F433811

General Info

Members Datasets Scaffolds Average Seq Length
397 224 794 281

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_100091431|Ga0307409_1000914313
Length 317
Sequence MLDVTRLRVLDALARLGSVTAAAKELHYTQPTVSHHLARLEAETGAQLLQRAGRGIRLTPAGQLLAVRAAEIIGRIDAADAELSAHVGLTSGRVRLASFSSVIGSLIPRAVAALTAKHPGLQIGLTDTQPPEALALLRTGKIDLAVIFRYDDTEPEPENVRLQHLLDDPLYLLSTRRERTLSTLRDATWIAGCDRCRRHLLWMCAKEGFEPRIGYTSDDMVVMQALVAAGLGVTTSPGLALRAHRGKGIVANELPGSHQRIYAATYGEPPDPPATTALLEALTEAAASVGSAPAGGLVRPRRGAGSTGRHVPGIRPD

Samples

Sample ID Description Type Environment
1 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
144 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
145 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
146 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
149 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
150 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
151 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
152 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
153 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
154 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
155 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
160 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
161 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
162 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
165 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
166 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
167 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
168 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
169 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
170 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
171 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
172 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
173 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
174 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
175 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
176 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
177 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
182 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
185 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
188 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
189 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
190 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
198 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
199 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
200 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
201 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
202 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
203 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
204 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
205 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
206 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
207 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
208 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
210 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
211 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
212 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
213 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
214 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
215 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
216 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
217 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
218 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
219 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
220 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
221 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
222 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
223 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
224 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0
Isolates 0.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.76
Nodule 0
Rhizoplane 7.81
Rhizosphere 88.16
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307409_100091431 3300031995 Bacteria 2494
2 rootL2_10122306 3300003322 Bacteria 3746
3 Ga0070683_100029935 3300005329 Bacteria 4937
4 Ga0070670_100190198 3300005331 Bacteria 1783
5 Ga0068869_100041705 3300005334 Bacteria 3288
6 Ga0068869_100045910 3300005334 Bacteria 3147
7 Ga0068869_100215687 3300005334 Bacteria 1519
8 Ga0070666_10201947 3300005335 Bacteria 1399
9 Ga0070680_100216322 3300005336 Bacteria 1617
10 Ga0070682_100064998 3300005337 Bacteria 2317
11 Ga0068868_100045597 3300005338 Bacteria 3430
12 Ga0068868_100058777 3300005338 Bacteria 3040
13 Ga0070660_100060726 3300005339 Bacteria 2934
14 Ga0070689_100051603 3300005340 Bacteria 3180
15 Ga0070661_100170674 3300005344 Bacteria 1651
16 Ga0070692_10057156 3300005345 Bacteria 2045
17 Ga0070692_10088828 3300005345 Bacteria 1677
18 Ga0070668_100000212 3300005347 Bacteria 37883
19 Ga0070668_100025515 3300005347 Bacteria 4482
20 Ga0070668_100049999 3300005347 Bacteria 3217
21 Ga0070668_100292025 3300005347 Bacteria 1365
22 Ga0070669_100194388 3300005353 Bacteria 1593
23 Ga0070675_100063442 3300005354 Bacteria 3054
24 Ga0070671_100306668 3300005355 Bacteria 1352
25 Ga0070674_100173375 3300005356 Bacteria 1647
26 Ga0070674_100187165 3300005356 Bacteria 1590
27 Ga0070659_100135593 3300005366 Bacteria 2002
28 Ga0070667_100293486 3300005367 Bacteria 1463
29 Ga0070703_10023803 3300005406 Bacteria 1805
30 Ga0070709_10336012 3300005434 Bacteria 1112
31 Ga0070714_100065406 3300005435 Bacteria 3131
32 Ga0070714_100065967 3300005435 Bacteria 3119
33 Ga0070714_100077501 3300005435 Bacteria 2887
34 Ga0070714_100323476 3300005435 Bacteria 1443
35 Ga0070713_100045459 3300005436 Bacteria 3598
36 Ga0070713_100072565 3300005436 Bacteria 2911
37 Ga0070713_100150698 3300005436 Bacteria 2068
38 Ga0070701_10023961 3300005438 Bacteria 2947
39 Ga0070701_10027707 3300005438 Bacteria 2779
40 Ga0070705_100056301 3300005440 Bacteria 2315
41 Ga0070700_100023771 3300005441 Bacteria 3589
42 Ga0070700_100099434 3300005441 Bacteria 1913
43 Ga0070694_100023488 3300005444 Bacteria 3966
44 Ga0070663_100025079 3300005455 Bacteria 4022
45 Ga0070663_100070906 3300005455 Bacteria 2535
46 Ga0070678_100064029 3300005456 Bacteria 2723
47 Ga0070678_100088322 3300005456 Bacteria 2370
48 Ga0070678_100509846 3300005456 Bacteria 1062
49 Ga0070662_100022596 3300005457 Bacteria 4309
50 Ga0068867_100184755 3300005459 Bacteria 1659
51 Ga0070685_10003535 3300005466 Bacteria 7935
52 Ga0070707_100000727 3300005468 Bacteria 32816
53 Ga0068853_100137542 3300005539 Bacteria 2191
54 Ga0070686_100014678 3300005544 Bacteria 4519
55 Ga0070696_100142077 3300005546 Bacteria 1755
56 Ga0070665_100004500 3300005548 Bacteria 14627
57 Ga0070665_100183061 3300005548 Bacteria 2096
58 Ga0070704_100169248 3300005549 Bacteria 1736
59 Ga0068855_100033775 3300005563 Bacteria 6103
60 Ga0068855_100041015 3300005563 Bacteria 5488
61 Ga0070664_100086798 3300005564 Bacteria 2704
62 Ga0068857_100190581 3300005577 Bacteria 1867
63 Ga0068857_100235368 3300005577 Bacteria 1676
64 Ga0068856_100300241 3300005614 Bacteria 1623
65 Ga0068856_100525388 3300005614 Bacteria 1205
66 Ga0068852_100073633 3300005616 Bacteria 3005
67 Ga0068852_100084381 3300005616 Bacteria 2827
68 Ga0068852_100825386 3300005616 Bacteria 942
69 Ga0068859_100184828 3300005617 Bacteria 2168
70 Ga0068864_100043563 3300005618 Bacteria 3843
71 Ga0068864_100161437 3300005618 Bacteria 2037
72 Ga0068861_100023394 3300005719 Bacteria 4455
73 Ga0068861_100094446 3300005719 Bacteria 2366
74 Ga0068863_100082561 3300005841 Bacteria 3046
75 Ga0068858_100233561 3300005842 Bacteria 1744
76 Ga0068858_100273524 3300005842 Bacteria 1608
77 Ga0068860_100044928 3300005843 Bacteria 4210
78 Ga0068860_100073099 3300005843 Bacteria 3260
79 Ga0068860_100207753 3300005843 Bacteria 1899
80 Ga0068862_100059103 3300005844 Bacteria 3291
81 Ga0068862_100264212 3300005844 Bacteria 1572
82 Ga0068862_100606549 3300005844 Bacteria 1051
83 Ga0081455_10002213 3300005937 Bacteria 23164
84 Ga0081455_10008340 3300005937 Bacteria 10791
85 Ga0081455_10042032 3300005937 Bacteria 4014
86 Ga0081538_10000592 3300005981 Bacteria 40148
87 Ga0081538_10004762 3300005981 Bacteria 12408
88 Ga0081538_10007675 3300005981 Bacteria 9300
89 Ga0081538_10008641 3300005981 Bacteria 8612
90 Ga0081539_10001609 3300005985 Bacteria 37152
91 Ga0081539_10014136 3300005985 Bacteria 5933
92 Ga0081539_10060079 3300005985 Bacteria 2089
93 Ga0070717_10248487 3300006028 Bacteria 1571
94 Ga0075365_10001200 3300006038 Bacteria 11426
95 Ga0075365_10011016 3300006038 Bacteria 5299
96 Ga0075363_100020717 3300006048 Bacteria 3301
97 Ga0070716_100090877 3300006173 Bacteria 1848
98 Ga0070712_100019005 3300006175 Bacteria 4472
99 Ga0097621_100148131 3300006237 Bacteria 2011
100 Ga0075428_100002893 3300006844 Bacteria 18688
101 Ga0075428_100082524 3300006844 Bacteria 3507
102 Ga0075428_100169480 3300006844 Bacteria 2367
103 Ga0075428_100222158 3300006844 Bacteria 2039
104 Ga0075430_100028903 3300006846 Bacteria 4707
105 Ga0075430_100316251 3300006846 Bacteria 1291
106 Ga0075431_100001317 3300006847 Bacteria 22711
107 Ga0075431_100361223 3300006847 Bacteria 1458
108 Ga0075433_10063370 3300006852 Bacteria 3239
109 Ga0075434_100582379 3300006871 Bacteria 1138
110 Ga0075429_100027075 3300006880 Bacteria 4977
111 Ga0075436_100079560 3300006914 Bacteria 2270
112 Ga0097620_100184835 3300006931 Bacteria 2168
113 Ga0075435_100167932 3300007076 Bacteria 1851
114 Ga0105240_10365572 3300009093 Bacteria 1633
115 Ga0111539_10006118 3300009094 Bacteria 15538
116 Ga0111539_10160776 3300009094 Bacteria 2627
117 Ga0111539_10256585 3300009094 Bacteria 2036
118 Ga0111539_10444547 3300009094 Bacteria 1510
119 Ga0105245_10001368 3300009098 Bacteria 22081
120 Ga0105245_10006706 3300009098 Bacteria 10099
121 Ga0105247_10013975 3300009101 Bacteria 4814
122 Ga0105243_10260670 3300009148 Bacteria 1552
123 Ga0105243_10339991 3300009148 Bacteria 1374
124 Ga0105243_10393516 3300009148 Bacteria 1285
125 Ga0105243_10553778 3300009148 Bacteria 1099
126 Ga0105241_10302563 3300009174 Bacteria 1373
127 Ga0105242_10384298 3300009176 Bacteria 1306
128 Ga0105248_10718710 3300009177 Bacteria 1127
129 Ga0105237_10034796 3300009545 Bacteria 5098
130 Ga0105237_10072711 3300009545 Bacteria 3432
131 Ga0105237_10471765 3300009545 Bacteria 1261
132 Ga0105238_10161112 3300009551 Bacteria 2219
133 Ga0105238_10240622 3300009551 Bacteria 1787
134 Ga0105238_10346831 3300009551 Bacteria 1473
135 Ga0105249_10011539 3300009553 Bacteria 7764
136 Ga0105249_10041735 3300009553 Bacteria 4171
137 Ga0105239_10069990 3300010375 Bacteria 3854
138 Ga0105239_10098864 3300010375 Bacteria 3226
139 Ga0105239_10111069 3300010375 Bacteria 3039
140 Ga0105246_10010021 3300011119 Bacteria 5846
141 Ga0157370_10165620 3300013104 Bacteria 2055
142 Ga0157374_10227546 3300013296 Bacteria 1831
143 Ga0157378_10033110 3300013297 Bacteria 4568
144 Ga0163162_10486660 3300013306 Bacteria 1365
145 Ga0157372_10184629 3300013307 Bacteria 2415
146 Ga0157372_10204957 3300013307 Bacteria 2285
147 Ga0157372_10692480 3300013307 Bacteria 1186
148 Ga0157375_10024885 3300013308 Bacteria 5549
149 Ga0163163_10016998 3300014325 Bacteria 6774
150 Ga0163163_10394554 3300014325 Bacteria 1442
151 Ga0163163_10717386 3300014325 Bacteria 1063
152 Ga0157380_10176336 3300014326 Bacteria 1873
153 Ga0157377_10011012 3300014745 Bacteria 4499
154 Ga0157377_10208748 3300014745 Bacteria 1244
155 Ga0157379_10024682 3300014968 Bacteria 5336
156 Ga0157379_10182272 3300014968 Bacteria 1897
157 Ga0163161_10023962 3300017792 Bacteria 4308
158 Ga0213876_10022150 3300021384 Bacteria 3360
159 Ga0207692_10069255 3300025898 Bacteria 1853
160 Ga0207710_10078075 3300025900 Bacteria 1531
161 Ga0207688_10003541 3300025901 Bacteria 8520
162 Ga0207688_10029076 3300025901 Bacteria 3041
163 Ga0207688_10080684 3300025901 Bacteria 1857
164 Ga0207688_10280220 3300025901 Bacteria 1015
165 Ga0207680_10017580 3300025903 Bacteria 3781
166 Ga0207647_10128182 3300025904 Bacteria 1492
167 Ga0207699_10212185 3300025906 Bacteria 1317
168 Ga0207654_10060165 3300025911 Bacteria 2218
169 Ga0207671_10043838 3300025914 Bacteria 3307
170 Ga0207671_10292633 3300025914 Bacteria 1286
171 Ga0207693_10008214 3300025915 Bacteria 8550
172 Ga0207663_10257062 3300025916 Bacteria 1288
173 Ga0207662_10179851 3300025918 Bacteria 1360
174 Ga0207657_10073917 3300025919 Bacteria 2879
175 Ga0207657_10238995 3300025919 Bacteria 1451
176 Ga0207649_10107220 3300025920 Bacteria 1860
177 Ga0207646_10000149 3300025922 Bacteria 95761
178 Ga0207659_10297942 3300025926 Bacteria 1323
179 Ga0207687_10005717 3300025927 Bacteria 8228
180 Ga0207687_10043271 3300025927 Bacteria 3103
181 Ga0207700_10016544 3300025928 Bacteria 4903
182 Ga0207664_10031101 3300025929 Bacteria 4081
183 Ga0207664_10034329 3300025929 Bacteria 3906
184 Ga0207664_10111388 3300025929 Bacteria 2277
185 Ga0207690_10142346 3300025932 Bacteria 1768
186 Ga0207706_10014143 3300025933 Bacteria 7236
187 Ga0207709_10253270 3300025935 Bacteria 1287
188 Ga0207670_10187825 3300025936 Bacteria 1561
189 Ga0207669_10165381 3300025937 Bacteria 1568
190 Ga0207669_10179812 3300025937 Bacteria 1515
191 Ga0207704_10291246 3300025938 Bacteria 1246
192 Ga0207665_10003061 3300025939 Bacteria 11220
193 Ga0207711_10362773 3300025941 Bacteria 1342
194 Ga0207689_10049326 3300025942 Bacteria 3473
195 Ga0207689_10249789 3300025942 Bacteria 1467
196 Ga0207679_10296379 3300025945 Bacteria 1392
197 Ga0207679_10372079 3300025945 Bacteria 1251
198 Ga0207667_10040228 3300025949 Bacteria 4979
199 Ga0207651_10075221 3300025960 Bacteria 2409
200 Ga0207712_10022598 3300025961 Bacteria 4143
201 Ga0207712_10149278 3300025961 Bacteria 1804
202 Ga0207712_10226632 3300025961 Bacteria 1497
203 Ga0207668_10000202 3300025972 Bacteria 40372
204 Ga0207668_10001219 3300025972 Bacteria 15275
205 Ga0207668_10017229 3300025972 Bacteria 4522
206 Ga0207668_10036715 3300025972 Bacteria 3273
207 Ga0207668_10127757 3300025972 Bacteria 1936
208 Ga0207640_10036761 3300025981 Bacteria 3077
209 Ga0207677_10002048 3300026023 Bacteria 10630
210 Ga0207677_10145782 3300026023 Bacteria 1819
211 Ga0207703_10049561 3300026035 Bacteria 3395
212 Ga0207703_10058709 3300026035 Bacteria 3141
213 Ga0207703_10182344 3300026035 Bacteria 1853
214 Ga0207678_10008530 3300026067 Bacteria 9030
215 Ga0207678_10104302 3300026067 Bacteria 2420
216 Ga0207708_10024326 3300026075 Bacteria 4581
217 Ga0207708_10064326 3300026075 Bacteria 2801
218 Ga0207708_10108776 3300026075 Bacteria 2150
219 Ga0207702_10184578 3300026078 Bacteria 1923
220 Ga0207702_10215961 3300026078 Bacteria 1785
221 Ga0207641_10083359 3300026088 Bacteria 2781
222 Ga0207641_10242910 3300026088 Bacteria 1679
223 Ga0207648_10439485 3300026089 Bacteria 1186
224 Ga0207676_10049477 3300026095 Bacteria 3270
225 Ga0207676_10107411 3300026095 Bacteria 2328
226 Ga0207676_10150424 3300026095 Bacteria 2004
227 Ga0207674_10066159 3300026116 Bacteria 3641
228 Ga0207674_10074204 3300026116 Bacteria 3414
229 Ga0207675_100019914 3300026118 Bacteria 6262
230 Ga0207675_100064247 3300026118 Bacteria 3431
231 Ga0207675_100078048 3300026118 Bacteria 3102
232 Ga0207675_100116925 3300026118 Bacteria 2520
233 Ga0207683_10068415 3300026121 Bacteria 3135
234 Ga0207683_10154952 3300026121 Bacteria 2069
235 Ga0207428_10020955 3300027907 Bacteria 5541
236 Ga0207428_10128900 3300027907 Bacteria 1936
237 Ga0207428_10171501 3300027907 Bacteria 1643
238 Ga0268266_10045877 3300028379 Bacteria 3740
239 Ga0268265_10081674 3300028380 Bacteria 2553
240 Ga0268265_10148375 3300028380 Bacteria 1974
241 Ga0268265_10162699 3300028380 Bacteria 1898
242 Ga0268265_10435368 3300028380 Bacteria 1221
243 Ga0268264_10097993 3300028381 Bacteria 2542
244 Ga0268264_10131598 3300028381 Bacteria 2218
245 Ga0268264_10410136 3300028381 Bacteria 1304
246 Ga0307515_10018826 3300028794 Bacteria 12466
247 Ga0307511_10144635 3300030521 Bacteria 1385
248 Ga0307512_10037487 3300030522 Bacteria 4093
249 Ga0307513_10183706 3300031456 Bacteria 1951
250 Ga0307408_100313852 3300031548 Bacteria 1318
251 Ga0307408_100462202 3300031548 Bacteria 1103
252 Ga0307516_10022434 3300031730 Bacteria 6483
253 Ga0307405_10051147 3300031731 Bacteria 2562
254 Ga0307405_10064114 3300031731 Bacteria 2334
255 Ga0307405_10136567 3300031731 Bacteria 1703
256 Ga0307405_10155332 3300031731 Bacteria 1614
257 Ga0307405_10215827 3300031731 Bacteria 1404
258 Ga0307413_10017736 3300031824 Bacteria 3716
259 Ga0307413_10181084 3300031824 Bacteria 1502
260 Ga0307413_10349213 3300031824 Bacteria 1141
261 Ga0307410_10013834 3300031852 Bacteria 4724
262 Ga0307410_10059614 3300031852 Bacteria 2606
263 Ga0307410_10096962 3300031852 Bacteria 2106
264 Ga0307410_10122603 3300031852 Bacteria 1898
265 Ga0307410_10476325 3300031852 Bacteria 1023
266 Ga0326468_10000878 3300031889 Bacteria 2948
267 Ga0307406_10012599 3300031901 Bacteria 4822
268 Ga0307406_10093181 3300031901 Bacteria 2033
269 Ga0307407_10028485 3300031903 Bacteria 2987
270 Ga0307407_10135157 3300031903 Bacteria 1583
271 Ga0307412_10009566 3300031911 Bacteria 5566
272 Ga0307409_100005628 3300031995 Bacteria 7247
273 Ga0307409_100005717 3300031995 Bacteria 7208
274 Ga0307409_100060718 3300031995 Bacteria 2950
275 Ga0307409_100129414 3300031995 Bacteria 2154
276 Ga0307409_100206460 3300031995 Bacteria 1762
277 Ga0307409_100226423 3300031995 Bacteria 1692
278 Ga0307409_100782800 3300031995 Bacteria 960
279 Ga0307416_100000220 3300032002 Bacteria 30200
280 Ga0307416_100264585 3300032002 Bacteria 1683
281 Ga0307416_100430339 3300032002 Bacteria 1367
282 Ga0307416_100523515 3300032002 Bacteria 1254
283 Ga0307414_10133566 3300032004 Bacteria 1931
284 Ga0307411_10485552 3300032005 Bacteria 1041
285 Ga0307415_100000053 3300032126 Bacteria 49897
286 Ga0307415_100046871 3300032126 Bacteria 2906
287 Ga0307415_100065359 3300032126 Bacteria 2534
288 Ga0307415_100117892 3300032126 Bacteria 1984
289 Ga0307415_100289005 3300032126 Bacteria 1352
290 Ga0373929_0005861 3300035085 Bacteria 2219
291 Ga0373940_0008667 3300035088 Bacteria 2343
292 Ga0373931_0008382 3300035691 Bacteria 4900
293 Ga0395900_0081518 3300037418 Bacteria 3324
294 Ga0395898_0016693 3300037466 Bacteria 7504
295 Ga0395905_0140286 3300037471 Bacteria 2274
296 Ga0436365_0086732 3300039437 Bacteria 19713
297 Ga0466963_0102020 3300044694 Bacteria 1965
298 Ga0466971_0014474 3300044719 Bacteria 3471
299 Ga0466970_0001586 3300044765 Bacteria 10979
300 Ga0466960_0018667 3300044901 Bacteria 3044
301 Ga0466959_0128106 3300045049 Bacteria 1800
302 Ga0466967_0009633 3300045976 Bacteria 7180
303 Ga0466967_0030683 3300045976 Bacteria 4513
304 Ga0466967_0105284 3300045976 Bacteria 2584
305 Ga0495631_0092655 3300046518 Bacteria 1301
306 Ga0495625_0221721 3300046660 Bacteria 1239
307 Ga0495676_0093404 3300047321 Bacteria 2244
308 Ga0496101_0104270 3300048904 Bacteria 2127
309 Ga0496101_0115707 3300048904 Bacteria 2023
310 Ga0496103_0040200 3300048906 Bacteria 2874
311 Ga0496104_0045943 3300048907 Bacteria 4109
312 Ga0496104_0076061 3300048907 Bacteria 3197
313 Ga0496105_0243861 3300048908 Bacteria 1457
314 Ga0496106_0068635 3300048909 Bacteria 2704
315 Ga0496107_0260173 3300048910 Bacteria 1291
316 Ga0496108_0010966 3300048911 Bacteria 7360
317 Ga0496108_0053814 3300048911 Bacteria 3376
318 Ga0496108_0076653 3300048911 Bacteria 2827
319 Ga0496109_0004112 3300048912 Bacteria 12157
320 Ga0496109_0017228 3300048912 Bacteria 6329
321 Ga0496109_0027986 3300048912 Bacteria 5039
322 Ga0496109_0086769 3300048912 Bacteria 2890
323 Ga0496109_0097058 3300048912 Bacteria 2731
324 Ga0496110_0005198 3300048913 Bacteria 10184
325 Ga0496110_0064422 3300048913 Bacteria 3239
326 Ga0496110_0112978 3300048913 Bacteria 2442
327 Ga0496110_0578930 3300048913 Bacteria 1019
328 Ga0496111_0032701 3300048914 Bacteria 3709
329 Ga0496111_0080385 3300048914 Bacteria 2378
330 Ga0496111_0092219 3300048914 Bacteria 2220
331 Ga0496112_0086444 3300048915 Bacteria 3102
332 Ga0496112_0158817 3300048915 Bacteria 2227
333 Ga0496112_0186559 3300048915 Bacteria 2037
334 Ga0496112_0353213 3300048915 Bacteria 1412
335 Ga0496113_0123348 3300048916 Bacteria 2027
336 Ga0496114_0201236 3300048917 Bacteria 1744
337 Ga0496115_0045373 3300048918 Bacteria 3508
338 Ga0496115_0145681 3300048918 Bacteria 1955
339 Ga0501031_0051086 3300049568 Bacteria 2693
340 Ga0501034_0014036 3300049571 Bacteria 8249
341 Ga0501034_0030057 3300049571 Bacteria 5523
342 Ga0501034_0399370 3300049571 Bacteria 1297
343 Ga0501034_0609659 3300049571 Bacteria 996
344 Ga0501036_0074703 3300049572 Bacteria 2867
345 Ga0501038_0000113 3300049574 Bacteria 68151
346 Ga0501038_0050933 3300049574 Bacteria 3576
347 Ga0501043_0296187 3300049579 Bacteria 1237
348 Ga0501046_0085090 3300049580 Bacteria 2438
349 Ga0501047_0123328 3300049581 Bacteria 2471
350 Ga0501067_0011257 3300049583 Bacteria 4951
351 Ga0501068_0038881 3300049584 Bacteria 2851
352 Ga0501068_0094324 3300049584 Bacteria 1849
353 Ga0501071_0004136 3300049587 Bacteria 9171
354 Ga0501071_0133012 3300049587 Bacteria 1849
355 Ga0501072_0100866 3300049588 Bacteria 2294
356 Ga0501072_0159296 3300049588 Bacteria 1800
357 Ga0501073_0062499 3300049589 Bacteria 2597
358 Ga0501073_0063426 3300049589 Bacteria 2577
359 Ga0501073_0110971 3300049589 Bacteria 1902
360 Ga0501074_0145883 3300049590 Bacteria 1692
361 Ga0501076_0006544 3300049592 Bacteria 8454
362 Ga0501076_0223679 3300049592 Bacteria 1538
363 Ga0501077_0012166 3300049593 Bacteria 5386
364 Ga0501077_0058433 3300049593 Bacteria 2448
365 Ga0501077_0150901 3300049593 Bacteria 1475
366 Ga0501079_0029095 3300049741 Bacteria 4241
367 Ga0501079_0035419 3300049741 Bacteria 3842
368 Ga0501079_0134067 3300049741 Bacteria 1928
369 Ga0501079_0354313 3300049741 Bacteria 1150
370 Ga0501080_0004334 3300049742 Bacteria 12599
371 Ga0501080_0226303 3300049742 Bacteria 1710
372 Ga0501081_0128917 3300049743 Bacteria 1806
373 Ga0501035_0076002 3300049822 Bacteria 2970
374 Ga0501035_0253880 3300049822 Bacteria 1492
375 Ga0501035_0456514 3300049822 Bacteria 1056
376 Ga0501044_0048836 3300049823 Bacteria 4369
377 Ga0501044_0145344 3300049823 Bacteria 2357
378 nmdc:mga03n38_36871_c1 3300050490 Bacteria 2105
379 nmdc:mga0yw44_95218_c1 3300050492 Bacteria 1888
380 nmdc:mga05p37_1060_c1 3300050507 Bacteria 31438
381 nmdc:mga05p37_872532_c1 3300050507 Bacteria 974
382 nmdc:mga09592_473_c1 3300050508 Bacteria 30066
383 nmdc:mga0qj67_283423_c1 3300050509 Bacteria 1343
384 nmdc:mga0qj67_33539_c1 3300050509 Bacteria 4007
385 nmdc:mga06r32_1253_c1 3300050510 Bacteria 22855
386 nmdc:mga08y16_12369_c1 3300050511 Bacteria 8973
387 nmdc:mga08y16_250739_c1 3300050511 Bacteria 1829
388 nmdc:mga0n895_53465_c1 3300050512 Bacteria 3968
389 nmdc:mga0a205_7314_c1 3300050515 Bacteria 9990
390 Ga0500577_0003554 3300053142 Bacteria 4054
391 Ga0500600_0068509 3300053149 Bacteria 1953
392 Ga0501084_0011337 3300054114 Bacteria 7383
393 Ga0501084_0014874 3300054114 Bacteria 6454
394 Ga0501082_0024089 3300060353 Bacteria 5250
395 Ga0501082_0070930 3300060353 Bacteria 3000
396 Ga0530510_0016088 3300061734 Bacteria 5288
397 8055070916 8055066027 Bacteria 9479577
398 Ga0307409_100091431
399 rootL2_10122306
400 Ga0070683_100029935
401 Ga0070670_100190198
402 Ga0068869_100041705
403 Ga0068869_100045910
404 Ga0068869_100215687
405 Ga0070666_10201947
406 Ga0070680_100216322
407 Ga0070682_100064998
408 Ga0068868_100045597
409 Ga0068868_100058777
410 Ga0070660_100060726
411 Ga0070689_100051603
412 Ga0070661_100170674
413 Ga0070692_10057156
414 Ga0070692_10088828
415 Ga0070668_100000212
416 Ga0070668_100025515
417 Ga0070668_100049999
418 Ga0070668_100292025
419 Ga0070669_100194388
420 Ga0070675_100063442
421 Ga0070671_100306668
422 Ga0070674_100173375
423 Ga0070674_100187165
424 Ga0070659_100135593
425 Ga0070667_100293486
426 Ga0070703_10023803
427 Ga0070709_10336012
428 Ga0070714_100065406
429 Ga0070714_100065967
430 Ga0070714_100077501
431 Ga0070714_100323476
432 Ga0070713_100045459
433 Ga0070713_100072565
434 Ga0070713_100150698
435 Ga0070701_10023961
436 Ga0070701_10027707
437 Ga0070705_100056301
438 Ga0070700_100023771
439 Ga0070700_100099434
440 Ga0070694_100023488
441 Ga0070663_100025079
442 Ga0070663_100070906
443 Ga0070678_100064029
444 Ga0070678_100088322
445 Ga0070678_100509846
446 Ga0070662_100022596
447 Ga0068867_100184755
448 Ga0070685_10003535
449 Ga0070707_100000727
450 Ga0068853_100137542
451 Ga0070686_100014678
452 Ga0070696_100142077
453 Ga0070665_100004500
454 Ga0070665_100183061
455 Ga0070704_100169248
456 Ga0068855_100033775
457 Ga0068855_100041015
458 Ga0070664_100086798
459 Ga0068857_100190581
460 Ga0068857_100235368
461 Ga0068856_100300241
462 Ga0068856_100525388
463 Ga0068852_100073633
464 Ga0068852_100084381
465 Ga0068852_100825386
466 Ga0068859_100184828
467 Ga0068864_100043563
468 Ga0068864_100161437
469 Ga0068861_100023394
470 Ga0068861_100094446
471 Ga0068863_100082561
472 Ga0068858_100233561
473 Ga0068858_100273524
474 Ga0068860_100044928
475 Ga0068860_100073099
476 Ga0068860_100207753
477 Ga0068862_100059103
478 Ga0068862_100264212
479 Ga0068862_100606549
480 Ga0081455_10002213
481 Ga0081455_10008340
482 Ga0081455_10042032
483 Ga0081538_10000592
484 Ga0081538_10004762
485 Ga0081538_10007675
486 Ga0081538_10008641
487 Ga0081539_10001609
488 Ga0081539_10014136
489 Ga0081539_10060079
490 Ga0070717_10248487
491 Ga0075365_10001200
492 Ga0075365_10011016
493 Ga0075363_100020717
494 Ga0070716_100090877
495 Ga0070712_100019005
496 Ga0097621_100148131
497 Ga0075428_100002893
498 Ga0075428_100082524
499 Ga0075428_100169480
500 Ga0075428_100222158
501 Ga0075430_100028903
502 Ga0075430_100316251
503 Ga0075431_100001317
504 Ga0075431_100361223
505 Ga0075433_10063370
506 Ga0075434_100582379
507 Ga0075429_100027075
508 Ga0075436_100079560
509 Ga0097620_100184835
510 Ga0075435_100167932
511 Ga0105240_10365572
512 Ga0111539_10006118
513 Ga0111539_10160776
514 Ga0111539_10256585
515 Ga0111539_10444547
516 Ga0105245_10001368
517 Ga0105245_10006706
518 Ga0105247_10013975
519 Ga0105243_10260670
520 Ga0105243_10339991
521 Ga0105243_10393516
522 Ga0105243_10553778
523 Ga0105241_10302563
524 Ga0105242_10384298
525 Ga0105248_10718710
526 Ga0105237_10034796
527 Ga0105237_10072711
528 Ga0105237_10471765
529 Ga0105238_10161112
530 Ga0105238_10240622
531 Ga0105238_10346831
532 Ga0105249_10011539
533 Ga0105249_10041735
534 Ga0105239_10069990
535 Ga0105239_10098864
536 Ga0105239_10111069
537 Ga0105246_10010021
538 Ga0157370_10165620
539 Ga0157374_10227546
540 Ga0157378_10033110
541 Ga0163162_10486660
542 Ga0157372_10184629
543 Ga0157372_10204957
544 Ga0157372_10692480
545 Ga0157375_10024885
546 Ga0163163_10016998
547 Ga0163163_10394554
548 Ga0163163_10717386
549 Ga0157380_10176336
550 Ga0157377_10011012
551 Ga0157377_10208748
552 Ga0157379_10024682
553 Ga0157379_10182272
554 Ga0163161_10023962
555 Ga0213876_10022150
556 Ga0207692_10069255
557 Ga0207710_10078075
558 Ga0207688_10003541
559 Ga0207688_10029076
560 Ga0207688_10080684
561 Ga0207688_10280220
562 Ga0207680_10017580
563 Ga0207647_10128182
564 Ga0207699_10212185
565 Ga0207654_10060165
566 Ga0207671_10043838
567 Ga0207671_10292633
568 Ga0207693_10008214
569 Ga0207663_10257062
570 Ga0207662_10179851
571 Ga0207657_10073917
572 Ga0207657_10238995
573 Ga0207649_10107220
574 Ga0207646_10000149
575 Ga0207659_10297942
576 Ga0207687_10005717
577 Ga0207687_10043271
578 Ga0207700_10016544
579 Ga0207664_10031101
580 Ga0207664_10034329
581 Ga0207664_10111388
582 Ga0207690_10142346
583 Ga0207706_10014143
584 Ga0207709_10253270
585 Ga0207670_10187825
586 Ga0207669_10165381
587 Ga0207669_10179812
588 Ga0207704_10291246
589 Ga0207665_10003061
590 Ga0207711_10362773
591 Ga0207689_10049326
592 Ga0207689_10249789
593 Ga0207679_10296379
594 Ga0207679_10372079
595 Ga0207667_10040228
596 Ga0207651_10075221
597 Ga0207712_10022598
598 Ga0207712_10149278
599 Ga0207712_10226632
600 Ga0207668_10000202
601 Ga0207668_10001219
602 Ga0207668_10017229
603 Ga0207668_10036715
604 Ga0207668_10127757
605 Ga0207640_10036761
606 Ga0207677_10002048
607 Ga0207677_10145782
608 Ga0207703_10049561
609 Ga0207703_10058709
610 Ga0207703_10182344
611 Ga0207678_10008530
612 Ga0207678_10104302
613 Ga0207708_10024326
614 Ga0207708_10064326
615 Ga0207708_10108776
616 Ga0207702_10184578
617 Ga0207702_10215961
618 Ga0207641_10083359
619 Ga0207641_10242910
620 Ga0207648_10439485
621 Ga0207676_10049477
622 Ga0207676_10107411
623 Ga0207676_10150424
624 Ga0207674_10066159
625 Ga0207674_10074204
626 Ga0207675_100019914
627 Ga0207675_100064247
628 Ga0207675_100078048
629 Ga0207675_100116925
630 Ga0207683_10068415
631 Ga0207683_10154952
632 Ga0207428_10020955
633 Ga0207428_10128900
634 Ga0207428_10171501
635 Ga0268266_10045877
636 Ga0268265_10081674
637 Ga0268265_10148375
638 Ga0268265_10162699
639 Ga0268265_10435368
640 Ga0268264_10097993
641 Ga0268264_10131598
642 Ga0268264_10410136
643 Ga0307515_10018826
644 Ga0307511_10144635
645 Ga0307512_10037487
646 Ga0307513_10183706
647 Ga0307408_100313852
648 Ga0307408_100462202
649 Ga0307516_10022434
650 Ga0307405_10051147
651 Ga0307405_10064114
652 Ga0307405_10136567
653 Ga0307405_10155332
654 Ga0307405_10215827
655 Ga0307413_10017736
656 Ga0307413_10181084
657 Ga0307413_10349213
658 Ga0307410_10013834
659 Ga0307410_10059614
660 Ga0307410_10096962
661 Ga0307410_10122603
662 Ga0307410_10476325
663 Ga0326468_10000878
664 Ga0307406_10012599
665 Ga0307406_10093181
666 Ga0307407_10028485
667 Ga0307407_10135157
668 Ga0307412_10009566
669 Ga0307409_100005628
670 Ga0307409_100005717
671 Ga0307409_100060718
672 Ga0307409_100129414
673 Ga0307409_100206460
674 Ga0307409_100226423
675 Ga0307409_100782800
676 Ga0307416_100000220
677 Ga0307416_100264585
678 Ga0307416_100430339
679 Ga0307416_100523515
680 Ga0307414_10133566
681 Ga0307411_10485552
682 Ga0307415_100000053
683 Ga0307415_100046871
684 Ga0307415_100065359
685 Ga0307415_100117892
686 Ga0307415_100289005
687 Ga0373929_0005861
688 Ga0373940_0008667
689 Ga0373931_0008382
690 Ga0395900_0081518
691 Ga0395898_0016693
692 Ga0395905_0140286
693 Ga0436365_0086732
694 Ga0466963_0102020
695 Ga0466971_0014474
696 Ga0466970_0001586
697 Ga0466960_0018667
698 Ga0466959_0128106
699 Ga0466967_0009633
700 Ga0466967_0030683
701 Ga0466967_0105284
702 Ga0495631_0092655
703 Ga0495625_0221721
704 Ga0495676_0093404
705 Ga0496101_0104270
706 Ga0496101_0115707
707 Ga0496103_0040200
708 Ga0496104_0045943
709 Ga0496104_0076061
710 Ga0496105_0243861
711 Ga0496106_0068635
712 Ga0496107_0260173
713 Ga0496108_0010966
714 Ga0496108_0053814
715 Ga0496108_0076653
716 Ga0496109_0004112
717 Ga0496109_0017228
718 Ga0496109_0027986
719 Ga0496109_0086769
720 Ga0496109_0097058
721 Ga0496110_0005198
722 Ga0496110_0064422
723 Ga0496110_0112978
724 Ga0496110_0578930
725 Ga0496111_0032701
726 Ga0496111_0080385
727 Ga0496111_0092219
728 Ga0496112_0086444
729 Ga0496112_0158817
730 Ga0496112_0186559
731 Ga0496112_0353213
732 Ga0496113_0123348
733 Ga0496114_0201236
734 Ga0496115_0045373
735 Ga0496115_0145681
736 Ga0501031_0051086
737 Ga0501034_0014036
738 Ga0501034_0030057
739 Ga0501034_0399370
740 Ga0501034_0609659
741 Ga0501036_0074703
742 Ga0501038_0000113
743 Ga0501038_0050933
744 Ga0501043_0296187
745 Ga0501046_0085090
746 Ga0501047_0123328
747 Ga0501067_0011257
748 Ga0501068_0038881
749 Ga0501068_0094324
750 Ga0501071_0004136
751 Ga0501071_0133012
752 Ga0501072_0100866
753 Ga0501072_0159296
754 Ga0501073_0062499
755 Ga0501073_0063426
756 Ga0501073_0110971
757 Ga0501074_0145883
758 Ga0501076_0006544
759 Ga0501076_0223679
760 Ga0501077_0012166
761 Ga0501077_0058433
762 Ga0501077_0150901
763 Ga0501079_0029095
764 Ga0501079_0035419
765 Ga0501079_0134067
766 Ga0501079_0354313
767 Ga0501080_0004334
768 Ga0501080_0226303
769 Ga0501081_0128917
770 Ga0501035_0076002
771 Ga0501035_0253880
772 Ga0501035_0456514
773 Ga0501044_0048836
774 Ga0501044_0145344
775 nmdc:mga03n38_36871_c1
776 nmdc:mga0yw44_95218_c1
777 nmdc:mga05p37_1060_c1
778 nmdc:mga05p37_872532_c1
779 nmdc:mga09592_473_c1
780 nmdc:mga0qj67_283423_c1
781 nmdc:mga0qj67_33539_c1
782 nmdc:mga06r32_1253_c1
783 nmdc:mga08y16_12369_c1
784 nmdc:mga08y16_250739_c1
785 nmdc:mga0n895_53465_c1
786 nmdc:mga0a205_7314_c1
787 Ga0500577_0003554
788 Ga0500600_0068509
789 Ga0501084_0011337
790 Ga0501084_0014874
791 Ga0501082_0024089
792 Ga0501082_0070930
793 Ga0530510_0016088
794 8055070916

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00126

HTH_1

Bacterial regulatory helix-turn-helix protein, lysR family

4

63

0.98

PF03466

LysR_substrate

LysR substrate binding domain

88

287

0.95

PF01022

HTH_5

Bacterial regulatory protein, arsR family

3

43

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7trv-assembly1.cif.gz_A crystal structure of the dna-binding domain of the lysr family transcriptional regulator yfba from yersinia pestis 0.9261 4 85
7trv-assembly1.cif.gz_B crystal structure of the dna-binding domain of the lysr family transcriptional regulator yfba from yersinia pestis 0.9136 1 85
4pzj-assembly1.cif.gz_A-2 1.60 angstrom resolution crystal structure of a transcriptional regulator of the lysr family from eggerthella lenta dsm 2243 0.898 5 70
4ihs-assembly1.cif.gz_A crystal structure of benm_dbd/catb site 1 dna complex 0.8934 4 85
4ihs-assembly3.cif.gz_C crystal structure of benm_dbd/catb site 1 dna complex 0.8869 4 86
ID Description Score Start End Superfamily
af_P52696_4_93_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9489 4 83 1.10.10.10
af_P10151_15_101_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9375 1 77 1.10.10.10
af_P30979_21_108_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9372 4 79 1.10.10.10
af_P03030_3_92_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.935 1 86 1.10.10.10
2esnD01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9312 4 83 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A6N3U979-F1-model_v4 deleted 0.9375 4 74
AF-A0A7Y8HXQ6-F1-model_v4 LysR family transcriptional regulator 0.9369 3 77 GO:0000976
GO:0003700
AF-A0A0F4JEL2-F1-model_v4 LysR family transcriptional regulator 0.9337 4 77 GO:0003677
GO:0003700
GO:0032993
AF-A0A3S4IF02-F1-model_v4 Cat operon transcriptional regulator 0.9131 1 85 GO:0000976
GO:0003700
AF-A0A258CPL3-F1-model_v4 LysR family transcriptional regulator 0.9016 4 83 GO:0003700
GO:0006351
GO:0043565

Map