F433803

General Info

Members Datasets Scaffolds Average Seq Length
397 281 263 182

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10052274|Ga0307513_100522742
Length 190
Sequence MRYFLTLASLVSALLITGCEDEKNSPPPAPFALTAEAIGRYCGMNVLEHAGPKGQVILDAKVGEPIWFSSARDTLAFTMLPEEPKDYAAVYVSDMGKAPSWEKPGATNWIDAKKAFYVIGSAVRGGMGADEAVPFSTRDAADKFAVENGGKVMSFEEVPRDYVLGGGETEKAKDLTPVSKQEDVKGNDHG

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
3 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
4 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
5 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
6 2516143018 Ensifer sp. BR816 Isolate Nodule
7 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
8 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
9 2534681786 Brucella suis 92/29 Isolate Unclassified
10 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
11 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
12 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
13 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
14 2643221582 Rhizobium sp. Root651 Isolate Unclassified
15 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
16 2643221618 Ensifer sp. Root231 Isolate Unclassified
17 2643221626 Ensifer sp. Root31 Isolate Unclassified
18 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
19 2643221655 Ensifer sp. Root1252 Isolate Unclassified
20 2643221659 Ensifer sp. Root127 Isolate Unclassified
21 2643221688 Rhizobium sp. Root482 Isolate Unclassified
22 2643221698 Ensifer sp. Root142 Isolate Unclassified
23 2643221712 Ensifer sp. Root258 Isolate Unclassified
24 2773857925 Microvirga vignae BR3299 Isolate Unclassified
25 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
26 2802429634 Rhizobium anhuiense S10 Isolate Nodule
27 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
28 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
29 2844163670 Ensifer sp. 1H6 Isolate Unclassified
30 2854911287 Brucella lupini LUP21 Isolate Unclassified
31 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
32 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
33 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
34 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
35 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
36 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
37 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
38 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
39 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
40 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
41 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
42 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
43 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
44 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
45 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
46 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
47 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
48 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
49 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
50 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
51 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
52 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
53 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
54 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
55 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
56 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
57 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
58 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
59 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
60 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
61 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
62 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
63 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
64 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
65 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
66 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
67 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
68 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
69 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
70 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
71 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
72 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
73 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
74 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
75 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
76 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
77 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
78 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
79 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
80 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
81 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
82 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
83 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
84 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
85 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
86 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
87 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
88 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
89 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
90 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
91 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
92 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
93 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
94 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
95 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
96 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
97 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
98 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
99 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
100 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
101 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
102 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
103 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
104 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
105 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
106 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
107 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
108 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
109 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
110 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
111 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
112 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
113 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
114 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
115 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
116 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
117 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
118 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
119 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
120 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
121 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
122 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
123 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
124 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
125 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
126 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
127 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
128 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
129 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
130 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
131 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
132 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
133 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
134 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
135 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
136 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
137 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
138 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
139 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
140 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
141 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
142 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
143 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
144 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
145 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
146 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
147 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
148 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
149 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
150 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
151 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
152 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
153 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
154 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
155 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
156 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
157 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
158 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
159 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
160 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
161 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
162 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
163 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
164 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
165 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
166 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
167 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
168 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
171 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
173 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
175 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
176 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
193 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
194 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
195 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
196 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
197 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
198 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
199 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
200 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
201 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
202 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
203 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
204 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
205 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
206 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
207 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
208 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
209 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
210 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
211 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
212 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
213 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
216 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
217 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
220 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
221 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
222 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
223 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
224 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
225 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
226 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
227 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
228 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
229 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
230 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
231 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
232 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
248 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
249 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
250 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
251 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
252 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
253 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
254 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
255 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
256 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
257 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
260 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
261 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
262 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
263 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
264 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
265 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
266 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
267 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
268 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
269 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
270 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
271 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
272 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
273 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
274 641522639 Methylobacterium sp. 4-46 Isolate Nodule
275 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
276 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
277 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
278 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
279 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
280 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
281 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 65.99
Metatranscriptomes 0.25
Isolates 33.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.08
Nodule 28.21
Rhizoplane 3.27
Rhizosphere 45.34
Stem 0
Stem Tuber 0
Unclassified 13.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006562J51391_1002919 3300003578 Bacteria 10390
2 Ga0055524_1053670 3300003775 Bacteria 890
3 Ga0055531_10048687 3300003794 Bacteria 1140
4 Ga0055543_1003312 3300004625 Bacteria 4829
5 Ga0065165_1000309 3300005262 Bacteria 80166
6 Ga0065165_1004535 3300005262 Bacteria 8493
7 Ga0070683_100202175 3300005329 Bacteria 1887
8 Ga0070680_100040100 3300005336 Bacteria 3790
9 Ga0070682_100109858 3300005337 Bacteria 1836
10 Ga0070668_100409909 3300005347 Bacteria 1159
11 Ga0070681_10019544 3300005458 Bacteria 6783
12 Ga0070681_10155638 3300005458 Bacteria 2211
13 Ga0068867_100794678 3300005459 Unclassified 843
14 Ga0070679_100006235 3300005530 Bacteria 11106
15 Ga0070679_100039892 3300005530 Bacteria 4668
16 Ga0070684_100009000 3300005535 Bacteria 7844
17 Ga0070686_101089817 3300005544 Bacteria 659
18 Ga0070665_100119572 3300005548 Bacteria 2636
19 Ga0068857_100080782 3300005577 Bacteria 2903
20 Ga0068856_100754632 3300005614 Bacteria 993
21 Ga0068858_101175031 3300005842 Bacteria 754
22 Ga0075365_10184070 3300006038 Bacteria 1461
23 Ga0075368_10048196 3300006042 Bacteria 1688
24 Ga0075364_10000039 3300006051 Bacteria 45751
25 Ga0070715_10314527 3300006163 Bacteria 843
26 Ga0075367_10149673 3300006178 Bacteria 1448
27 Ga0075367_10228203 3300006178 Bacteria 1166
28 Ga0075369_10282511 3300006186 Bacteria 773
29 Ga0079104_1000216 3300006946 Bacteria 80738
30 Ga0079104_1045317 3300006946 Bacteria 1004
31 Ga0105240_10658280 3300009093 Bacteria 1147
32 Ga0111539_11585968 3300009094 Bacteria 759
33 Ga0114129_10635201 3300009147 Bacteria 1379
34 Ga0105237_10225038 3300009545 Bacteria 1876
35 Ga0105237_11363020 3300009545 Bacteria 716
36 Ga0105238_10255772 3300009551 Bacteria 1730
37 Ga0105249_10613648 3300009553 Bacteria 1143
38 Ga0105249_11388072 3300009553 Unclassified 774
39 Ga0105239_11025146 3300010375 Bacteria 949
40 Ga0105239_11264533 3300010375 Bacteria 851
41 Ga0105246_10784965 3300011119 Bacteria 844
42 Ga0157369_10403302 3300013105 Bacteria 1418
43 Ga0171462_1043 3300013250 Bacteria 56604
44 Ga0163162_10519307 3300013306 Bacteria 1320
45 Ga0157375_11013560 3300013308 Bacteria 969
46 Ga0163163_10461905 3300014325 Bacteria 1330
47 Ga0163163_11276782 3300014325 Unclassified 796
48 Ga0182008_10175225 3300014497 Bacteria 1084
49 Ga0157379_10270990 3300014968 Bacteria 1544
50 Ga0207425_1039987 3300025245 Bacteria 897
51 Ga0209677_101017 3300025253 Bacteria 13404
52 Ga0209455_1001272 3300025272 Bacteria 11813
53 Ga0209455_1024619 3300025272 Bacteria 1109
54 Ga0209673_1011211 3300025273 Bacteria 3709
55 Ga0209676_1016303 3300025292 Bacteria 2688
56 Ga0209564_1000189 3300025295 Bacteria 144041
57 Ga0209050_1007751 3300025298 Bacteria 5921
58 Ga0209256_1001306 3300025299 Bacteria 26768
59 Ga0209256_1007725 3300025299 Bacteria 5208
60 Ga0207426_1001105 3300025302 Bacteria 24832
61 Ga0207426_1026351 3300025302 Bacteria 1948
62 Ga0207426_1073327 3300025302 Bacteria 948
63 Ga0209051_1042882 3300025303 Bacteria 1594
64 Ga0209257_1009098 3300025304 Bacteria 5429
65 Ga0209257_1025476 3300025304 Bacteria 2020
66 Ga0207654_10111631 3300025911 Bacteria 1702
67 Ga0207707_10026734 3300025912 Bacteria 5043
68 Ga0207695_10058399 3300025913 Bacteria 4004
69 Ga0207660_10053424 3300025917 Bacteria 2879
70 Ga0207652_10016779 3300025921 Bacteria 5984
71 Ga0207652_10039831 3300025921 Bacteria 3989
72 Ga0207694_10461825 3300025924 Bacteria 1061
73 Ga0207689_10874363 3300025942 Unclassified 758
74 Ga0207661_10002979 3300025944 Bacteria 11707
75 Ga0207661_10217138 3300025944 Bacteria 1688
76 Ga0207639_10261869 3300026041 Bacteria 1513
77 Ga0207708_10597555 3300026075 Bacteria 934
78 Ga0207702_10581800 3300026078 Bacteria 1097
79 Ga0207674_10174364 3300026116 Bacteria 2103
80 Ga0207675_100278545 3300026118 Bacteria 1625
81 Ga0207683_10124738 3300026121 Bacteria 2314
82 Ga0209281_1000472 3300027111 Bacteria 56483
83 Ga0209281_1001540 3300027111 Bacteria 12810
84 Ga0307515_10143744 3300028794 Bacteria 2541
85 Ga0265340_10111539 3300031247 Bacteria 1264
86 Ga0265339_10039880 3300031249 Bacteria 2612
87 Ga0307513_10052274 3300031456 Bacteria 4400
88 Ga0307408_100534324 3300031548 Bacteria 1032
89 Ga0307408_100795271 3300031548 Bacteria 858
90 Ga0307408_100959470 3300031548 Bacteria 786
91 Ga0307516_10258919 3300031730 Bacteria 1431
92 Ga0307410_10116077 3300031852 Bacteria 1945
93 Ga0307412_10098568 3300031911 Bacteria 2062
94 Ga0307412_10953446 3300031911 Bacteria 755
95 Ga0307414_10065784 3300032004 Bacteria 2588
96 Ga0307414_10285861 3300032004 Bacteria 1388
97 Ga0307414_11246884 3300032004 Bacteria 689
98 Ga0373933_0925815 3300035724 Unclassified 574
99 Ga0395899_0091428 3300037312 Bacteria 2205
100 Ga0395900_0035890 3300037418 Bacteria 5108
101 Ga0395898_0035333 3300037466 Bacteria 4971
102 Ga0395905_0000547 3300037471 Bacteria 51364
103 Ga0395905_0006875 3300037471 Bacteria 11372
104 Ga0395905_0082236 3300037471 Bacteria 3018
105 Ga0395905_0917870 3300037471 Bacteria 779
106 Ga0395901_0015214 3300038443 Bacteria 7828
107 Ga0439465_0173871 3300041413 Bacteria 777
108 Ga0451833_0672446 3300041491 Bacteria 5746
109 Ga0451837_1626977 3300041494 Bacteria 1161
110 Ga0451855_0003628 3300041511 Bacteria 12250
111 Ga0451853_0910860 3300041512 Bacteria 25581
112 Ga0496101_0844430 3300048904 Unclassified 722
113 Ga0496106_0000833 3300048909 Bacteria 22331
114 Ga0496106_0156080 3300048909 Bacteria 1802
115 Ga0496107_0576906 3300048910 Bacteria 832
116 Ga0496110_0128438 3300048913 Bacteria 2288
117 Ga0496110_0442092 3300048913 Unclassified 1185
118 Ga0496111_0042771 3300048914 Bacteria 3254
119 Ga0496111_0616161 3300048914 Unclassified 794
120 Ga0496112_0297738 3300048915 Bacteria 1559
121 Ga0496113_0303248 3300048916 Unclassified 1279
122 Ga0496113_0452498 3300048916 Bacteria 1032
123 Ga0496115_0590233 3300048918 Bacteria 884
124 Ga0496115_0717531 3300048918 Unclassified 785
125 Ga0496116_0004881 3300048919 Bacteria 12650
126 Ga0496117_0001278 3300048920 Bacteria 37300
127 Ga0496117_0084830 3300048920 Bacteria 2065
128 Ga0496118_0020534 3300048921 Bacteria 5853
129 Ga0496118_0038740 3300048921 Bacteria 3815
130 Ga0496119_0012017 3300048922 Bacteria 7083
131 Ga0496120_0002198 3300048923 Bacteria 20614
132 Ga0496121_0002652 3300048924 Bacteria 26846
133 Ga0496121_0007809 3300048924 Bacteria 12810
134 Ga0496121_0051483 3300048924 Bacteria 3467
135 Ga0496122_0032613 3300048925 Bacteria 4303
136 Ga0496123_0005009 3300048926 Bacteria 13561
137 Ga0496124_0004071 3300048927 Bacteria 17315
138 Ga0496124_0057088 3300048927 Bacteria 3290
139 Ga0496125_0000034 3300048928 Bacteria 348231
140 Ga0496125_0073223 3300048928 Bacteria 2665
141 Ga0496125_0199052 3300048928 Bacteria 1314
142 Ga0496126_0023821 3300048929 Bacteria 5926
143 Ga0496126_0030571 3300048929 Bacteria 5099
144 Ga0496126_0050411 3300048929 Bacteria 3794
145 Ga0501031_0000381 3300049568 Bacteria 26060
146 Ga0501032_0001260 3300049569 Bacteria 20312
147 Ga0501032_0002511 3300049569 Bacteria 14334
148 Ga0501032_0149026 3300049569 Bacteria 1539
149 Ga0501033_0007576 3300049570 Bacteria 8445
150 Ga0501033_0012584 3300049570 Bacteria 6456
151 Ga0501033_0132563 3300049570 Bacteria 1804
152 Ga0501033_0135970 3300049570 Bacteria 1778
153 Ga0501033_0219967 3300049570 Bacteria 1352
154 Ga0501033_0232125 3300049570 Bacteria 1310
155 Ga0501033_0361721 3300049570 Bacteria 1015
156 Ga0501034_0000561 3300049571 Bacteria 58872
157 Ga0501034_0002233 3300049571 Bacteria 23848
158 Ga0501034_0004522 3300049571 Bacteria 15461
159 Ga0501034_0668146 3300049571 Bacteria 939
160 Ga0501034_0913356 3300049571 Bacteria 765
161 Ga0501036_0000138 3300049572 Bacteria 47432
162 Ga0501036_0015507 3300049572 Bacteria 6367
163 Ga0501036_0175873 3300049572 Bacteria 1802
164 Ga0501036_0721960 3300049572 Bacteria 823
165 Ga0501037_0001072 3300049573 Bacteria 20302
166 Ga0501037_0001995 3300049573 Bacteria 14807
167 Ga0501037_0002132 3300049573 Bacteria 14325
168 Ga0501038_0000204 3300049574 Bacteria 50812
169 Ga0501038_0010917 3300049574 Bacteria 8296
170 Ga0501038_0061312 3300049574 Bacteria 3217
171 Ga0501038_0079722 3300049574 Bacteria 2760
172 Ga0501038_0081547 3300049574 Plasmid 2725
173 Ga0501038_0467791 3300049574 Bacteria 968
174 Ga0501038_0482180 3300049574 Bacteria 950
175 Ga0501039_0000596 3300049575 Bacteria 26141
176 Ga0501039_0005796 3300049575 Bacteria 9354
177 Ga0501039_0034313 3300049575 Bacteria 3916
178 Ga0501039_0186973 3300049575 Unclassified 1629
179 Ga0501039_0370452 3300049575 Bacteria 1125
180 Ga0501040_0009682 3300049576 Bacteria 6291
181 Ga0501040_0114191 3300049576 Unclassified 1890
182 Ga0501040_0189897 3300049576 Bacteria 1457
183 Ga0501041_0056350 3300049577 Bacteria 2401
184 Ga0501041_0057356 3300049577 Bacteria 2381
185 Ga0501042_0010819 3300049578 Bacteria 6134
186 Ga0501042_0046396 3300049578 Bacteria 3097
187 Ga0501042_0369288 3300049578 Bacteria 1038
188 Ga0501043_0007600 3300049579 Bacteria 8595
189 Ga0501043_0029585 3300049579 Bacteria 4304
190 Ga0501043_0088491 3300049579 Bacteria 2434
191 Ga0501043_0193882 3300049579 Bacteria 1579
192 Ga0501046_0002348 3300049580 Bacteria 17844
193 Ga0501046_0060059 3300049580 Bacteria 2976
194 Ga0501046_0127850 3300049580 Bacteria 1929
195 Ga0501046_0129756 3300049580 Bacteria 1912
196 Ga0501046_0206889 3300049580 Bacteria 1458
197 Ga0501047_0002857 3300049581 Bacteria 16379
198 Ga0501047_0003702 3300049581 Bacteria 14394
199 Ga0501047_0028397 3300049581 Bacteria 5393
200 Ga0501047_0165620 3300049581 Bacteria 2081
201 Ga0501047_0179372 3300049581 Bacteria 1984
202 Ga0501048_0494066 3300049582 Bacteria 877
203 Ga0501048_0729943 3300049582 Unclassified 711
204 Ga0501067_0001279 3300049583 Bacteria 13638
205 Ga0501067_0123412 3300049583 Bacteria 1441
206 Ga0501067_0129851 3300049583 Bacteria 1402
207 Ga0501067_0146474 3300049583 Bacteria 1316
208 Ga0501070_0008260 3300049586 Bacteria 8802
209 Ga0501070_0010319 3300049586 Bacteria 7896
210 Ga0501070_0010869 3300049586 Bacteria 7690
211 Ga0501070_0070413 3300049586 Bacteria 2896
212 Ga0501070_0196306 3300049586 Bacteria 1658
213 Ga0501070_0869569 3300049586 Bacteria 704
214 Ga0501071_0021247 3300049587 Unclassified 4518
215 Ga0501071_0347319 3300049587 Unclassified 1129
216 Ga0501073_0163839 3300049589 Bacteria 1540
217 Ga0501074_0034082 3300049590 Bacteria 3691
218 Ga0501074_0459138 3300049590 Unclassified 903
219 Ga0501075_0227739 3300049591 Bacteria 1421
220 Ga0501077_0410976 3300049593 Bacteria 865
221 Ga0501079_0024794 3300049741 Bacteria 4601
222 Ga0501079_0068544 3300049741 Unclassified 2738
223 Ga0501079_0267580 3300049741 Bacteria 1336
224 Ga0501080_0000159 3300049742 Bacteria 48535
225 Ga0501080_0017987 3300049742 Bacteria 6543
226 Ga0501080_0540968 3300049742 Bacteria 1038
227 Ga0501081_0026019 3300049743 Unclassified 3942
228 Ga0501081_0310360 3300049743 Bacteria 1158
229 Ga0501035_0000473 3300049822 Bacteria 45096
230 Ga0501035_0000623 3300049822 Bacteria 39011
231 Ga0501035_0012567 3300049822 Bacteria 7823
232 Ga0501035_0012679 3300049822 Bacteria 7789
233 Ga0501035_0037754 3300049822 Bacteria 4372
234 Ga0501035_0178362 3300049822 Bacteria 1831
235 Ga0501044_0000115 3300049823 Bacteria 96999
236 Ga0501044_0000441 3300049823 Bacteria 50812
237 Ga0501044_0000505 3300049823 Bacteria 47475
238 Ga0501044_0035159 3300049823 Bacteria 5248
239 Ga0501044_0052901 3300049823 Bacteria 4180
240 Ga0501044_0063189 3300049823 Bacteria 3783
241 Ga0501044_0109953 3300049823 Bacteria 2765
242 Ga0501044_1018636 3300049823 Bacteria 699
243 Ga0501045_0017086 3300049824 Bacteria 5152
244 Ga0501045_0405301 3300049824 Bacteria 1015
245 nmdc:mga00v17_122_c1 3300050491 Bacteria 45788
246 nmdc:mga0yw44_393435_c1 3300050492 Bacteria 936
247 nmdc:mga06z11_21083_c1 3300050494 Bacteria 1209
248 nmdc:mga07m45_331569_c1 3300050496 Bacteria 884
249 nmdc:mga07m45_335604_c1 3300050496 Bacteria 878
250 nmdc:mga0sz30_73231_c1 3300050516 Bacteria 1476
251 Ga0500651_0248203 3300053093 Bacteria 1036
252 Ga0500608_094352 3300053122 Bacteria 1394
253 Ga0500658_0000940 3300053134 Bacteria 11882
254 Ga0500568_0000819 3300053139 Bacteria 21859
255 Ga0500622_0000101 3300053156 Bacteria 86856
256 Ga0500627_0056146 3300053158 Bacteria 1726
257 Ga0500627_0284929 3300053158 Unclassified 724
258 Ga0501084_0167681 3300054114 Bacteria 1853
259 Ga0501082_0040819 3300060353 Bacteria 4001
260 Ga0501082_0085399 3300060353 Bacteria 2722
261 Ga0501082_0130080 3300060353 Bacteria 2184
262 Ga0501082_0262301 3300060353 Bacteria 1503
263 Ga0530510_0000705 3300061734 Bacteria 21694

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003794 Ga0055531_10048687 Ga0055531_100486872 151
2 3300025304 Ga0209257_1009098 Ga0209257_10090985 151
3 3300013250 Ga0171462_1043 Ga0171462_104334 152
4 3300009545 Ga0105237_11363020 Ga0105237_113630202 153
5 3300050496 nmdc:mga07m45_331569_c1 nmdc:mga07m45_331569_c1_258_800 153
6 3300006042 Ga0075368_10048196 Ga0075368_100481962 158
7 3300006178 Ga0075367_10228203 Ga0075367_102282032 158
8 3300050494 nmdc:mga06z11_21083_c1 nmdc:mga06z11_21083_c1_624_1181 158
9 3300041413 Ga0439465_0173871 Ga0439465_0173871_209_766 159
10 3300049583 Ga0501067_0129851 Ga0501067_0129851_275_793 159
11 3300003775 Ga0055524_1053670 Ga0055524_10536702 160
12 3300014968 Ga0157379_10270990 Ga0157379_102709902 160
13 3300025273 Ga0209673_1011211 Ga0209673_10112114 160
14 3300025299 Ga0209256_1007725 Ga0209256_10077252 160
15 3300025302 Ga0207426_1001105 Ga0207426_10011057 160
16 3300025942 Ga0207689_10874363 Ga0207689_108743631 160
17 3300048904 Ga0496101_0844430 Ga0496101_0844430_167_691 160
18 3300049571 Ga0501034_0000561 Ga0501034_0000561_42223_42759 160
19 3300049572 Ga0501036_0175873 Ga0501036_0175873_1249_1785 160
20 3300049573 Ga0501037_0001995 Ga0501037_0001995_2572_3108 160
21 3300049574 Ga0501038_0081547 Ga0501038_0081547_35_571 160
22 3300049575 Ga0501039_0005796 Ga0501039_0005796_1312_1848 160
23 3300049579 Ga0501043_0088491 Ga0501043_0088491_946_1482 160
24 3300049580 Ga0501046_0002348 Ga0501046_0002348_12722_13258 160
25 3300049581 Ga0501047_0179372 Ga0501047_0179372_226_762 160
26 3300049582 Ga0501048_0729943 Ga0501048_0729943_137_673 160
27 3300049583 Ga0501067_0001279 Ga0501067_0001279_3868_4404 160
28 3300049583 Ga0501067_0146474 Ga0501067_0146474_519_1070 160
29 3300049586 Ga0501070_0010319 Ga0501070_0010319_6460_6996 160
30 3300049590 Ga0501074_0459138 Ga0501074_0459138_198_734 160
31 3300049742 Ga0501080_0000159 Ga0501080_0000159_44694_45230 160
32 3300049822 Ga0501035_0000623 Ga0501035_0000623_13018_13554 160
33 3300049823 Ga0501044_0000115 Ga0501044_0000115_18461_18997 160
34 3300060353 Ga0501082_0130080 Ga0501082_0130080_1576_2112 160
35 3300060353 Ga0501082_0262301 Ga0501082_0262301_172_723 160
36 iso_pu_bacteria 2513237144 2513910089 160
37 iso_pu_bacteria 2933016740 2933017063 160
38 3300014497 Ga0182008_10175225 Ga0182008_101752252 161
39 3300049569 Ga0501032_0149026 Ga0501032_0149026_610_1140 161
40 3300049570 Ga0501033_0135970 Ga0501033_0135970_939_1469 161
41 3300049570 Ga0501033_0361721 Ga0501033_0361721_377_895 161
42 3300049572 Ga0501036_0721960 Ga0501036_0721960_100_630 161
43 3300049574 Ga0501038_0482180 Ga0501038_0482180_36_554 161
44 3300049581 Ga0501047_0165620 Ga0501047_0165620_1339_1869 161
45 3300049593 Ga0501077_0410976 Ga0501077_0410976_38_565 161
46 3300049741 Ga0501079_0068544 Ga0501079_0068544_493_1020 161
47 3300049822 Ga0501035_0037754 Ga0501035_0037754_1336_1866 161
48 3300049823 Ga0501044_0035159 Ga0501044_0035159_949_1479 161
49 iso_pu_bacteria 2643221564 2643837120 161
50 iso_pu_bacteria 2643221595 2643989822 161
51 iso_pu_bacteria 2643221627 2644153475 161
52 3300049569 Ga0501032_0002511 Ga0501032_0002511_11990_12520 162
53 3300049570 Ga0501033_0012584 Ga0501033_0012584_1141_1671 162
54 3300049570 Ga0501033_0132563 Ga0501033_0132563_579_1109 162
55 3300049571 Ga0501034_0004522 Ga0501034_0004522_11990_12520 162
56 3300049573 Ga0501037_0002132 Ga0501037_0002132_1806_2336 162
57 3300049574 Ga0501038_0010917 Ga0501038_0010917_4212_4742 162
58 3300049579 Ga0501043_0029585 Ga0501043_0029585_1451_1981 162
59 3300049581 Ga0501047_0003702 Ga0501047_0003702_6946_7476 162
60 3300049742 Ga0501080_0540968 Ga0501080_0540968_228_758 162
61 3300049822 Ga0501035_0012567 Ga0501035_0012567_6690_7220 162
62 3300049823 Ga0501044_0000505 Ga0501044_0000505_42690_43220 162
63 3300049824 Ga0501045_0405301 Ga0501045_0405301_236_766 162
64 3300037471 Ga0395905_0082236 Ga0395905_0082236_118_669 163
65 3300048928 Ga0496125_0199052 Ga0496125_0199052_370_903 163
66 3300049574 Ga0501038_0467791 Ga0501038_0467791_141_677 163
67 3300049581 Ga0501047_0028397 Ga0501047_0028397_2673_3221 163
68 3300004625 Ga0055543_1003312 Ga0055543_10033123 164
69 3300005262 Ga0065165_1000309 Ga0065165_100030940 164
70 3300005336 Ga0070680_100040100 Ga0070680_1000401001 164
71 3300005458 Ga0070681_10019544 Ga0070681_100195445 164
72 3300005530 Ga0070679_100006235 Ga0070679_10000623513 164
73 3300005535 Ga0070684_100009000 Ga0070684_1000090008 164
74 3300005577 Ga0068857_100080782 Ga0068857_1000807822 164
75 3300005614 Ga0068856_100754632 Ga0068856_1007546322 164
76 3300006038 Ga0075365_10184070 Ga0075365_101840702 164
77 3300009094 Ga0111539_11585968 Ga0111539_115859681 164
78 3300009147 Ga0114129_10635201 Ga0114129_106352012 164
79 3300009545 Ga0105237_10225038 Ga0105237_102250382 164
80 3300009551 Ga0105238_10255772 Ga0105238_102557723 164
81 3300009553 Ga0105249_11388072 Ga0105249_113880722 164
82 3300010375 Ga0105239_11025146 Ga0105239_110251462 164
83 3300025302 Ga0207426_1026351 Ga0207426_10263512 164
84 3300025912 Ga0207707_10026734 Ga0207707_100267343 164
85 3300025917 Ga0207660_10053424 Ga0207660_100534242 164
86 3300025921 Ga0207652_10039831 Ga0207652_100398313 164
87 3300025924 Ga0207694_10461825 Ga0207694_104618252 164
88 3300025944 Ga0207661_10002979 Ga0207661_100029795 164
89 3300026041 Ga0207639_10261869 Ga0207639_102618692 164
90 3300026078 Ga0207702_10581800 Ga0207702_105818001 164
91 3300026116 Ga0207674_10174364 Ga0207674_101743642 164
92 3300035724 Ga0373933_0925815 Ga0373933_0925815_51_563 164
93 3300049568 Ga0501031_0000381 Ga0501031_0000381_18937_19467 164
94 3300049570 Ga0501033_0007576 Ga0501033_0007576_1348_1878 164
95 3300049570 Ga0501033_0219967 Ga0501033_0219967_518_1048 164
96 3300049571 Ga0501034_0002233 Ga0501034_0002233_16725_17255 164
97 3300049572 Ga0501036_0015507 Ga0501036_0015507_1368_1913 164
98 3300049573 Ga0501037_0001072 Ga0501037_0001072_13189_13719 164
99 3300049574 Ga0501038_0061312 Ga0501038_0061312_656_1201 164
100 3300049575 Ga0501039_0186973 Ga0501039_0186973_340_885 164
101 3300049576 Ga0501040_0114191 Ga0501040_0114191_911_1456 164
102 3300049577 Ga0501041_0056350 Ga0501041_0056350_286_831 164
103 3300049578 Ga0501042_0010819 Ga0501042_0010819_478_1023 164
104 3300049578 Ga0501042_0369288 Ga0501042_0369288_299_844 164
105 3300049579 Ga0501043_0007600 Ga0501043_0007600_5131_5661 164
106 3300049580 Ga0501046_0060059 Ga0501046_0060059_760_1290 164
107 3300049580 Ga0501046_0127850 Ga0501046_0127850_1023_1553 164
108 3300049580 Ga0501046_0206889 Ga0501046_0206889_429_974 164
109 3300049581 Ga0501047_0002857 Ga0501047_0002857_9277_9807 164
110 3300049582 Ga0501048_0494066 Ga0501048_0494066_135_665 164
111 3300049586 Ga0501070_0008260 Ga0501070_0008260_1677_2207 164
112 3300049586 Ga0501070_0070413 Ga0501070_0070413_1146_1739 164
113 3300049586 Ga0501070_0869569 Ga0501070_0869569_89_679 164
114 3300049587 Ga0501071_0021247 Ga0501071_0021247_3899_4444 164
115 3300049589 Ga0501073_0163839 Ga0501073_0163839_378_929 164
116 3300049591 Ga0501075_0227739 Ga0501075_0227739_476_1021 164
117 3300049743 Ga0501081_0026019 Ga0501081_0026019_3055_3600 164
118 3300049822 Ga0501035_0012679 Ga0501035_0012679_4266_4796 164
119 3300049823 Ga0501044_0063189 Ga0501044_0063189_2685_3215 164
120 3300049823 Ga0501044_1018636 Ga0501044_1018636_55_648 164
121 3300049824 Ga0501045_0017086 Ga0501045_0017086_2978_3523 164
122 3300050492 nmdc:mga0yw44_393435_c1 nmdc:mga0yw44_393435_c1_202_744 164
123 3300054114 Ga0501084_0167681 Ga0501084_0167681_453_998 164
124 3300060353 Ga0501082_0040819 Ga0501082_0040819_1611_2159 164
125 3300060353 Ga0501082_0085399 Ga0501082_0085399_1796_2341 164
126 3300061734 Ga0530510_0000705 Ga0530510_0000705_3426_3971 164
127 iso_pu_bacteria 2524023210 2524463751 164
128 iso_pu_bacteria 2903768456 2903769390 164
129 iso_pu_bacteria 2996336353 2996336673 164
130 iso_pu_bacteria 8056681323 8056685656 164
131 3300005329 Ga0070683_100202175 Ga0070683_1002021752 165
132 3300005458 Ga0070681_10155638 Ga0070681_101556383 165
133 3300005530 Ga0070679_100039892 Ga0070679_1000398923 165
134 3300009093 Ga0105240_10658280 Ga0105240_106582802 165
135 3300013105 Ga0157369_10403302 Ga0157369_104033021 165
136 3300025913 Ga0207695_10058399 Ga0207695_100583993 165
137 3300025921 Ga0207652_10016779 Ga0207652_100167793 165
138 3300025944 Ga0207661_10217138 Ga0207661_102171383 165
139 3300049575 Ga0501039_0034313 Ga0501039_0034313_878_1411 165
140 3300049575 Ga0501039_0370452 Ga0501039_0370452_285_821 165
141 3300049576 Ga0501040_0189897 Ga0501040_0189897_350_883 165
142 3300049586 Ga0501070_0010869 Ga0501070_0010869_5884_6435 165
143 3300049586 Ga0501070_0196306 Ga0501070_0196306_358_900 165
144 3300049587 Ga0501071_0347319 Ga0501071_0347319_219_764 165
145 3300049590 Ga0501074_0034082 Ga0501074_0034082_1639_2190 165
146 3300049741 Ga0501079_0267580 Ga0501079_0267580_309_860 165
147 3300049742 Ga0501080_0017987 Ga0501080_0017987_1806_2357 165
148 3300049823 Ga0501044_0052901 Ga0501044_0052901_1686_2237 165
149 3300005459 Ga0068867_100794678 Ga0068867_1007946781 166
150 3300005548 Ga0070665_100119572 Ga0070665_1001195723 166
151 3300006163 Ga0070715_10314527 Ga0070715_103145272 166
152 3300011119 Ga0105246_10784965 Ga0105246_107849652 166
153 3300013306 Ga0163162_10519307 Ga0163162_105193072 166
154 3300014325 Ga0163163_11276782 Ga0163163_112767822 166
155 3300026118 Ga0207675_100278545 Ga0207675_1002785452 166
156 3300031548 Ga0307408_100795271 Ga0307408_1007952712 166
157 3300031911 Ga0307412_10098568 Ga0307412_100985683 166
158 3300031911 Ga0307412_10953446 Ga0307412_109534462 166
159 3300032004 Ga0307414_11246884 Ga0307414_112468841 166
160 3300048914 Ga0496111_0616161 Ga0496111_0616161_223_780 166
161 3300048916 Ga0496113_0452498 Ga0496113_0452498_442_996 166
162 3300048918 Ga0496115_0717531 Ga0496115_0717531_75_632 166
163 3300049823 Ga0501044_0109953 Ga0501044_0109953_1045_1611 166
164 3300005337 Ga0070682_100109858 Ga0070682_1001098582 167
165 3300005347 Ga0070668_100409909 Ga0070668_1004099092 167
166 3300005842 Ga0068858_101175031 Ga0068858_1011750311 167
167 3300006178 Ga0075367_10149673 Ga0075367_101496732 167
168 3300009553 Ga0105249_10613648 Ga0105249_106136482 167
169 3300025253 Ga0209677_101017 Ga0209677_1010178 167
170 3300025272 Ga0209455_1024619 Ga0209455_10246192 167
171 3300025911 Ga0207654_10111631 Ga0207654_101116312 167
172 3300031247 Ga0265340_10111539 Ga0265340_101115392 167
173 3300031249 Ga0265339_10039880 Ga0265339_100398802 167
174 3300037312 Ga0395899_0091428 Ga0395899_0091428_879_1430 167
175 3300037418 Ga0395900_0035890 Ga0395900_0035890_1986_2537 167
176 3300037466 Ga0395898_0035333 Ga0395898_0035333_1878_2429 167
177 3300037471 Ga0395905_0917870 Ga0395905_0917870_202_753 167
178 3300038443 Ga0395901_0015214 Ga0395901_0015214_2237_2788 167
179 3300048918 Ga0496115_0590233 Ga0496115_0590233_136_687 167
180 3300048920 Ga0496117_0084830 Ga0496117_0084830_358_921 167
181 3300048921 Ga0496118_0038740 Ga0496118_0038740_3173_3736 167
182 3300048924 Ga0496121_0051483 Ga0496121_0051483_580_1143 167
183 3300048928 Ga0496125_0073223 Ga0496125_0073223_1930_2493 167
184 3300048929 Ga0496126_0030571 Ga0496126_0030571_4031_4582 167
185 3300049569 Ga0501032_0001260 Ga0501032_0001260_6594_7196 167
186 3300049570 Ga0501033_0232125 Ga0501033_0232125_513_1115 167
187 3300049571 Ga0501034_0668146 Ga0501034_0668146_273_821 167
188 3300049571 Ga0501034_0913356 Ga0501034_0913356_15_617 167
189 3300049572 Ga0501036_0000138 Ga0501036_0000138_6594_7196 167
190 3300049574 Ga0501038_0000204 Ga0501038_0000204_6594_7196 167
191 3300049574 Ga0501038_0079722 Ga0501038_0079722_1262_1810 167
192 3300049575 Ga0501039_0000596 Ga0501039_0000596_6594_7196 167
193 3300049576 Ga0501040_0009682 Ga0501040_0009682_4450_5052 167
194 3300049579 Ga0501043_0193882 Ga0501043_0193882_445_993 167
195 3300049583 Ga0501067_0123412 Ga0501067_0123412_257_811 167
196 3300049822 Ga0501035_0000473 Ga0501035_0000473_6594_7196 167
197 3300049822 Ga0501035_0178362 Ga0501035_0178362_545_1147 167
198 3300049823 Ga0501044_0000441 Ga0501044_0000441_6594_7196 167
199 iso_pu_bacteria 2937877337 2937879640 167
200 iso_pu_bacteria 2958084443 2958086816 167
201 iso_pu_bacteria 3000135777 3000138683 167
202 3300006051 Ga0075364_10000039 Ga0075364_1000003925 168
203 3300006946 Ga0079104_1000216 Ga0079104_100021641 168
204 3300027111 Ga0209281_1000472 Ga0209281_100047218 168
205 3300050491 nmdc:mga00v17_122_c1 nmdc:mga00v17_122_c1_21041_21598 168
206 3300049577 Ga0501041_0057356 Ga0501041_0057356_1738_2304 169
207 3300049578 Ga0501042_0046396 Ga0501042_0046396_2463_3029 169
208 3300049580 Ga0501046_0129756 Ga0501046_0129756_212_778 169
209 3300049741 Ga0501079_0024794 Ga0501079_0024794_3844_4410 169
210 iso_pu_bacteria 2545555834 2545678593 169
211 iso_pu_bacteria 2920760137 2920764787 169
212 iso_pu_bacteria 641522639 641643057 169
213 3300010375 Ga0105239_11264533 Ga0105239_112645331 170
214 iso_pu_bacteria 2509276021 2509390284 170
215 iso_pu_bacteria 2510065057 2510307890 170
216 iso_pu_bacteria 2513237091 2513620047 170
217 iso_pu_bacteria 2513237159 2514002028 170
218 iso_pu_bacteria 2516143018 2516207322 170
219 iso_pu_bacteria 2516653046 2516897272 170
220 iso_pu_bacteria 2551306089 2551713462 170
221 iso_pu_bacteria 2643221582 2643917912 170
222 iso_pu_bacteria 2643221618 2644106128 170
223 iso_pu_bacteria 2643221626 2644146910 170
224 iso_pu_bacteria 2643221655 2644310739 170
225 iso_pu_bacteria 2643221659 2644334474 170
226 iso_pu_bacteria 2643221688 2644492938 170
227 iso_pu_bacteria 2643221698 2644545327 170
228 iso_pu_bacteria 2643221712 2644616573 170
229 iso_pu_bacteria 2791355082 2792580267 170
230 iso_pu_bacteria 2802429634 2806056547 170
231 iso_pu_bacteria 2802429635 2806063697 170
232 iso_pu_bacteria 2842521101 2842527431 170
233 iso_pu_bacteria 2844163670 2844165837 170
234 iso_pu_bacteria 2854916844 2854922478 170
235 iso_pu_bacteria 2855825444 2855830861 170
236 iso_pu_bacteria 2874123672 2874128075 170
237 iso_pu_bacteria 2899803654 2899808727 170
238 iso_pu_bacteria 2915993759 2915999978 170
239 iso_pu_bacteria 2916000859 2916007111 170
240 iso_pu_bacteria 2916007675 2916010684 170
241 iso_pu_bacteria 2916014648 2916017502 170
242 iso_pu_bacteria 2916041962 2916046712 170
243 iso_pu_bacteria 2916048683 2916053274 170
244 iso_pu_bacteria 2916076590 2916082087 170
245 iso_pu_bacteria 2920822456 2920826442 170
246 iso_pu_bacteria 2921237296 2921241940 170
247 iso_pu_bacteria 2921244191 2921246657 170
248 iso_pu_bacteria 2921257292 2921261631 170
249 iso_pu_bacteria 2921282425 2921284505 170
250 iso_pu_bacteria 2924144063 2924149450 170
251 iso_pu_bacteria 2924150972 2924158078 170
252 iso_pu_bacteria 2924158325 2924161029 170
253 iso_pu_bacteria 2924179722 2924185407 170
254 iso_pu_bacteria 2924200457 2924206228 170
255 iso_pu_bacteria 2924207177 2924208708 170
256 iso_pu_bacteria 2936996657 2937000533 170
257 iso_pu_bacteria 2937002841 2937005194 170
258 iso_pu_bacteria 2937009748 2937011370 170
259 iso_pu_bacteria 2937016420 2937017160 170
260 iso_pu_bacteria 2937023124 2937027576 170
261 iso_pu_bacteria 2937049772 2937050577 170
262 iso_pu_bacteria 2937056579 2937062933 170
263 iso_pu_bacteria 2937091812 2937093367 170
264 iso_pu_bacteria 2937098957 2937100581 170
265 iso_pu_bacteria 2937119839 2937120736 170
266 iso_pu_bacteria 2957382221 2957386982 170
267 iso_pu_bacteria 2957395598 2957399802 170
268 iso_pu_bacteria 2957402308 2957407334 170
269 iso_pu_bacteria 2957408893 2957413129 170
270 iso_pu_bacteria 2957430029 2957436633 170
271 iso_pu_bacteria 2957450854 2957452942 170
272 iso_pu_bacteria 2957464669 2957470541 170
273 iso_pu_bacteria 2957471148 2957476370 170
274 iso_pu_bacteria 2957498199 2957501255 170
275 iso_pu_bacteria 2960584000 2960586690 170
276 iso_pu_bacteria 2960603979 2960607616 170
277 iso_pu_bacteria 2960610863 2960612860 170
278 iso_pu_bacteria 2960624210 2960630171 170
279 iso_pu_bacteria 2960637947 2960644476 170
280 iso_pu_bacteria 2960687367 2960691765 170
281 iso_pu_bacteria 2964607997 2964613200 170
282 iso_pu_bacteria 2964615318 2964620038 170
283 iso_pu_bacteria 2964621998 2964626812 170
284 iso_pu_bacteria 2964628898 2964629409 170
285 iso_pu_bacteria 2964656573 2964657588 170
286 iso_pu_bacteria 2964663802 2964664760 170
287 iso_pu_bacteria 2964678106 2964679897 170
288 iso_pu_bacteria 2964685014 2964687921 170
289 iso_pu_bacteria 2964691889 2964696746 170
290 iso_pu_bacteria 2964719344 2964725567 170
291 iso_pu_bacteria 2967671571 2967676872 170
292 iso_pu_bacteria 2967678726 2967680203 170
293 iso_pu_bacteria 2967693043 2967698738 170
294 iso_pu_bacteria 2967699805 2967704497 170
295 iso_pu_bacteria 2967748971 2967751674 170
296 iso_pu_bacteria 2967755722 2967760089 170
297 iso_pu_bacteria 2967762386 2967767911 170
298 iso_pu_bacteria 2967769361 2967773999 170
299 iso_pu_bacteria 2970019648 2970022095 170
300 iso_pu_bacteria 2970040964 2970046351 170
301 iso_pu_bacteria 2970047711 2970049137 170
302 iso_pu_bacteria 2970054988 2970057535 170
303 iso_pu_bacteria 2970061556 2970066413 170
304 iso_pu_bacteria 2970088815 2970089888 170
305 iso_pu_bacteria 2970095765 2970101630 170
306 iso_pu_bacteria 2970102677 2970106603 170
307 iso_pu_bacteria 2970109326 2970113468 170
308 iso_pu_bacteria 2970116247 2970121840 170
309 iso_pu_bacteria 2970129317 2970134962 170
310 iso_pu_bacteria 2970149975 2970155779 170
311 iso_pu_bacteria 2970156795 2970162297 170
312 iso_pu_bacteria 2970164137 2970165075 170
313 iso_pu_bacteria 2970170962 2970177160 170
314 iso_pu_bacteria 2970177841 2970180475 170
315 iso_pu_bacteria 2970184632 2970185838 170
316 iso_pu_bacteria 2977516862 2977521973 170
317 iso_pu_bacteria 2977551784 2977554267 170
318 iso_pu_bacteria 2977558990 2977562360 170
319 iso_pu_bacteria 2977565890 2977569384 170
320 iso_pu_bacteria 2977579622 2977582056 170
321 iso_pu_bacteria 3005452660 3005457036 170
322 iso_pu_bacteria 648276728 648738030 170
323 iso_pu_bacteria 8003570095 8003573558 170
324 iso_pu_bacteria 8003992118 8003998066 170
325 iso_pu_bacteria 8005289223 8005294100 170
326 iso_pu_bacteria 8005688590 8005693171 170
327 iso_pu_bacteria 8018127388 8018129450 170
328 3300013308 Ga0157375_11013560 Ga0157375_110135602 171
329 3300037471 Ga0395905_0006875 Ga0395905_0006875_7633_8199 171
330 iso_pu_bacteria 2582581283 2585169315 171
331 3300014325 Ga0163163_10461905 Ga0163163_104619052 172
332 3300048913 Ga0496110_0128438 Ga0496110_0128438_139_708 172
333 3300048914 Ga0496111_0042771 Ga0496111_0042771_208_777 172
334 3300048915 Ga0496112_0297738 Ga0496112_0297738_118_687 172
335 3300048916 Ga0496113_0303248 Ga0496113_0303248_622_1191 172
336 3300049743 Ga0501081_0310360 Ga0501081_0310360_45_608 172
337 3300005262 Ga0065165_1004535 Ga0065165_100453511 173
338 3300006186 Ga0075369_10282511 Ga0075369_102825112 173
339 3300006946 Ga0079104_1045317 Ga0079104_10453171 173
340 3300025245 Ga0207425_1039987 Ga0207425_10399872 173
341 3300025272 Ga0209455_1001272 Ga0209455_100127211 173
342 3300025292 Ga0209676_1016303 Ga0209676_10163032 173
343 3300025295 Ga0209564_1000189 Ga0209564_100018978 173
344 3300025298 Ga0209050_1007751 Ga0209050_10077516 173
345 3300025299 Ga0209256_1001306 Ga0209256_100130617 173
346 3300025302 Ga0207426_1073327 Ga0207426_10733272 173
347 3300025303 Ga0209051_1042882 Ga0209051_10428822 173
348 3300025304 Ga0209257_1025476 Ga0209257_10254762 173
349 3300027111 Ga0209281_1001540 Ga0209281_10015406 173
350 3300028794 Ga0307515_10143744 Ga0307515_101437442 173
351 3300031456 Ga0307513_10052274 Ga0307513_100522742 173
352 3300031548 Ga0307408_100534324 Ga0307408_1005343242 173
353 3300031548 Ga0307408_100959470 Ga0307408_1009594702 173
354 3300031730 Ga0307516_10258919 Ga0307516_102589192 173
355 3300031852 Ga0307410_10116077 Ga0307410_101160772 173
356 3300032004 Ga0307414_10065784 Ga0307414_100657841 173
357 3300037471 Ga0395905_0000547 Ga0395905_0000547_45830_46402 173
358 3300041491 Ga0451833_0672446 Ga0451833_0672446_2838_3404 173
359 3300041494 Ga0451837_1626977 Ga0451837_1626977_94_660 173
360 3300041511 Ga0451855_0003628 Ga0451855_0003628_1005_1571 173
361 3300041512 Ga0451853_0910860 Ga0451853_0910860_21237_21803 173
362 3300048909 Ga0496106_0000833 Ga0496106_0000833_1279_1839 173
363 3300048909 Ga0496106_0156080 Ga0496106_0156080_1172_1738 173
364 3300048910 Ga0496107_0576906 Ga0496107_0576906_53_619 173
365 3300048913 Ga0496110_0442092 Ga0496110_0442092_131_703 173
366 3300048919 Ga0496116_0004881 Ga0496116_0004881_4027_4575 173
367 3300048920 Ga0496117_0001278 Ga0496117_0001278_15563_16111 173
368 3300048921 Ga0496118_0020534 Ga0496118_0020534_4157_4705 173
369 3300048922 Ga0496119_0012017 Ga0496119_0012017_1561_2109 173
370 3300048923 Ga0496120_0002198 Ga0496120_0002198_1493_2041 173
371 3300048924 Ga0496121_0002652 Ga0496121_0002652_21316_21882 173
372 3300048924 Ga0496121_0007809 Ga0496121_0007809_2993_3541 173
373 3300048925 Ga0496122_0032613 Ga0496122_0032613_3595_4143 173
374 3300048926 Ga0496123_0005009 Ga0496123_0005009_3467_4015 173
375 3300048927 Ga0496124_0004071 Ga0496124_0004071_10342_10890 173
376 3300048927 Ga0496124_0057088 Ga0496124_0057088_1565_2131 173
377 3300048928 Ga0496125_0000034 Ga0496125_0000034_327251_327799 173
378 3300048929 Ga0496126_0023821 Ga0496126_0023821_1224_1772 173
379 3300048929 Ga0496126_0050411 Ga0496126_0050411_660_1226 173
380 3300050496 nmdc:mga07m45_335604_c1 nmdc:mga07m45_335604_c1_21_581 173
381 3300050516 nmdc:mga0sz30_73231_c1 nmdc:mga0sz30_73231_c1_814_1374 173
382 3300053093 Ga0500651_0248203 Ga0500651_0248203_283_843 173
383 3300053122 Ga0500608_094352 Ga0500608_094352_209_781 173
384 3300053134 Ga0500658_0000940 Ga0500658_0000940_9194_9754 173
385 3300053139 Ga0500568_0000819 Ga0500568_0000819_19870_20430 173
386 3300053156 Ga0500622_0000101 Ga0500622_0000101_65002_65574 173
387 3300053158 Ga0500627_0056146 Ga0500627_0056146_451_1023 173
388 3300053158 Ga0500627_0284929 Ga0500627_0284929_86_658 173
389 3300032004 Ga0307414_10285861 Ga0307414_102858611 174
390 iso_pu_bacteria 2534681786 2535486261 174
391 iso_pu_bacteria 2773857925 2774870806 174
392 iso_pu_bacteria 2884298095 2884298191 174
393 3300026075 Ga0207708_10597555 Ga0207708_105975552 175
394 3300005544 Ga0070686_101089817 Ga0070686_1010898171 176
395 3300026121 Ga0207683_10124738 Ga0207683_101247383 176
396 iso_pu_bacteria 2854911287 2854916841 176
397 3300003578 Ga0006562J51391_1002919 Ga0006562J51391_10029197 180

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05573

NosL

NosL

30

163

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7og7-assembly1.cif.gz_A crystal structure of the copper chaperone nosl from shewanella denitrificans 0.9155 27 159
7osg-assembly1.cif.gz_H abc transporter complex nosdfyl, consensus refinement 0.914 27 163
7og7-assembly1.cif.gz_A crystal structure of the copper chaperone nosl from shewanella denitrificans 0.8835 27 159
7osg-assembly1.cif.gz_H abc transporter complex nosdfyl, consensus refinement 0.8428 27 163
2hq3-assembly1.cif.gz_A solution nmr structure of the apo-nosl protein from achromobacter cycloclastes 0.6926 54 169
ID Description Score Start End Superfamily
2hq3A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6452 115 169 3.30.70.2050
af_D4AEI6_288_587_3.90.70.10 Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A;Cysteine proteinases 0.6151 49 66 3.90.70.10
2hq3A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.5642 115 169 3.30.70.2050
af_O96177_23_269_3.30.230.70 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;GHMP Kinase, N-terminal domain 0.5369 49 91 3.30.230.70
af_Q2FWZ5_229_340_3.30.1490.100 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;DNA polymerase, Y-family, little finger domain 0.514 47 91 3.30.1490.100
ID Description Score Start End GO Terms
AF-A0A3B0XIQ1-F1-model_v4 Nitrous oxide reductase maturation protein, outer-membrane lipoprotein NosL 0.9708 44 162
AF-A0A349KXV2-F1-model_v4 Nitrous oxide reductase accessory protein NosL 0.9481 28 156
AF-A0A3T0MZ82-F1-model_v4 Copper resistance protein CopZ 0.9437 17 164
AF-A0A3B0XIQ1-F1-model_v4 Nitrous oxide reductase maturation protein, outer-membrane lipoprotein NosL 0.9319 44 162
AF-A0A2I8DPZ5-F1-model_v4 Copper resistance protein CopZ 0.9283 18 164

Feature Viewer

pLDDT pTM Quality
82.56 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map