2643221647 Streptomyces sp. Root369 Isolate Unclassified
207 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
208 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
209 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
210 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
211 2867428634 Streptomyces sp. RP5T Isolate Unclassified
212 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
213 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
214 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
215 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
216 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
217 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
218 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
219 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
220 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
221 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
222 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
223 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
224 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
225 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
226 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
227 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
228 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
229 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
230 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
231 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
232 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.44
Metatranscriptomes 0
Isolates 7.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.8
Nodule 0
Rhizoplane 0.25
Rhizosphere 81.36
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466969_0004111 3300044656 Bacteria 7724
2 JGI24737J22298_10012057 3300001990 Bacteria 2822
3 JGI25153J46596_10056050 3300003215 Bacteria 1099
4 rootH1_10066173 3300003316 Bacteria 2181
5 rootH2_10026446 3300003320 Bacteria 3893
6 rootL2_10052478 3300003322 Bacteria 6290
7 rootH1_10019622 3300003323 Bacteria 11458
8 Ga0070670_100203329 3300005331 Bacteria 1721
9 Ga0070665_100047987 3300005548 Bacteria 4287
10 Ga0070665_100924348 3300005548 Bacteria 885
11 Ga0068854_100465801 3300005578 Bacteria 1058
12 Ga0068856_100576996 3300005614 Bacteria 1146
13 Ga0070715_10281277 3300006163 Bacteria 882
14 Ga0075367_10019974 3300006178 Bacteria 3724
15 Ga0105251_10024482 3300009011 Bacteria 3099
16 Ga0105245_10093383 3300009098 Bacteria 2772
17 Ga0105248_10055762 3300009177 Bacteria 4433
18 Ga0105237_10859813 3300009545 Bacteria 914
19 Ga0105238_11155979 3300009551 Bacteria 798
20 Ga0105246_10006769 3300011119 Bacteria 7010
21 Ga0105246_10539842 3300011119 Bacteria 997
22 Ga0157372_10116507 3300013307 Bacteria 3064
23 Ga0182007_10000971 3300015262 Bacteria 15743
24 Ga0182005_1043545 3300015265 Bacteria 1220
25 Ga0209758_1001599 3300025297 Bacteria 25885
26 Ga0207426_1013834 3300025302 Bacteria 2974
27 Ga0207713_1029093 3300025735 Bacteria 2481
28 Ga0207647_10075853 3300025904 Bacteria 2023
29 Ga0207671_10583326 3300025914 Bacteria 891
30 Ga0207657_10492713 3300025919 Bacteria 960
31 Ga0207650_10236616 3300025925 Bacteria 1475
32 Ga0207709_10295481 3300025935 Bacteria 1202
33 Ga0207691_10273029 3300025940 Bacteria 1455
34 Ga0207711_10122625 3300025941 Bacteria 2322
35 Ga0207702_10495564 3300026078 Bacteria 1190
36 Ga0207674_10937908 3300026116 Bacteria 834
37 Ga0207683_10720035 3300026121 Bacteria 925
38 Ga0207698_11394807 3300026142 Bacteria 716
39 Ga0209371_1007484 3300027312 Bacteria 3794
40 Ga0209813_10059446 3300027866 Bacteria 1217
41 Ga0307517_10003138 3300028786 Bacteria 26000
42 Ga0307517_10015116 3300028786 Bacteria 10284
43 Ga0307517_10399188 3300028786 Bacteria 728
44 Ga0307515_10006981 3300028794 Bacteria 22422
45 Ga0307515_10065396 3300028794 Bacteria 5062
46 Ga0268256_1007712 3300030500 Bacteria 3794
47 Ga0268256_1024452 3300030500 Bacteria 1550
48 Ga0307511_10000978 3300030521 Bacteria 30359
49 Ga0307511_10168259 3300030521 Bacteria 1211
50 Ga0307512_10011939 3300030522 Bacteria 8211
51 Ga0307512_10017654 3300030522 Bacteria 6537
52 Ga0307513_10028788 3300031456 Bacteria 6345
53 Ga0307513_10263727 3300031456 Bacteria 1510
54 Ga0307509_10017538 3300031507 Bacteria 8234
55 Ga0307509_10138904 3300031507 Bacteria 2370
56 Ga0307508_10004885 3300031616 Bacteria 12897
57 Ga0307508_10019966 3300031616 Bacteria 6087
58 Ga0307508_10035638 3300031616 Bacteria 4483
59 Ga0307508_10250691 3300031616 Bacteria 1366
60 Ga0307514_10034545 3300031649 Bacteria 4029
61 Ga0307514_10208464 3300031649 Bacteria 1217
62 Ga0307516_10057137 3300031730 Bacteria 3802
63 Ga0307516_10093982 3300031730 Bacteria 2823
64 Ga0307518_10036833 3300031838 Bacteria 3555
65 Ga0307518_10089428 3300031838 Bacteria 2217
66 Ga0307518_10091945 3300031838 Bacteria 2182
67 Ga0307416_100200537 3300032002 Bacteria 1893
68 Ga0307507_10073501 3300033179 Bacteria 3073
69 Ga0307507_10098187 3300033179 Bacteria 2467
70 Ga0307510_10016551 3300033180 Bacteria 8704
71 Ga0307510_10247276 3300033180 Bacteria 1273
72 Ga0307510_10250359 3300033180 Bacteria 1260
73 Ga0307510_10276455 3300033180 Bacteria 1152
74 Ga0395898_0031182 3300037466 Bacteria 5329
75 Ga0395898_0035639 3300037466 Bacteria 4945
76 Ga0395901_0147745 3300038443 Bacteria 2470
77 Ga0451807_1595658 3300041486 Bacteria 880
78 Ga0451853_3774284 3300041512 Bacteria 1001
79 Ga0439448_0002548 3300042005 Bacteria 4966
80 Ga0439448_0053216 3300042005 Bacteria 1328
81 Ga0439455_0024410 3300042012 Bacteria 1462
82 Ga0439462_0024207 3300042015 Bacteria 1593
83 Ga0450903_000389 3300042138 Bacteria 9499
84 Ga0439458_0004783 3300042157 Bacteria 3079
85 Ga0466969_0225284 3300044656 Bacteria 852
86 Ga0466972_0001117 3300044658 Bacteria 12859
87 Ga0466972_0004269 3300044658 Bacteria 7139
88 Ga0466972_0004794 3300044658 Bacteria 6779
89 Ga0466965_0004501 3300044683 Bacteria 6205
90 Ga0466965_0118403 3300044683 Bacteria 1366
91 Ga0466966_0004094 3300044684 Bacteria 9625
92 Ga0466961_0004453 3300044693 Bacteria 8774
93 Ga0466961_0017283 3300044693 Bacteria 4631
94 Ga0466961_0018499 3300044693 Bacteria 4482
95 Ga0466963_0005679 3300044694 Bacteria 7327
96 Ga0466963_0005879 3300044694 Bacteria 7231
97 Ga0466963_0438166 3300044694 Bacteria 922
98 Ga0466964_0018339 3300044706 Bacteria 2685
99 Ga0466964_0265128 3300044706 Bacteria 852
100 Ga0466964_0319808 3300044706 Bacteria 788
101 Ga0466971_0001873 3300044719 Bacteria 8940
102 Ga0466971_0167547 3300044719 Bacteria 1030
103 Ga0466971_0256800 3300044719 Bacteria 833
104 Ga0466968_0055195 3300044735 Bacteria 1704
105 Ga0466970_0002851 3300044765 Bacteria 8351
106 Ga0466970_0022525 3300044765 Bacteria 3287
107 Ga0466957_0001114 3300044842 Bacteria 13915
108 Ga0466960_0009654 3300044901 Bacteria 3985
109 Ga0466960_0275464 3300044901 Bacteria 942
110 Ga0466959_0042936 3300045049 Bacteria 3334
111 Ga0466958_0009069 3300045836 Bacteria 5526
112 Ga0466967_0000653 3300045976 Bacteria 17417
113 Ga0466967_0013524 3300045976 Bacteria 6311
114 Ga0495627_009537 3300046453 Bacteria 3567
115 Ga0495592_0036216 3300046454 Bacteria 3717
116 Ga0495592_0036325 3300046454 Bacteria 3711
117 Ga0495603_0004095 3300046455 Bacteria 8686
118 Ga0495603_0036071 3300046455 Bacteria 2968
119 Ga0495603_0076178 3300046455 Bacteria 1968
120 Ga0495603_0097492 3300046455 Bacteria 1717
121 Ga0495590_0058667 3300046457 Bacteria 1346
122 Ga0495629_0007326 3300046459 Bacteria 8133
123 Ga0495629_0013070 3300046459 Bacteria 5999
124 Ga0495629_0018343 3300046459 Bacteria 5009
125 Ga0495629_0021235 3300046459 Bacteria 4634
126 Ga0495629_0030560 3300046459 Bacteria 3818
127 Ga0495629_0033266 3300046459 Bacteria 3647
128 Ga0495629_0041001 3300046459 Bacteria 3257
129 Ga0495629_0353544 3300046459 Bacteria 1002
130 Ga0495638_0032398 3300046460 Bacteria 3350
131 Ga0495641_0102776 3300046461 Bacteria 1275
132 Ga0495580_0309628 3300046472 Bacteria 1074
133 Ga0495582_0094838 3300046473 Bacteria 1666
134 Ga0495605_0010457 3300046474 Bacteria 5189
135 Ga0495639_0003339 3300046475 Bacteria 6958
136 Ga0495662_0002609 3300046476 Bacteria 9112
137 Ga0495662_0052740 3300046476 Bacteria 1963
138 Ga0495664_0000329 3300046477 Bacteria 22872
139 Ga0495664_0090324 3300046477 Bacteria 1841
140 Ga0495585_0024836 3300046492 Bacteria 3435
141 Ga0495594_0019723 3300046499 Bacteria 3586
142 Ga0495594_0037835 3300046499 Bacteria 2633
143 Ga0495596_0196296 3300046500 Bacteria 784
144 Ga0495607_0035327 3300046501 Bacteria 3024
145 Ga0495583_0046367 3300046506 Bacteria 2004
146 Ga0495606_0012682 3300046507 Bacteria 6728
147 Ga0495610_0052897 3300046512 Bacteria 1969
148 Ga0495616_0017339 3300046513 Bacteria 3973
149 Ga0495618_0068205 3300046514 Bacteria 2262
150 Ga0495618_0080039 3300046514 Bacteria 2084
151 Ga0495620_0019982 3300046515 Bacteria 3279
152 Ga0495628_0020328 3300046516 Bacteria 5479
153 Ga0495628_0075516 3300046516 Bacteria 2624
154 Ga0495628_0193676 3300046516 Bacteria 1534
155 Ga0495632_0051647 3300046519 Bacteria 2023
156 Ga0495643_0003895 3300046522 Bacteria 10712
157 Ga0495643_0006952 3300046522 Bacteria 7358
158 Ga0495648_0015773 3300046524 Bacteria 5467
159 Ga0495666_0008302 3300046526 Bacteria 5203
160 Ga0495666_0192858 3300046526 Bacteria 938
161 Ga0495652_0192252 3300046529 Bacteria 1556
162 Ga0495654_0057772 3300046530 Bacteria 1873
163 Ga0495665_0107043 3300046531 Bacteria 1467
164 Ga0495640_0008195 3300046533 Bacteria 8204
165 Ga0495640_0008902 3300046533 Bacteria 7839
166 Ga0495640_0503889 3300046533 Bacteria 736
167 Ga0495587_0006390 3300046536 Bacteria 7686
168 Ga0495609_0016573 3300046538 Bacteria 3433
169 Ga0495645_0004878 3300046543 Bacteria 9172
170 Ga0495622_0011519 3300046557 Bacteria 4086
171 Ga0495633_0007683 3300046558 Bacteria 6170
172 Ga0495667_0061709 3300046559 Bacteria 2457
173 Ga0495656_0009189 3300046615 Bacteria 3551
174 Ga0495634_0007221 3300046642 Bacteria 8375
175 Ga0495634_0063724 3300046642 Bacteria 2445
176 Ga0495634_0089812 3300046642 Bacteria 1996
177 Ga0495625_0007588 3300046660 Bacteria 9417
178 Ga0495625_0051359 3300046660 Bacteria 2956
179 Ga0495635_0012295 3300046663 Bacteria 5996
180 Ga0495661_0014480 3300046665 Bacteria 5283
181 Ga0495588_0033142 3300046674 Bacteria 2607
182 Ga0495657_0019455 3300046675 Bacteria 4898
183 Ga0495657_0027299 3300046675 Bacteria 4031
184 Ga0495657_0051762 3300046675 Bacteria 2756
185 Ga0495623_0108612 3300046679 Bacteria 1684
186 Ga0495623_0184351 3300046679 Bacteria 1210
187 Ga0495646_0002403 3300046680 Bacteria 11487
188 Ga0495613_0001840 3300046689 Bacteria 16144
189 Ga0495613_0013907 3300046689 Bacteria 5971
190 Ga0495613_0020027 3300046689 Bacteria 4985
191 Ga0495613_0052062 3300046689 Bacteria 3016
192 Ga0495613_0220766 3300046689 Bacteria 1330
193 Ga0495624_0157866 3300046690 Bacteria 1386
194 Ga0495670_0001303 3300046691 Bacteria 12151
195 Ga0495670_0101079 3300046691 Bacteria 1485
196 Ga0495671_0021726 3300046692 Bacteria 3367
197 Ga0495671_0093916 3300046692 Bacteria 1468
198 Ga0495649_0077164 3300046694 Bacteria 1783
199 Ga0495649_0369125 3300046694 Bacteria 723
200 Ga0495589_0004630 3300046794 Bacteria 7310
201 Ga0495589_0009410 3300046794 Bacteria 5082
202 Ga0495589_0065237 3300046794 Bacteria 1785
203 Ga0495600_0005132 3300046809 Bacteria 7872
204 Ga0495600_0084116 3300046809 Bacteria 2076
205 Ga0495600_0215487 3300046809 Bacteria 1229
206 Ga0495660_0033012 3300046810 Bacteria 2904
207 Ga0495581_0005322 3300047315 Bacteria 7442
208 Ga0495581_0174651 3300047315 Bacteria 1256
209 Ga0495581_0366903 3300047315 Bacteria 840
210 Ga0495604_0000676 3300047317 Bacteria 28890
211 Ga0495604_0003136 3300047317 Bacteria 13216
212 Ga0495636_0016992 3300047318 Bacteria 2909
213 Ga0495636_0172141 3300047318 Bacteria 979
214 Ga0495674_0090889 3300047319 Bacteria 2608
215 Ga0495674_0705519 3300047319 Bacteria 791
216 Ga0495676_0027607 3300047321 Bacteria 4864
217 Ga0495676_0083961 3300047321 Bacteria 2404
218 Ga0495676_0092358 3300047321 Bacteria 2259
219 Ga0495680_0034540 3300047322 Bacteria 4081
220 Ga0495683_0064927 3300047323 Bacteria 1801
221 Ga0495687_002290 3300047443 Bacteria 15657
222 Ga0495687_012526 3300047443 Bacteria 4477
223 Ga0495687_018379 3300047443 Bacteria 3456
224 Ga0495687_050387 3300047443 Bacteria 1774
225 Ga0495687_089786 3300047443 Bacteria 1179
226 Ga0495687_162710 3300047443 Bacteria 748
227 Ga0495675_0011509 3300047444 Bacteria 5555
228 Ga0495675_0176827 3300047444 Bacteria 1308
229 Ga0495675_0271071 3300047444 Bacteria 1014
230 Ga0495677_0084934 3300047445 Bacteria 1189
231 Ga0495685_000067 3300047447 Bacteria 39630
232 Ga0495685_001137 3300047447 Bacteria 8136
233 Ga0495681_0001968 3300047470 Bacteria 15013
234 Ga0495681_0007924 3300047470 Bacteria 6713
235 Ga0495681_0037571 3300047470 Bacteria 2383
236 Ga0495684_0031234 3300047471 Bacteria 4089
237 Ga0495686_0021589 3300047472 Bacteria 4271
238 Ga0495686_0032999 3300047472 Bacteria 3345
239 Ga0495686_0065224 3300047472 Bacteria 2252
240 Ga0495602_0145540 3300048088 Bacteria 1870
241 Ga0495602_0554089 3300048088 Bacteria 796
242 Ga0495614_0015249 3300048089 Bacteria 3352
243 Ga0495614_0042018 3300048089 Bacteria 1960
244 Ga0495614_0107589 3300048089 Bacteria 1222
245 Ga0495626_0003723 3300048091 Bacteria 9630
246 Ga0495678_056373 3300049459 Bacteria 1494
247 Ga0495682_0064744 3300049460 Bacteria 1318
248 Ga0501031_0017683 3300049568 Bacteria 4635
249 Ga0501031_0068589 3300049568 Bacteria 2310
250 Ga0501031_0304980 3300049568 Bacteria 1032
251 Ga0501032_0053992 3300049569 Bacteria 2705
252 Ga0501032_0072809 3300049569 Bacteria 2289
253 Ga0501032_0145959 3300049569 Bacteria 1557
254 Ga0501032_0383677 3300049569 Bacteria 903
255 Ga0501033_0001714 3300049570 Bacteria 19196
256 Ga0501033_0027575 3300049570 Bacteria 4270
257 Ga0501033_0033774 3300049570 Bacteria 3840
258 Ga0501033_0080585 3300049570 Bacteria 2388
259 Ga0501033_0113678 3300049570 Bacteria 1968
260 Ga0501033_0628925 3300049570 Bacteria 734
261 Ga0501034_0001636 3300049571 Bacteria 28989
262 Ga0501034_0027430 3300049571 Bacteria 5792
263 Ga0501034_0142321 3300049571 Bacteria 2377
264 Ga0501034_1009723 3300049571 Bacteria 716
265 Ga0501036_0000201 3300049572 Bacteria 39731
266 Ga0501036_0006994 3300049572 Bacteria 9182
267 Ga0501036_0023365 3300049572 Bacteria 5207
268 Ga0501036_0049884 3300049572 Bacteria 3545
269 Ga0501036_0157945 3300049572 Bacteria 1912
270 Ga0501036_0309314 3300049572 Bacteria 1321
271 Ga0501037_0002121 3300049573 Bacteria 14360
272 Ga0501037_0009865 3300049573 Bacteria 7007
273 Ga0501037_0089109 3300049573 Bacteria 2233
274 Ga0501037_0099312 3300049573 Bacteria 2102
275 Ga0501037_0101814 3300049573 Bacteria 2072
276 Ga0501037_0126959 3300049573 Bacteria 1830
277 Ga0501038_0003658 3300049574 Bacteria 14324
278 Ga0501038_0011424 3300049574 Bacteria 8103
279 Ga0501038_0016583 3300049574 Bacteria 6678
280 Ga0501038_0026503 3300049574 Bacteria 5162
281 Ga0501038_0043226 3300049574 Bacteria 3919
282 Ga0501038_0048699 3300049574 Bacteria 3666
283 Ga0501039_0016638 3300049575 Bacteria 5634
284 Ga0501039_0047536 3300049575 Bacteria 3317
285 Ga0501039_0059703 3300049575 Bacteria 2953
286 Ga0501039_0412025 3300049575 Bacteria 1061
287 Ga0501039_0527511 3300049575 Bacteria 927
288 Ga0501039_0865577 3300049575 Bacteria 704
289 Ga0501040_0141938 3300049576 Bacteria 1692
290 Ga0501042_0024722 3300049578 Bacteria 4214
291 Ga0501042_0075898 3300049578 Bacteria 2405
292 Ga0501042_0442829 3300049578 Bacteria 942
293 Ga0501043_0022222 3300049579 Bacteria 4976
294 Ga0501043_0122851 3300049579 Bacteria 2036
295 Ga0501043_0524820 3300049579 Bacteria 882
296 Ga0501046_0003739 3300049580 Bacteria 13929
297 Ga0501046_0038572 3300049580 Bacteria 3832
298 Ga0501046_0065185 3300049580 Bacteria 2842
299 Ga0501046_0198535 3300049580 Bacteria 1493
300 Ga0501046_0316319 3300049580 Bacteria 1138
301 Ga0501047_0000359 3300049581 Bacteria 51862
302 Ga0501047_0000431 3300049581 Bacteria 46585
303 Ga0501047_0001120 3300049581 Bacteria 26611
304 Ga0501047_0040709 3300049581 Bacteria 4493
305 Ga0501047_0087951 3300049581 Bacteria 2984
306 Ga0501047_0147063 3300049581 Bacteria 2232
307 Ga0501047_0284268 3300049581 Bacteria 1498
308 Ga0501048_0035149 3300049582 Bacteria 3608
309 Ga0501048_0543368 3300049582 Bacteria 833
310 Ga0501067_0066524 3300049583 Bacteria 1994
311 Ga0501068_0012030 3300049584 Bacteria 4895
312 Ga0501069_0073650 3300049585 Bacteria 1915
313 Ga0501070_0000725 3300049586 Bacteria 30116
314 Ga0501071_0236974 3300049587 Bacteria 1375
315 Ga0501072_0004968 3300049588 Bacteria 10114
316 Ga0501072_0499429 3300049588 Bacteria 962
317 Ga0501073_0050597 3300049589 Bacteria 2911
318 Ga0501074_0003177 3300049590 Bacteria 11590
319 Ga0501074_0028005 3300049590 Bacteria 4084
320 Ga0501077_0172678 3300049593 Bacteria 1373
321 Ga0501079_0026391 3300049741 Bacteria 4453
322 Ga0501083_0006334 3300049744 Bacteria 8387
323 Ga0501035_0000428 3300049822 Bacteria 47356
324 Ga0501035_0003831 3300049822 Bacteria 14331
325 Ga0501035_0028971 3300049822 Bacteria 5051
326 Ga0501035_0034838 3300049822 Bacteria 4573
327 Ga0501035_0035274 3300049822 Bacteria 4540
328 Ga0501035_0147932 3300049822 Bacteria 2039
329 Ga0501035_0197130 3300049822 Bacteria 1729
330 Ga0501044_0001371 3300049823 Bacteria 28580
331 Ga0501044_0003747 3300049823 Bacteria 17081
332 Ga0501044_0033890 3300049823 Bacteria 5361
333 Ga0501044_0065032 3300049823 Bacteria 3720
334 Ga0501044_0093509 3300049823 Bacteria 3031
335 Ga0501044_0103222 3300049823 Bacteria 2866
336 Ga0501044_0159146 3300049823 Bacteria 2236
337 Ga0501044_0287047 3300049823 Bacteria 1578
338 Ga0501045_0264624 3300049824 Bacteria 1280
339 Ga0501045_0289021 3300049824 Bacteria 1220
340 nmdc:mga0yw44_342702_c1 3300050492 Bacteria 1005
341 nmdc:mga06z11_12263_c1 3300050494 Bacteria 3723
342 nmdc:mga04h51_20124_c1 3300050495 Bacteria 1988
343 Ga0500610_0088596 3300053079 Bacteria 1609
344 Ga0495655_0033688 3300053083 Bacteria 1262
345 Ga0495595_0069005 3300053084 Bacteria 1668
346 Ga0500640_017879 3300053095 Bacteria 3016
347 Ga0500650_0063166 3300053098 Bacteria 1730
348 Ga0500654_084153 3300053099 Bacteria 1461
349 Ga0500660_031818 3300053100 Bacteria 2748
350 Ga0500553_116346 3300053101 Bacteria 1112
351 Ga0500560_010542 3300053107 Bacteria 2319
352 Ga0500560_051212 3300053107 Bacteria 1325
353 Ga0500569_015489 3300053109 Bacteria 1910
354 Ga0500628_008482 3300053129 Bacteria 1788
355 Ga0500573_0313973 3300053140 Bacteria 777
356 Ga0500577_0193599 3300053142 Bacteria 876
357 Ga0500600_0003332 3300053149 Bacteria 9242
358 Ga0500600_0183288 3300053149 Bacteria 1005
359 Ga0500600_0227506 3300053149 Bacteria 855
360 Ga0500616_0003582 3300053153 Bacteria 11724
361 Ga0500633_0004124 3300053160 Bacteria 3290
362 Ga0500634_0000586 3300053161 Bacteria 12088
363 Ga0500587_006975 3300053739 Bacteria 1481
364 Ga0501084_0008029 3300054114 Bacteria 8689
365 Ga0501082_0010579 3300060353 Bacteria 7941
366 Ga0466962_0005884 3300061719 Bacteria 5891
367 Ga0530510_0051017 3300061734 Bacteria 2989
368 2585310812 2582581313 Bacteria 10042643
369 2585314500 2582581314 Bacteria 11452267
370 2616700308 2616644814 Bacteria 11555299
371 2644262927 2643221647 Bacteria 10741251
372 2785369933 2784746768 Bacteria 10036182
373 2786671005 2786546132 Bacteria 10419719
374 2808920939 2808606375 Bacteria 9466072
375 2812480189 2811994917 Bacteria 7761064
376 2867434844 2867428634 Bacteria 9590268
377 2877680696 2877676314 Bacteria 9512378
378 2912719412 2912715099 Bacteria 9460473
379 2912731382 2912723979 Bacteria 8557534
380 2954006776 2954002825 Bacteria 9173742
381 2954385823 2954380949 Bacteria 10050426
382 2954677332 2954673503 Bacteria 9685905
383 2954686820 2954682443 Bacteria 9862841
384 2954696470 2954691527 Bacteria 10720516
385 2954705809 2954701450 Bacteria 10834262
386 2954725762 2954721474 Bacteria 10456478
387 2954736038 2954731030 Bacteria 10243860
388 2954744720 2954740390 Bacteria 10229294
389 3006325674 3006321560 Bacteria 8247479
390 3006397203 3006393351 Bacteria 6615579
391 3006425707 3006425503 Bacteria 6491253
392 8008578550 8008574985 Bacteria 7815457
393 8025484678 8025478263 Bacteria 8209203
394 8033686074 8033684223 Bacteria 6906479
395 8056449700 8056447290 Bacteria 7680491
396 8056667400 8056667051 Bacteria 6953971
397 8056833309 8056829672 Bacteria 9045328
398 Ga0466969_0004111
399 JGI24737J22298_10012057
400 JGI25153J46596_10056050
401 rootH1_10066173
402 rootH2_10026446
403 rootL2_10052478
404 rootH1_10019622
405 Ga0070670_100203329
406 Ga0070665_100047987
407 Ga0070665_100924348
408 Ga0068854_100465801
409 Ga0068856_100576996
410 Ga0070715_10281277
411 Ga0075367_10019974
412 Ga0105251_10024482
413 Ga0105245_10093383
414 Ga0105248_10055762
415 Ga0105237_10859813
416 Ga0105238_11155979
417 Ga0105246_10006769
418 Ga0105246_10539842
419 Ga0157372_10116507
420 Ga0182007_10000971
421 Ga0182005_1043545
422 Ga0209758_1001599
423 Ga0207426_1013834
424 Ga0207713_1029093
425 Ga0207647_10075853
426 Ga0207671_10583326
427 Ga0207657_10492713
428 Ga0207650_10236616
429 Ga0207709_10295481
430 Ga0207691_10273029
431 Ga0207711_10122625
432 Ga0207702_10495564
433 Ga0207674_10937908
434 Ga0207683_10720035
435 Ga0207698_11394807
436 Ga0209371_1007484
437 Ga0209813_10059446
438 Ga0307517_10003138
439 Ga0307517_10015116
440 Ga0307517_10399188
441 Ga0307515_10006981
442 Ga0307515_10065396
443 Ga0268256_1007712
444 Ga0268256_1024452
445 Ga0307511_10000978
446 Ga0307511_10168259
447 Ga0307512_10011939
448 Ga0307512_10017654
449 Ga0307513_10028788
450 Ga0307513_10263727
451 Ga0307509_10017538
452 Ga0307509_10138904
453 Ga0307508_10004885
454 Ga0307508_10019966
455 Ga0307508_10035638
456 Ga0307508_10250691
457 Ga0307514_10034545
458 Ga0307514_10208464
459 Ga0307516_10057137
460 Ga0307516_10093982
461 Ga0307518_10036833
462 Ga0307518_10089428
463 Ga0307518_10091945
464 Ga0307416_100200537
465 Ga0307507_10073501
466 Ga0307507_10098187
467 Ga0307510_10016551
468 Ga0307510_10247276
469 Ga0307510_10250359
470 Ga0307510_10276455
471 Ga0395898_0031182
472 Ga0395898_0035639
473 Ga0395901_0147745
474 Ga0451807_1595658
475 Ga0451853_3774284
476 Ga0439448_0002548
477 Ga0439448_0053216
478 Ga0439455_0024410
479 Ga0439462_0024207
480 Ga0450903_000389
481 Ga0439458_0004783
482 Ga0466969_0225284
483 Ga0466972_0001117
484 Ga0466972_0004269
485 Ga0466972_0004794
486 Ga0466965_0004501
487 Ga0466965_0118403
488 Ga0466966_0004094
489 Ga0466961_0004453
490 Ga0466961_0017283
491 Ga0466961_0018499
492 Ga0466963_0005679
493 Ga0466963_0005879
494 Ga0466963_0438166
495 Ga0466964_0018339
496 Ga0466964_0265128
497 Ga0466964_0319808
498 Ga0466971_0001873
499 Ga0466971_0167547
500 Ga0466971_0256800
501 Ga0466968_0055195
502 Ga0466970_0002851
503 Ga0466970_0022525
504 Ga0466957_0001114
505 Ga0466960_0009654
506 Ga0466960_0275464
507 Ga0466959_0042936
508 Ga0466958_0009069
509 Ga0466967_0000653
510 Ga0466967_0013524
511 Ga0495627_009537
512 Ga0495592_0036216
513 Ga0495592_0036325
514 Ga0495603_0004095
515 Ga0495603_0036071
516 Ga0495603_0076178
517 Ga0495603_0097492
518 Ga0495590_0058667
519 Ga0495629_0007326
520 Ga0495629_0013070
521 Ga0495629_0018343
522 Ga0495629_0021235
523 Ga0495629_0030560
524 Ga0495629_0033266
525 Ga0495629_0041001
526 Ga0495629_0353544
527 Ga0495638_0032398
528 Ga0495641_0102776
529 Ga0495580_0309628
530 Ga0495582_0094838
531 Ga0495605_0010457
532 Ga0495639_0003339
533 Ga0495662_0002609
534 Ga0495662_0052740
535 Ga0495664_0000329
536 Ga0495664_0090324
537 Ga0495585_0024836
538 Ga0495594_0019723
539 Ga0495594_0037835
540 Ga0495596_0196296
541 Ga0495607_0035327
542 Ga0495583_0046367
543 Ga0495606_0012682
544 Ga0495610_0052897
545 Ga0495616_0017339
546 Ga0495618_0068205
547 Ga0495618_0080039
548 Ga0495620_0019982
549 Ga0495628_0020328
550 Ga0495628_0075516
551 Ga0495628_0193676
552 Ga0495632_0051647
553 Ga0495643_0003895
554 Ga0495643_0006952
555 Ga0495648_0015773
556 Ga0495666_0008302
557 Ga0495666_0192858
558 Ga0495652_0192252
559 Ga0495654_0057772
560 Ga0495665_0107043
561 Ga0495640_0008195
562 Ga0495640_0008902
563 Ga0495640_0503889
564 Ga0495587_0006390
565 Ga0495609_0016573
566 Ga0495645_0004878
567 Ga0495622_0011519
568 Ga0495633_0007683
569 Ga0495667_0061709
570 Ga0495656_0009189
571 Ga0495634_0007221
572 Ga0495634_0063724
573 Ga0495634_0089812
574 Ga0495625_0007588
575 Ga0495625_0051359
576 Ga0495635_0012295
577 Ga0495661_0014480
578 Ga0495588_0033142
579 Ga0495657_0019455
580 Ga0495657_0027299
581 Ga0495657_0051762
582 Ga0495623_0108612
583 Ga0495623_0184351
584 Ga0495646_0002403
585 Ga0495613_0001840
586 Ga0495613_0013907
587 Ga0495613_0020027
588 Ga0495613_0052062
589 Ga0495613_0220766
590 Ga0495624_0157866
591 Ga0495670_0001303
592 Ga0495670_0101079
593 Ga0495671_0021726
594 Ga0495671_0093916
595 Ga0495649_0077164
596 Ga0495649_0369125
597 Ga0495589_0004630
598 Ga0495589_0009410
599 Ga0495589_0065237
600 Ga0495600_0005132
601 Ga0495600_0084116
602 Ga0495600_0215487
603 Ga0495660_0033012
604 Ga0495581_0005322
605 Ga0495581_0174651
606 Ga0495581_0366903
607 Ga0495604_0000676
608 Ga0495604_0003136
609 Ga0495636_0016992
610 Ga0495636_0172141
611 Ga0495674_0090889
612 Ga0495674_0705519
613 Ga0495676_0027607
614 Ga0495676_0083961
615 Ga0495676_0092358
616 Ga0495680_0034540
617 Ga0495683_0064927
618 Ga0495687_002290
619 Ga0495687_012526
620 Ga0495687_018379
621 Ga0495687_050387
622 Ga0495687_089786
623 Ga0495687_162710
624 Ga0495675_0011509
625 Ga0495675_0176827
626 Ga0495675_0271071
627 Ga0495677_0084934
628 Ga0495685_000067
629 Ga0495685_001137
630 Ga0495681_0001968
631 Ga0495681_0007924
632 Ga0495681_0037571
633 Ga0495684_0031234
634 Ga0495686_0021589
635 Ga0495686_0032999
636 Ga0495686_0065224
637 Ga0495602_0145540
638 Ga0495602_0554089
639 Ga0495614_0015249
640 Ga0495614_0042018
641 Ga0495614_0107589
642 Ga0495626_0003723
643 Ga0495678_056373
644 Ga0495682_0064744
645 Ga0501031_0017683
646 Ga0501031_0068589
647 Ga0501031_0304980
648 Ga0501032_0053992
649 Ga0501032_0072809
650 Ga0501032_0145959
651 Ga0501032_0383677
652 Ga0501033_0001714
653 Ga0501033_0027575
654 Ga0501033_0033774
655 Ga0501033_0080585
656 Ga0501033_0113678
657 Ga0501033_0628925
658 Ga0501034_0001636
659 Ga0501034_0027430
660 Ga0501034_0142321
661 Ga0501034_1009723
662 Ga0501036_0000201
663 Ga0501036_0006994
664 Ga0501036_0023365
665 Ga0501036_0049884
666 Ga0501036_0157945
667 Ga0501036_0309314
668 Ga0501037_0002121
669 Ga0501037_0009865
670 Ga0501037_0089109
671 Ga0501037_0099312
672 Ga0501037_0101814
673 Ga0501037_0126959
674 Ga0501038_0003658
675 Ga0501038_0011424
676 Ga0501038_0016583
677 Ga0501038_0026503
678 Ga0501038_0043226
679 Ga0501038_0048699
680 Ga0501039_0016638
681 Ga0501039_0047536
682 Ga0501039_0059703
683 Ga0501039_0412025
684 Ga0501039_0527511
685 Ga0501039_0865577
686 Ga0501040_0141938
687 Ga0501042_0024722
688 Ga0501042_0075898
689 Ga0501042_0442829
690 Ga0501043_0022222
691 Ga0501043_0122851
692 Ga0501043_0524820
693 Ga0501046_0003739
694 Ga0501046_0038572
695 Ga0501046_0065185
696 Ga0501046_0198535
697 Ga0501046_0316319
698 Ga0501047_0000359
699 Ga0501047_0000431
700 Ga0501047_0001120
701 Ga0501047_0040709
702 Ga0501047_0087951
703 Ga0501047_0147063
704 Ga0501047_0284268
705 Ga0501048_0035149
706 Ga0501048_0543368
707 Ga0501067_0066524
708 Ga0501068_0012030
709 Ga0501069_0073650
710 Ga0501070_0000725
711 Ga0501071_0236974
712 Ga0501072_0004968
713 Ga0501072_0499429
714 Ga0501073_0050597
715 Ga0501074_0003177
716 Ga0501074_0028005
717 Ga0501077_0172678
718 Ga0501079_0026391
719 Ga0501083_0006334
720 Ga0501035_0000428
721 Ga0501035_0003831
722 Ga0501035_0028971
723 Ga0501035_0034838
724 Ga0501035_0035274
725 Ga0501035_0147932
726 Ga0501035_0197130
727 Ga0501044_0001371
728 Ga0501044_0003747
729 Ga0501044_0033890
730 Ga0501044_0065032
731 Ga0501044_0093509
732 Ga0501044_0103222
733 Ga0501044_0159146
734 Ga0501044_0287047
735 Ga0501045_0264624
736 Ga0501045_0289021
737 nmdc:mga0yw44_342702_c1
738 nmdc:mga06z11_12263_c1
739 nmdc:mga04h51_20124_c1
740 Ga0500610_0088596
741 Ga0495655_0033688
742 Ga0495595_0069005
743 Ga0500640_017879
744 Ga0500650_0063166
745 Ga0500654_084153
746 Ga0500660_031818
747 Ga0500553_116346
748 Ga0500560_010542
749 Ga0500560_051212
750 Ga0500569_015489
751 Ga0500628_008482
752 Ga0500573_0313973
753 Ga0500577_0193599
754 Ga0500600_0003332
755 Ga0500600_0183288
756 Ga0500600_0227506
757 Ga0500616_0003582
758 Ga0500633_0004124
759 Ga0500634_0000586
760 Ga0500587_006975
761 Ga0501084_0008029
762 Ga0501082_0010579
763 Ga0466962_0005884
764 Ga0530510_0051017
765 2585310812
766 2585314500
767 2616700308
768 2644262927
769 2785369933
770 2786671005
771 2808920939
772 2812480189
773 2867434844
774 2877680696
775 2912719412
776 2912731382
777 2954006776
778 2954385823
779 2954677332
780 2954686820
781 2954696470
782 2954705809
783 2954725762
784 2954736038
785 2954744720
786 3006325674
787 3006397203
788 3006425707
789 8008578550
790 8025484678
791 8033686074
792 8056449700
793 8056667400
794 8056833309

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02630

SCO1-SenC

SCO1/SenC

55

196

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4bpy-assembly1.cif.gz_A crystal structure of the c90a mutant of the sco copper chaperone protein from streptomyces lividans 0.9824 25 199
4bpy-assembly1.cif.gz_A crystal structure of the c90a mutant of the sco copper chaperone protein from streptomyces lividans 0.9705 25 199
6n5u-assembly2.cif.gz_B crystal structure of arabidopsis thaliana scoi with copper bound 0.8844 31 188
6n5u-assembly3.cif.gz_C crystal structure of arabidopsis thaliana scoi with copper bound 0.8742 31 188
2k6v-assembly1.cif.gz_A solution structures of apo sco1 protein from thermus thermophilus 0.8718 25 191
ID Description Score Start End Superfamily
4bpyA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9824 25 199 3.40.30.10
4bpyA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9703 25 199 3.40.30.10
af_Q54TT7_154_312_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8848 31 188 3.40.30.10
af_O42899_78_257_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.879 31 191 3.40.30.10
af_Q8IC00_108_304_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8737 31 188 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A1C0ANS6-F1-model_v4 Thioredoxin domain-containing protein 0.9479 36 195 GO:0046872
AF-A0A6P2BXZ0-F1-model_v4 SCO family protein 0.9416 26 199 GO:0046872
AF-A0A7W0Y0M1-F1-model_v4 SCO family protein 0.9395 29 195 GO:0046872
AF-D9UFZ3-F1-model_v4 Secreted protein 0.9314 7 199 GO:0046872
AF-A0A1C0ANS6-F1-model_v4 Thioredoxin domain-containing protein 0.9307 36 195 GO:0046872

Map