metagRoot

F433770

General Info

Members	Datasets	Scaffolds	Average Seq Length
397	259	391	202

Family's Representative Sequence

Representative Sequence	3300013306\|Ga0163162_10528053\|Ga0163162_105280531
Length	239
Sequence	LASAQRSLLSVPYRKEFLDWVYFVRNGTEINSGASPMDLYFSPLACSMASRIVIYEAGGKADFHRVDTKTKRTVTGGDYLKINPKGLVPAVRTDDGRVLTENAAILPYLADAFSGGSLAGDGFERNLVQQWLSFIGTELHTGVFHPLFATTAAPEVKAFARAEAVGRLTYLNDHLAGREWLTDRFTVADAYAAAVLNWAQFVKLDLAPYANVTAYLDRLKARPSVARAMKEEFELFQAA

Samples

	Sample ID	Description	Type	Environment
1	2585428106	Caulobacter sp. OV484	Isolate	Rhizosphere
2	2643221583	Caulobacter sp. Root655	Isolate	Unclassified
3	2643221640	Caulobacter sp. Root342	Isolate	Unclassified
4	2643221642	Caulobacter sp. Root343	Isolate	Unclassified
5	2884298095	Microvirga thermotolerans HR1	Isolate	Rhizosphere
6	2928531327	Caulobacter sp. 1776	Isolate	Rhizosphere
7	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
8	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
9	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
10	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
11	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
12	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
13	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
14	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
15	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
16	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
17	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
18	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
19	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
20	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
21	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
22	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
23	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
24	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
25	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
26	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
27	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
28	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
29	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
30	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
31	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
32	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
33	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
34	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
35	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
36	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
37	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
38	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
39	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
40	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
41	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
42	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
43	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
44	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
45	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
46	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
47	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
48	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
49	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
50	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
51	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
52	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
53	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
54	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
55	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
56	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
57	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
58	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
59	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
60	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
61	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
62	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
63	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
64	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
65	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
66	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
67	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
68	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
69	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
70	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
71	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
72	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
73	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
74	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
75	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
76	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
77	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
78	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
79	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
80	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
81	3300021377	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7	Metagenome	Unclassified
82	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
83	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
84	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
85	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
86	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
87	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
88	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
89	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
90	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
112	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
114	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
115	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
116	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
117	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
118	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
119	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
120	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
121	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
122	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
123	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
124	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
125	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
126	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
127	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
128	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
129	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
130	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
131	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
132	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
133	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
134	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
135	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
136	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
137	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
138	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
139	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
140	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
141	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
142	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
143	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
144	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
145	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
146	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
147	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
148	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
149	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
150	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
151	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
152	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
153	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
154	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
155	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
156	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
157	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
158	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
159	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
160	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
161	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
162	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
163	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
164	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
165	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
166	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
167	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
168	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
169	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
170	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
171	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
172	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
173	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
174	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
175	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
176	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
177	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
178	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
179	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
180	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
181	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
182	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
183	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
184	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
185	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
186	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
187	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
188	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
189	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
190	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
191	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
192	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
193	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
194	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
195	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
196	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
197	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
198	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
199	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
200	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
201	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
202	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
203	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
204	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
205	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
206	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
207	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
208	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
209	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
210	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
211	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
212	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
213	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
214	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
215	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
216	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
217	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
218	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
219	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
220	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
221	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
222	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
223	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
224	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
225	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
226	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
227	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
228	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
229	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
230	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
231	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
232	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
233	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
234	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
235	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
236	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
237	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
238	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
239	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
240	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
241	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
242	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
243	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
244	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
245	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
246	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
247	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
248	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
249	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
250	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
251	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
252	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
253	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
254	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
255	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
256	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
257	3300059426	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
258	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
259	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	98.49
Metatranscriptomes	0
Isolates	1.51

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	11.59
Nodule	0
Rhizoplane	7.05
Rhizosphere	78.09
Stem	0
Stem Tuber	0
Unclassified	3.27

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25406J46586_10032344	3300003203	Bacteria	1944
2	Ga0055536_1002363	3300003781	Bacteria	10672
3	Ga0055530_10004025	3300003791	Bacteria	7897
4	Ga0070690_100397686	3300005330	Bacteria	1011
5	Ga0070680_100004443	3300005336	Bacteria	10561
6	Ga0070691_10034410	3300005341	Unclassified	2385
7	Ga0070687_100141414	3300005343	Bacteria	1402
8	Ga0070668_100132459	3300005347	Bacteria	2002
9	Ga0070675_100761403	3300005354	Unclassified	884
10	Ga0070671_100715670	3300005355	Bacteria	869
11	Ga0070673_100630402	3300005364	Bacteria	980
12	Ga0070709_10081148	3300005434	Bacteria	2116
13	Ga0070701_10065016	3300005438	Unclassified	1934
14	Ga0070705_100000786	3300005440	Bacteria	17884
15	Ga0070700_100062737	3300005441	Unclassified	2349
16	Ga0070694_100001131	3300005444	Bacteria	15287
17	Ga0070663_100034118	3300005455	Bacteria	3522
18	Ga0070662_100063215	3300005457	Bacteria	2707
19	Ga0070681_10012640	3300005458	Bacteria	8375
20	Ga0068867_100067537	3300005459	Bacteria	2666
21	Ga0070706_100677187	3300005467	Unclassified	957
22	Ga0070699_100001118	3300005518	Bacteria	24997
23	Ga0070679_100042840	3300005530	Bacteria	4508
24	Ga0070684_100015047	3300005535	Bacteria	6287
25	Ga0070697_100009252	3300005536	Bacteria	7699
26	Ga0070697_100437735	3300005536	Unclassified	1138
27	Ga0068853_100594060	3300005539	Bacteria	1051
28	Ga0070686_100451789	3300005544	Unclassified	988
29	Ga0070695_100006602	3300005545	Bacteria	6855
30	Ga0070696_100000036	3300005546	Bacteria	62324
31	Ga0070704_100008928	3300005549	Bacteria	6038
32	Ga0070704_100061274	3300005549	Bacteria	2692
33	Ga0068855_100919990	3300005563	Bacteria	923
34	Ga0070664_100562838	3300005564	Bacteria	1055
35	Ga0068857_100024057	3300005577	Bacteria	5362
36	Ga0070702_100052095	3300005615	Unclassified	2346
37	Ga0068859_100002881	3300005617	Bacteria	17475
38	Ga0068859_100683991	3300005617	Unclassified	1117
39	Ga0068864_100083525	3300005618	Bacteria	2805
40	Ga0068860_100000758	3300005843	Bacteria	36435
41	Ga0068860_100158586	3300005843	Bacteria	2181
42	Ga0068862_100001849	3300005844	Bacteria	19183
43	Ga0081539_10000798	3300005985	Bacteria	61226
44	Ga0070717_10030076	3300006028	Bacteria	4362
45	Ga0075365_10006755	3300006038	Bacteria	6348
46	Ga0075365_10193263	3300006038	Bacteria	1425
47	Ga0075368_10001299	3300006042	Bacteria	7919
48	Ga0075368_10005248	3300006042	Bacteria	4449
49	Ga0075368_10075766	3300006042	Bacteria	1364
50	Ga0075363_100002796	3300006048	Bacteria	7248
51	Ga0075363_100021865	3300006048	Bacteria	3228
52	Ga0075363_100142667	3300006048	Bacteria	1349
53	Ga0075364_10003077	3300006051	Bacteria	9425
54	Ga0075364_10095019	3300006051	Bacteria	1981
55	Ga0075364_10359715	3300006051	Bacteria	992
56	Ga0070712_100008617	3300006175	Bacteria	6419
57	Ga0075362_10085842	3300006177	Bacteria	1456
58	Ga0075362_10117499	3300006177	Bacteria	1256
59	Ga0075367_10004018	3300006178	Bacteria	7113
60	Ga0075367_10020318	3300006178	Bacteria	3696
61	Ga0075367_10248516	3300006178	Bacteria	1115
62	Ga0075366_10015764	3300006195	Bacteria	4338
63	Ga0075366_10219091	3300006195	Bacteria	1159
64	Ga0075370_10231690	3300006353	Bacteria	1093
65	Ga0075430_100026396	3300006846	Bacteria	4942
66	Ga0075431_100002257	3300006847	Bacteria	18483
67	Ga0075434_100310711	3300006871	Bacteria	1597
68	Ga0075434_100699694	3300006871	Bacteria	1031
69	Ga0075434_100763290	3300006871	Bacteria	984
70	Ga0068865_100028558	3300006881	Bacteria	3694
71	Ga0097620_100002881	3300006931	Bacteria	17475
72	Ga0097620_100683869	3300006931	Unclassified	1117
73	Ga0075435_100580280	3300007076	Bacteria	972
74	Ga0099794_10106219	3300007265	Bacteria	1404
75	Ga0099795_10051992	3300007788	Bacteria	1495
76	Ga0111539_10225561	3300009094	Bacteria	2182
77	Ga0105245_10745499	3300009098	Bacteria	1015
78	Ga0114129_10297959	3300009147	Bacteria	2150
79	Ga0105243_10118393	3300009148	Unclassified	2228
80	Ga0105242_10284904	3300009176	Bacteria	1502
81	Ga0105248_10000384	3300009177	Bacteria	50926
82	Ga0105237_10393560	3300009545	Bacteria	1390
83	Ga0105237_10788801	3300009545	Bacteria	957
84	Ga0105238_10009368	3300009551	Bacteria	9804
85	Ga0105238_10030014	3300009551	Bacteria	5534
86	Ga0105249_10002898	3300009553	Bacteria	14794
87	Ga0105239_10178253	3300010375	Bacteria	2377
88	Ga0105246_10088421	3300011119	Unclassified	2226
89	Ga0163162_10528053	3300013306	Bacteria	1309
90	Ga0163162_10609773	3300013306	Bacteria	1217
91	Ga0157372_10773990	3300013307	Bacteria	1116
92	Ga0163163_10056389	3300014325	Bacteria	3884
93	Ga0157380_10044114	3300014326	Bacteria	3493
94	Ga0157377_10079293	3300014745	Bacteria	1915
95	Ga0157379_10255999	3300014968	Bacteria	1590
96	Ga0157379_10800370	3300014968	Unclassified	890
97	Ga0213874_10022727	3300021377	Bacteria	1743
98	Ga0213876_10110564	3300021384	Bacteria	1458
99	Ga0213876_10366028	3300021384	Bacteria	767
100	Ga0209676_1000043	3300025292	Bacteria	418680
101	Ga0209050_1000729	3300025298	Bacteria	47913
102	Ga0209051_1001677	3300025303	Bacteria	17853
103	Ga0209257_1009887	3300025304	Bacteria	4977
104	Ga0207653_10010875	3300025885	Bacteria	2839
105	Ga0207692_10318779	3300025898	Unclassified	951
106	Ga0207692_10582358	3300025898	Bacteria	718
107	Ga0207647_10312628	3300025904	Unclassified	893
108	Ga0207699_10474534	3300025906	Bacteria	900
109	Ga0207707_10011137	3300025912	Bacteria	7822
110	Ga0207671_10309850	3300025914	Bacteria	1248
111	Ga0207671_10651207	3300025914	Bacteria	839
112	Ga0207693_10013647	3300025915	Bacteria	6547
113	Ga0207660_10002447	3300025917	Bacteria	12194
114	Ga0207662_10023254	3300025918	Bacteria	3559
115	Ga0207662_10406329	3300025918	Bacteria	924
116	Ga0207662_10477543	3300025918	Bacteria	856
117	Ga0207652_10152751	3300025921	Bacteria	2068
118	Ga0207694_10014334	3300025924	Bacteria	5976
119	Ga0207704_10000784	3300025938	Bacteria	14010
120	Ga0207704_10273155	3300025938	Unclassified	1281
121	Ga0207711_10000691	3300025941	Bacteria	33231
122	Ga0207667_10834124	3300025949	Bacteria	917
123	Ga0207712_10004745	3300025961	Bacteria	8594
124	Ga0207712_10229226	3300025961	Bacteria	1490
125	Ga0207668_10182715	3300025972	Bacteria	1656
126	Ga0207639_10461197	3300026041	Bacteria	1155
127	Ga0207678_10031181	3300026067	Bacteria	4651
128	Ga0207708_10000943	3300026075	Bacteria	21783
129	Ga0207676_10032907	3300026095	Bacteria	3913
130	Ga0207676_10725478	3300026095	Bacteria	965
131	Ga0207674_10011274	3300026116	Bacteria	10047
132	Ga0207675_100595384	3300026118	Bacteria	1108
133	Ga0207683_10172968	3300026121	Unclassified	1957
134	Ga0209588_1134720	3300027671	Bacteria	787
135	Ga0209813_10000400	3300027866	Bacteria	10671
136	Ga0268264_10000704	3300028381	Bacteria	38564
137	Ga0268264_10698306	3300028381	Unclassified	1007
138	Ga0268264_10706124	3300028381	Bacteria	1002
139	Ga0307517_10102918	3300028786	Bacteria	2235
140	Ga0307412_10076780	3300031911	Bacteria	2296
141	Ga0373926_0006328	3300035083	Bacteria	3930
142	Ga0373934_0009665	3300035086	Bacteria	3615
143	Ga0373934_0279969	3300035086	Bacteria	691
144	Ga0373944_0010267	3300035089	Bacteria	2550
145	Ga0373944_0072591	3300035089	Bacteria	1124
146	Ga0373923_0000438	3300035111	Bacteria	9810
147	Ga0373936_0001591	3300035113	Bacteria	8288
148	Ga0373936_0006399	3300035113	Bacteria	4438
149	Ga0373945_0112895	3300035116	Bacteria	1073
150	Ga0373945_0140967	3300035116	Bacteria	972
151	Ga0373953_0008471	3300035117	Bacteria	3494
152	Ga0373954_0010350	3300035118	Bacteria	4115
153	Ga0373956_0010545	3300035119	Bacteria	3788
154	Ga0373957_0000944	3300035120	Bacteria	7637
155	Ga0373943_0001341	3300035170	Bacteria	11089
156	Ga0373943_0095508	3300035170	Bacteria	1546
157	Ga0373946_0115321	3300035171	Bacteria	1220
158	Ga0373955_0005279	3300035172	Bacteria	5800
159	Ga0373924_0028703	3300035410	Bacteria	2218
160	Ga0373924_0129903	3300035410	Bacteria	1096
161	Ga0373935_0059544	3300035692	Bacteria	2441
162	Ga0373935_0097314	3300035692	Bacteria	1935
163	Ga0373935_0586930	3300035692	Bacteria	814
164	Ga0373927_0001755	3300035695	Bacteria	16180
165	Ga0373927_0017693	3300035695	Bacteria	4689
166	Ga0373927_0199209	3300035695	Bacteria	1314
167	Ga0373933_0533303	3300035724	Bacteria	770
168	Ga0373947_0001740	3300035725	Bacteria	13311
169	Ga0373947_0012645	3300035725	Bacteria	4840
170	Ga0373947_0087900	3300035725	Bacteria	1933
171	Ga0373937_0063924	3300036401	Bacteria	3384
172	Ga0373925_0000344	3300037068	Bacteria	48419
173	Ga0373925_0036134	3300037068	Bacteria	3647
174	Ga0373925_0042996	3300037068	Bacteria	3352
175	Ga0373925_0044937	3300037068	Bacteria	3280
176	Ga0373925_0094392	3300037068	Bacteria	2291
177	Ga0395899_0000018	3300037312	Bacteria	423194
178	Ga0395899_0002171	3300037312	Bacteria	16121
179	Ga0395900_0000002	3300037418	Bacteria	671103
180	Ga0395898_0016636	3300037466	Bacteria	7517
181	Ga0395905_0005996	3300037471	Bacteria	12310
182	Ga0395905_0628469	3300037471	Bacteria	976
183	Ga0436364_1414101	3300037853	Bacteria	1229
184	Ga0395901_0000021	3300038443	Bacteria	307734
185	Ga0436365_0875582	3300039437	Bacteria	5177
186	Ga0436365_1264609	3300039437	Bacteria	1096
187	Ga0436365_1474914	3300039437	Bacteria	2248
188	Ga0436365_1677510	3300039437	Bacteria	3893
189	Ga0436360_0524672	3300039438	Bacteria	725
190	Ga0436363_1634529	3300039450	Bacteria	1025
191	Ga0436362_0828113	3300039453	Bacteria	1021
192	Ga0436362_0997883	3300039453	Bacteria	964
193	Ga0466963_0694188	3300044694	Bacteria	718
194	Ga0466959_0424420	3300045049	Unclassified	902
195	Ga0451576_0077593	3300045051	Bacteria	3457
196	Ga0451576_0463948	3300045051	Bacteria	1330
197	Ga0495627_001159	3300046453	Bacteria	16920
198	Ga0495592_0028010	3300046454	Bacteria	4267
199	Ga0495629_0055170	3300046459	Bacteria	2779
200	Ga0495629_0128423	3300046459	Bacteria	1766
201	Ga0495629_0280860	3300046459	Bacteria	1142
202	Ga0495641_0022772	3300046461	Bacteria	3127
203	Ga0495651_0029542	3300046462	Bacteria	4275
204	Ga0495651_0190940	3300046462	Bacteria	1442
205	Ga0495651_0300104	3300046462	Bacteria	1078
206	Ga0495653_0014889	3300046463	Bacteria	6344
207	Ga0495653_0099933	3300046463	Bacteria	2104
208	Ga0495650_0025998	3300046471	Bacteria	2732
209	Ga0495580_0008928	3300046472	Bacteria	7926
210	Ga0495662_0013202	3300046476	Bacteria	4022
211	Ga0495664_0000292	3300046477	Bacteria	23928
212	Ga0495584_0314169	3300046491	Bacteria	796
213	Ga0495583_0008677	3300046506	Bacteria	6183
214	Ga0495608_0016292	3300046511	Bacteria	5141
215	Ga0495618_0002551	3300046514	Bacteria	11665
216	Ga0495618_0003828	3300046514	Bacteria	9309
217	Ga0495630_0001951	3300046517	Bacteria	14336
218	Ga0495630_0015117	3300046517	Bacteria	5632
219	Ga0495630_0149878	3300046517	Bacteria	1774
220	Ga0495648_0196445	3300046524	Bacteria	1014
221	Ga0495666_0037019	3300046526	Bacteria	2374
222	Ga0495652_0014880	3300046529	Bacteria	6974
223	Ga0495665_0013470	3300046531	Bacteria	4422
224	Ga0495665_0018483	3300046531	Bacteria	3745
225	Ga0495665_0100937	3300046531	Bacteria	1514
226	Ga0495640_0002721	3300046533	Bacteria	14211
227	Ga0495640_0011525	3300046533	Bacteria	6800
228	Ga0495640_0033153	3300046533	Bacteria	3671
229	Ga0495586_0014076	3300046535	Bacteria	4249
230	Ga0495587_0008649	3300046536	Bacteria	6541
231	Ga0495597_0042123	3300046542	Bacteria	2037
232	Ga0495645_0001428	3300046543	Bacteria	16090
233	Ga0495645_0226204	3300046543	Bacteria	1255
234	Ga0495622_0089329	3300046557	Bacteria	1416
235	Ga0495667_0016277	3300046559	Bacteria	5023
236	Ga0495668_0198185	3300046616	Bacteria	1099
237	Ga0495634_0002756	3300046642	Bacteria	14441
238	Ga0495634_0033273	3300046642	Bacteria	3542
239	Ga0495625_0148332	3300046660	Bacteria	1578
240	Ga0495635_0000545	3300046663	Bacteria	23993
241	Ga0495588_0298921	3300046674	Unclassified	848
242	Ga0495657_0001733	3300046675	Bacteria	18667
243	Ga0495599_0013855	3300046678	Bacteria	4990
244	Ga0495599_0078102	3300046678	Bacteria	2067
245	Ga0495646_0064119	3300046680	Bacteria	2179
246	Ga0495647_0001806	3300046681	Bacteria	6618
247	Ga0495647_0052649	3300046681	Bacteria	1586
248	Ga0495658_0005222	3300046683	Bacteria	6386
249	Ga0495658_0316743	3300046683	Bacteria	988
250	Ga0495613_0008236	3300046689	Bacteria	7739
251	Ga0495613_0024043	3300046689	Bacteria	4540
252	Ga0495624_0007320	3300046690	Bacteria	7749
253	Ga0495624_0025297	3300046690	Bacteria	3898
254	Ga0495624_0098642	3300046690	Bacteria	1799
255	Ga0495624_0231269	3300046690	Bacteria	1120
256	Ga0495589_0001649	3300046794	Bacteria	12782
257	Ga0495600_0007585	3300046809	Bacteria	6643
258	Ga0495581_0029278	3300047315	Bacteria	3192
259	Ga0495581_0036873	3300047315	Bacteria	2828
260	Ga0495604_0042440	3300047317	Bacteria	3564
261	Ga0495674_0000996	3300047319	Bacteria	27247
262	Ga0495674_0124302	3300047319	Bacteria	2178
263	Ga0495674_0218700	3300047319	Bacteria	1575
264	Ga0495676_0053424	3300047321	Bacteria	3220
265	Ga0495676_0207830	3300047321	Bacteria	1356
266	Ga0495676_0381812	3300047321	Bacteria	937
267	Ga0495676_0570919	3300047321	Bacteria	738
268	Ga0495680_0015960	3300047322	Bacteria	6462
269	Ga0495673_0000119	3300047469	Bacteria	145179
270	Ga0495684_0006541	3300047471	Bacteria	9041
271	Ga0495684_0006779	3300047471	Bacteria	8890
272	Ga0495684_0073912	3300047471	Bacteria	2589
273	Ga0495686_0115150	3300047472	Bacteria	1608
274	Ga0495593_0002216	3300047673	Bacteria	11645
275	Ga0495614_0239038	3300048089	Bacteria	829
276	Ga0496101_0143159	3300048904	Unclassified	1824
277	Ga0496102_0005652	3300048905	Bacteria	10610
278	Ga0496102_0619913	3300048905	Bacteria	1005
279	Ga0496103_0009202	3300048906	Bacteria	5851
280	Ga0496104_0000346	3300048907	Bacteria	41425
281	Ga0496104_0016666	3300048907	Bacteria	6677
282	Ga0496104_0068331	3300048907	Bacteria	3377
283	Ga0496105_0001039	3300048908	Bacteria	19207
284	Ga0496105_0021581	3300048908	Bacteria	5212
285	Ga0496106_0000429	3300048909	Bacteria	29888
286	Ga0496107_0018006	3300048910	Bacteria	4971
287	Ga0496108_0007004	3300048911	Bacteria	9131
288	Ga0496108_0009329	3300048911	Bacteria	7945
289	Ga0496108_0113517	3300048911	Bacteria	2319
290	Ga0496108_1008274	3300048911	Bacteria	711
291	Ga0496109_0003554	3300048912	Bacteria	13010
292	Ga0496109_0021276	3300048912	Bacteria	5734
293	Ga0496110_0000209	3300048913	Bacteria	37499
294	Ga0496110_0380890	3300048913	Bacteria	1285
295	Ga0496110_0917818	3300048913	Bacteria	782
296	Ga0496111_0003116	3300048914	Bacteria	10198
297	Ga0496111_0054869	3300048914	Bacteria	2881
298	Ga0496112_0021288	3300048915	Bacteria	6164
299	Ga0496113_0000537	3300048916	Bacteria	18713
300	Ga0496113_0004702	3300048916	Bacteria	8422
301	Ga0496114_0423597	3300048917	Unclassified	1179
302	Ga0496115_0010217	3300048918	Bacteria	7003
303	Ga0496115_0701967	3300048918	Bacteria	795
304	Ga0501036_0133667	3300049572	Bacteria	2094
305	Ga0501039_0052845	3300049575	Bacteria	3143
306	Ga0501040_0092949	3300049576	Bacteria	2098
307	Ga0501040_0658284	3300049576	Unclassified	757
308	Ga0501042_0047498	3300049578	Bacteria	3062
309	Ga0501042_0187731	3300049578	Bacteria	1491
310	Ga0501046_0015392	3300049580	Bacteria	6429
311	Ga0501046_0290058	3300049580	Bacteria	1197
312	Ga0501048_0167052	3300049582	Bacteria	1558
313	Ga0501048_0207399	3300049582	Bacteria	1390
314	Ga0501068_0529144	3300049584	Bacteria	766
315	Ga0501069_0259369	3300049585	Bacteria	1015
316	Ga0501070_0408792	3300049586	Unclassified	1097
317	Ga0501071_0629751	3300049587	Bacteria	825
318	Ga0501072_0124062	3300049588	Bacteria	2058
319	Ga0501072_0134316	3300049588	Bacteria	1973
320	Ga0501072_0134820	3300049588	Unclassified	1969
321	Ga0501072_0221084	3300049588	Unclassified	1509
322	Ga0501074_0392415	3300049590	Unclassified	984
323	Ga0501075_0075833	3300049591	Bacteria	2543
324	Ga0501075_0283721	3300049591	Unclassified	1262
325	Ga0501075_0370689	3300049591	Bacteria	1091
326	Ga0501076_0117506	3300049592	Bacteria	2152
327	Ga0501076_0154206	3300049592	Bacteria	1869
328	Ga0501076_0208342	3300049592	Unclassified	1597
329	Ga0501076_0248382	3300049592	Bacteria	1456
330	Ga0501077_0009752	3300049593	Bacteria	5972
331	Ga0501077_0053751	3300049593	Bacteria	2557
332	Ga0501079_0007432	3300049741	Bacteria	8292
333	Ga0501079_0037080	3300049741	Bacteria	3756
334	Ga0501079_0428773	3300049741	Unclassified	1038
335	Ga0501081_0020765	3300049743	Bacteria	4380
336	Ga0501081_0075676	3300049743	Bacteria	2350
337	Ga0501081_0077765	3300049743	Bacteria	2319
338	Ga0501083_0021270	3300049744	Bacteria	4507
339	Ga0501083_0229582	3300049744	Unclassified	1209
340	Ga0501045_0032017	3300049824	Bacteria	3809
341	Ga0501045_0190258	3300049824	Bacteria	1530
342	nmdc:mga03683_169716_c1	3300050489	Bacteria	991
343	nmdc:mga03n38_123575_c1	3300050490	Bacteria	1275
344	nmdc:mga03n38_303_c1	3300050490	Bacteria	11863
345	nmdc:mga03n38_35528_c1	3300050490	Bacteria	2136
346	nmdc:mga03n38_499184_c1	3300050490	Bacteria	683
347	nmdc:mga03n38_5304_c1	3300050490	Bacteria	4376
348	nmdc:mga00v17_365834_c1	3300050491	Bacteria	938
349	nmdc:mga0yw44_233342_c1	3300050492	Bacteria	1222
350	nmdc:mga0yw44_5626_c1	3300050492	Bacteria	5959
351	nmdc:mga06z11_1093_c1	3300050494	Bacteria	9890
352	nmdc:mga06z11_1406_c1	3300050494	Bacteria	8943
353	nmdc:mga04h51_2604_c1	3300050495	Bacteria	4293
354	nmdc:mga07m45_15663_c1	3300050496	Bacteria	4050
355	nmdc:mga07m45_57382_c1	3300050496	Bacteria	2202
356	nmdc:mga05p37_931662_c1	3300050507	Bacteria	932
357	nmdc:mga09592_436604_c1	3300050508	Bacteria	1130
358	nmdc:mga0qj67_20203_c1	3300050509	Bacteria	5098
359	nmdc:mga06r32_113559_c1	3300050510	Bacteria	2666
360	nmdc:mga06r32_138601_c1	3300050510	Bacteria	2408
361	nmdc:mga06r32_43868_c1	3300050510	Bacteria	4256
362	nmdc:mga06r32_714100_c1	3300050510	Bacteria	967
363	nmdc:mga0n895_641846_c1	3300050512	Bacteria	1061
364	nmdc:mga0rr50_549587_c1	3300050513	Bacteria	983
365	nmdc:mga08x19_524489_c1	3300050514	Bacteria	837
366	Ga0495601_0006910	3300053077	Bacteria	6647
367	Ga0495601_0056621	3300053077	Bacteria	2483
368	Ga0495601_0101775	3300053077	Bacteria	1856
369	Ga0495601_0363801	3300053077	Bacteria	940
370	Ga0495612_0003433	3300053078	Bacteria	6569
371	Ga0495612_0148549	3300053078	Bacteria	1019
372	Ga0495595_0006805	3300053084	Bacteria	4666
373	Ga0495619_0000639	3300053085	Bacteria	23071
374	Ga0495619_0024140	3300053085	Bacteria	3899
375	Ga0495619_0072697	3300053085	Bacteria	2303
376	Ga0500646_0022716	3300053090	Bacteria	1679
377	Ga0500555_043848	3300053103	Bacteria	1239
378	Ga0500559_0004392	3300053136	Bacteria	6703
379	Ga0500577_0005108	3300053142	Bacteria	3513
380	Ga0500616_0065184	3300053153	Bacteria	1874
381	Ga0500622_0258217	3300053156	Bacteria	761
382	Ga0501084_0006912	3300054114	Bacteria	9341
383	Ga0501084_0196584	3300054114	Bacteria	1701
384	Ga0501084_0387049	3300054114	Bacteria	1181
385	Ga0590077_013474	3300059426	Bacteria	1700
386	Ga0501082_0000040	3300060353	Bacteria	91596
387	Ga0501082_0029037	3300060353	Bacteria	4765
388	Ga0501082_0218064	3300060353	Bacteria	1660
389	Ga0501082_0580071	3300060353	Bacteria	981
390	Ga0530510_0052482	3300061734	Bacteria	2946
391	Ga0530510_0134597	3300061734	Bacteria	1819

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300007788	Ga0099795_10051992	Ga0099795_100519921	184
2	3300035083	Ga0373926_0006328	Ga0373926_0006328_998_1576	184
3	3300035086	Ga0373934_0279969	Ga0373934_0279969_65_643	184
4	3300035113	Ga0373936_0006399	Ga0373936_0006399_1283_1861	184
5	3300035116	Ga0373945_0112895	Ga0373945_0112895_457_1035	184
6	3300035170	Ga0373943_0001341	Ga0373943_0001341_5265_5843	184
7	3300035170	Ga0373943_0095508	Ga0373943_0095508_944_1522	184
8	3300035171	Ga0373946_0115321	Ga0373946_0115321_512_1090	184
9	3300035410	Ga0373924_0028703	Ga0373924_0028703_21_599	184
10	3300035410	Ga0373924_0129903	Ga0373924_0129903_211_789	184
11	3300035692	Ga0373935_0059544	Ga0373935_0059544_1652_2230	184
12	3300035695	Ga0373927_0001755	Ga0373927_0001755_8418_8996	184
13	3300035695	Ga0373927_0199209	Ga0373927_0199209_692_1270	184
14	3300035724	Ga0373933_0533303	Ga0373933_0533303_117_695	184
15	3300035725	Ga0373947_0001740	Ga0373947_0001740_5448_6026	184
16	3300035725	Ga0373947_0012645	Ga0373947_0012645_1842_2420	184
17	3300037068	Ga0373925_0000344	Ga0373925_0000344_26223_26801	184
18	3300037068	Ga0373925_0036134	Ga0373925_0036134_2828_3406	184
19	3300037068	Ga0373925_0044937	Ga0373925_0044937_188_766	184
20	3300044694	Ga0466963_0694188	Ga0466963_0694188_114_692	184
21	3300046459	Ga0495629_0055170	Ga0495629_0055170_1129_1707	184
22	3300046459	Ga0495629_0280860	Ga0495629_0280860_32_610	184
23	3300046462	Ga0495651_0190940	Ga0495651_0190940_769_1347	184
24	3300046463	Ga0495653_0099933	Ga0495653_0099933_1057_1635	184
25	3300046477	Ga0495664_0000292	Ga0495664_0000292_13513_14091	184
26	3300046491	Ga0495584_0314169	Ga0495584_0314169_17_595	184
27	3300046514	Ga0495618_0002551	Ga0495618_0002551_8784_9362	184
28	3300046517	Ga0495630_0015117	Ga0495630_0015117_4983_5561	184
29	3300046517	Ga0495630_0149878	Ga0495630_0149878_603_1181	184
30	3300046529	Ga0495652_0014880	Ga0495652_0014880_3986_4564	184
31	3300046531	Ga0495665_0013470	Ga0495665_0013470_1554_2132	184
32	3300046531	Ga0495665_0100937	Ga0495665_0100937_77_655	184
33	3300046533	Ga0495640_0002721	Ga0495640_0002721_1482_2060	184
34	3300046533	Ga0495640_0033153	Ga0495640_0033153_1719_2297	184
35	3300046543	Ga0495645_0001428	Ga0495645_0001428_8573_9151	184
36	3300046642	Ga0495634_0002756	Ga0495634_0002756_4095_4673	184
37	3300046663	Ga0495635_0000545	Ga0495635_0000545_9730_10308	184
38	3300046674	Ga0495588_0298921	Ga0495588_0298921_71_649	184
39	3300046680	Ga0495646_0064119	Ga0495646_0064119_792_1370	184
40	3300046681	Ga0495647_0052649	Ga0495647_0052649_857_1435	184
41	3300046683	Ga0495658_0316743	Ga0495658_0316743_104_682	184
42	3300046689	Ga0495613_0024043	Ga0495613_0024043_402_980	184
43	3300046690	Ga0495624_0007320	Ga0495624_0007320_1713_2291	184
44	3300046690	Ga0495624_0025297	Ga0495624_0025297_1796_2374	184
45	3300047315	Ga0495581_0029278	Ga0495581_0029278_1492_2070	184
46	3300047315	Ga0495581_0036873	Ga0495581_0036873_849_1427	184
47	3300047319	Ga0495674_0000996	Ga0495674_0000996_9761_10339	184
48	3300047319	Ga0495674_0218700	Ga0495674_0218700_965_1543	184
49	3300047321	Ga0495676_0207830	Ga0495676_0207830_23_601	184
50	3300047321	Ga0495676_0381812	Ga0495676_0381812_112_690	184
51	3300047321	Ga0495676_0570919	Ga0495676_0570919_88_666	184
52	3300047471	Ga0495684_0006541	Ga0495684_0006541_1582_2160	184
53	3300047471	Ga0495684_0073912	Ga0495684_0073912_270_848	184
54	3300047673	Ga0495593_0002216	Ga0495593_0002216_7441_8019	184
55	3300048089	Ga0495614_0239038	Ga0495614_0239038_38_616	184
56	3300048911	Ga0496108_1008274	Ga0496108_1008274_13_591	184
57	3300048913	Ga0496110_0917818	Ga0496110_0917818_109_687	184
58	3300048918	Ga0496115_0701967	Ga0496115_0701967_109_687	184
59	3300049575	Ga0501039_0052845	Ga0501039_0052845_1736_2314	184
60	3300049578	Ga0501042_0047498	Ga0501042_0047498_1968_2546	184
61	3300049582	Ga0501048_0167052	Ga0501048_0167052_914_1495	184
62	3300049582	Ga0501048_0207399	Ga0501048_0207399_694_1272	184
63	3300049586	Ga0501070_0408792	Ga0501070_0408792_467_1048	184
64	3300049588	Ga0501072_0134316	Ga0501072_0134316_636_1214	184
65	3300049588	Ga0501072_0134820	Ga0501072_0134820_229_807	184
66	3300049588	Ga0501072_0221084	Ga0501072_0221084_275_856	184
67	3300049590	Ga0501074_0392415	Ga0501074_0392415_177_758	184
68	3300049591	Ga0501075_0075833	Ga0501075_0075833_1056_1634	184
69	3300049591	Ga0501075_0283721	Ga0501075_0283721_601_1182	184
70	3300049592	Ga0501076_0154206	Ga0501076_0154206_140_721	184
71	3300049592	Ga0501076_0248382	Ga0501076_0248382_691_1269	184
72	3300049593	Ga0501077_0053751	Ga0501077_0053751_1164_1745	184
73	3300049741	Ga0501079_0007432	Ga0501079_0007432_2786_3367	184
74	3300049743	Ga0501081_0077765	Ga0501081_0077765_750_1328	184
75	3300049744	Ga0501083_0229582	Ga0501083_0229582_40_621	184
76	3300049824	Ga0501045_0190258	Ga0501045_0190258_767_1345	184
77	3300050490	nmdc:mga03n38_35528_c1	nmdc:mga03n38_35528_c1_276_854	184
78	3300050491	nmdc:mga00v17_365834_c1	nmdc:mga00v17_365834_c1_336_914	184
79	3300050492	nmdc:mga0yw44_233342_c1	nmdc:mga0yw44_233342_c1_170_748	184
80	3300050496	nmdc:mga07m45_57382_c1	nmdc:mga07m45_57382_c1_112_690	184
81	3300050507	nmdc:mga05p37_931662_c1	nmdc:mga05p37_931662_c1_147_725	184
82	3300050510	nmdc:mga06r32_138601_c1	nmdc:mga06r32_138601_c1_260_838	184
83	3300050510	nmdc:mga06r32_714100_c1	nmdc:mga06r32_714100_c1_108_686	184
84	3300050512	nmdc:mga0n895_641846_c1	nmdc:mga0n895_641846_c1_316_894	184
85	3300050514	nmdc:mga08x19_524489_c1	nmdc:mga08x19_524489_c1_62_640	184
86	3300053077	Ga0495601_0006910	Ga0495601_0006910_2377_2955	184
87	3300053078	Ga0495612_0003433	Ga0495612_0003433_2107_2685	184
88	3300053085	Ga0495619_0000639	Ga0495619_0000639_12152_12730	184
89	3300054114	Ga0501084_0006912	Ga0501084_0006912_3206_3787	184
90	3300060353	Ga0501082_0029037	Ga0501082_0029037_425_1006	184
91	3300060353	Ga0501082_0218064	Ga0501082_0218064_736_1314	184
92	3300061734	Ga0530510_0052482	Ga0530510_0052482_2263_2841	184
93	3300061734	Ga0530510_0134597	Ga0530510_0134597_25_603	184
94	3300003781	Ga0055536_1002363	Ga0055536_10023638	187
95	3300003791	Ga0055530_10004025	Ga0055530_100040256	187
96	3300025292	Ga0209676_1000043	Ga0209676_1000043297	187
97	3300025298	Ga0209050_1000729	Ga0209050_100072921	187
98	3300025303	Ga0209051_1001677	Ga0209051_10016779	187
99	3300025304	Ga0209257_1009887	Ga0209257_10098874	187
100	3300048911	Ga0496108_0113517	Ga0496108_0113517_70_663	188
101	3300026121	Ga0207683_10172968	Ga0207683_101729682	191
102	3300046524	Ga0495648_0196445	Ga0495648_0196445_84_719	192
103	3300046542	Ga0495597_0042123	Ga0495597_0042123_308_931	192
104	3300046616	Ga0495668_0198185	Ga0495668_0198185_50_673	192
105	3300053156	Ga0500622_0258217	Ga0500622_0258217_100_723	192
106	3300031911	Ga0307412_10076780	Ga0307412_100767803	194
107	3300005330	Ga0070690_100397686	Ga0070690_1003976862	195
108	3300005336	Ga0070680_100004443	Ga0070680_1000044436	195
109	3300005341	Ga0070691_10034410	Ga0070691_100344102	195
110	3300005343	Ga0070687_100141414	Ga0070687_1001414142	195
111	3300005347	Ga0070668_100132459	Ga0070668_1001324592	195
112	3300005354	Ga0070675_100761403	Ga0070675_1007614031	195
113	3300005434	Ga0070709_10081148	Ga0070709_100811482	195
114	3300005438	Ga0070701_10065016	Ga0070701_100650162	195
115	3300005440	Ga0070705_100000786	Ga0070705_1000007865	195
116	3300005441	Ga0070700_100062737	Ga0070700_1000627372	195
117	3300005444	Ga0070694_100001131	Ga0070694_10000113112	195
118	3300005455	Ga0070663_100034118	Ga0070663_1000341182	195
119	3300005457	Ga0070662_100063215	Ga0070662_1000632152	195
120	3300005458	Ga0070681_10012640	Ga0070681_100126404	195
121	3300005459	Ga0068867_100067537	Ga0068867_1000675372	195
122	3300005467	Ga0070706_100677187	Ga0070706_1006771871	195
123	3300005518	Ga0070699_100001118	Ga0070699_10000111820	195
124	3300005530	Ga0070679_100042840	Ga0070679_1000428403	195
125	3300005536	Ga0070697_100009252	Ga0070697_1000092524	195
126	3300005536	Ga0070697_100437735	Ga0070697_1004377352	195
127	3300005544	Ga0070686_100451789	Ga0070686_1004517892	195
128	3300005545	Ga0070695_100006602	Ga0070695_1000066027	195
129	3300005546	Ga0070696_100000036	Ga0070696_10000003640	195
130	3300005549	Ga0070704_100008928	Ga0070704_1000089287	195
131	3300005549	Ga0070704_100061274	Ga0070704_1000612743	195
132	3300005577	Ga0068857_100024057	Ga0068857_1000240572	195
133	3300005615	Ga0070702_100052095	Ga0070702_1000520952	195
134	3300005617	Ga0068859_100002881	Ga0068859_1000028813	195
135	3300005617	Ga0068859_100683991	Ga0068859_1006839911	195
136	3300005843	Ga0068860_100000758	Ga0068860_10000075811	195
137	3300005843	Ga0068860_100158586	Ga0068860_1001585862	195
138	3300005844	Ga0068862_100001849	Ga0068862_1000018494	195
139	3300006038	Ga0075365_10006755	Ga0075365_100067557	195
140	3300006038	Ga0075365_10193263	Ga0075365_101932632	195
141	3300006042	Ga0075368_10001299	Ga0075368_100012997	195
142	3300006042	Ga0075368_10005248	Ga0075368_100052484	195
143	3300006042	Ga0075368_10075766	Ga0075368_100757662	195
144	3300006048	Ga0075363_100002796	Ga0075363_1000027961	195
145	3300006048	Ga0075363_100021865	Ga0075363_1000218654	195
146	3300006048	Ga0075363_100142667	Ga0075363_1001426672	195
147	3300006051	Ga0075364_10003077	Ga0075364_1000307710	195
148	3300006051	Ga0075364_10095019	Ga0075364_100950193	195
149	3300006051	Ga0075364_10359715	Ga0075364_103597152	195
150	3300006175	Ga0070712_100008617	Ga0070712_1000086176	195
151	3300006177	Ga0075362_10085842	Ga0075362_100858422	195
152	3300006177	Ga0075362_10117499	Ga0075362_101174992	195
153	3300006178	Ga0075367_10004018	Ga0075367_100040184	195
154	3300006178	Ga0075367_10020318	Ga0075367_100203184	195
155	3300006178	Ga0075367_10248516	Ga0075367_102485162	195
156	3300006195	Ga0075366_10219091	Ga0075366_102190912	195
157	3300006846	Ga0075430_100026396	Ga0075430_1000263964	195
158	3300006847	Ga0075431_100002257	Ga0075431_10000225713	195
159	3300006871	Ga0075434_100310711	Ga0075434_1003107112	195
160	3300006871	Ga0075434_100699694	Ga0075434_1006996942	195
161	3300006871	Ga0075434_100763290	Ga0075434_1007632901	195
162	3300006931	Ga0097620_100002881	Ga0097620_1000028813	195
163	3300006931	Ga0097620_100683869	Ga0097620_1006838691	195
164	3300007076	Ga0075435_100580280	Ga0075435_1005802801	195
165	3300007265	Ga0099794_10106219	Ga0099794_101062192	195
166	3300009094	Ga0111539_10225561	Ga0111539_102255612	195
167	3300009147	Ga0114129_10297959	Ga0114129_102979592	195
168	3300009148	Ga0105243_10118393	Ga0105243_101183932	195
169	3300009553	Ga0105249_10002898	Ga0105249_1000289811	195
170	3300010375	Ga0105239_10178253	Ga0105239_101782533	195
171	3300011119	Ga0105246_10088421	Ga0105246_100884212	195
172	3300013306	Ga0163162_10609773	Ga0163162_106097732	195
173	3300014326	Ga0157380_10044114	Ga0157380_100441142	195
174	3300014968	Ga0157379_10255999	Ga0157379_102559992	195
175	3300014968	Ga0157379_10800370	Ga0157379_108003701	195
176	3300021384	Ga0213876_10366028	Ga0213876_103660281	195
177	3300025885	Ga0207653_10010875	Ga0207653_100108753	195
178	3300025898	Ga0207692_10318779	Ga0207692_103187791	195
179	3300025904	Ga0207647_10312628	Ga0207647_103126281	195
180	3300025906	Ga0207699_10474534	Ga0207699_104745341	195
181	3300025912	Ga0207707_10011137	Ga0207707_100111376	195
182	3300025915	Ga0207693_10013647	Ga0207693_100136476	195
183	3300025917	Ga0207660_10002447	Ga0207660_100024476	195
184	3300025918	Ga0207662_10023254	Ga0207662_100232542	195
185	3300025921	Ga0207652_10152751	Ga0207652_101527513	195
186	3300025938	Ga0207704_10273155	Ga0207704_102731552	195
187	3300025961	Ga0207712_10004745	Ga0207712_100047457	195
188	3300025961	Ga0207712_10229226	Ga0207712_102292262	195
189	3300025972	Ga0207668_10182715	Ga0207668_101827152	195
190	3300026067	Ga0207678_10031181	Ga0207678_100311812	195
191	3300026075	Ga0207708_10000943	Ga0207708_1000094315	195
192	3300026095	Ga0207676_10032907	Ga0207676_100329074	195
193	3300026116	Ga0207674_10011274	Ga0207674_100112747	195
194	3300027671	Ga0209588_1134720	Ga0209588_11347201	195
195	3300027866	Ga0209813_10000400	Ga0209813_100004008	195
196	3300028381	Ga0268264_10000704	Ga0268264_1000070412	195
197	3300028381	Ga0268264_10698306	Ga0268264_106983061	195
198	3300035086	Ga0373934_0009665	Ga0373934_0009665_2860_3474	195
199	3300035089	Ga0373944_0010267	Ga0373944_0010267_395_1009	195
200	3300035111	Ga0373923_0000438	Ga0373923_0000438_3300_3914	195
201	3300035113	Ga0373936_0001591	Ga0373936_0001591_7262_7876	195
202	3300035116	Ga0373945_0140967	Ga0373945_0140967_341_955	195
203	3300035117	Ga0373953_0008471	Ga0373953_0008471_1746_2360	195
204	3300035118	Ga0373954_0010350	Ga0373954_0010350_2873_3487	195
205	3300035119	Ga0373956_0010545	Ga0373956_0010545_2546_3160	195
206	3300035120	Ga0373957_0000944	Ga0373957_0000944_2378_2992	195
207	3300035172	Ga0373955_0005279	Ga0373955_0005279_4529_5143	195
208	3300035692	Ga0373935_0097314	Ga0373935_0097314_1132_1746	195
209	3300035695	Ga0373927_0017693	Ga0373927_0017693_1537_2151	195
210	3300036401	Ga0373937_0063924	Ga0373937_0063924_1618_2232	195
211	3300037068	Ga0373925_0042996	Ga0373925_0042996_2697_3311	195
212	3300037853	Ga0436364_1414101	Ga0436364_1414101_340_954	195
213	3300039437	Ga0436365_1264609	Ga0436365_1264609_350_964	195
214	3300039437	Ga0436365_1474914	Ga0436365_1474914_523_1137	195
215	3300039437	Ga0436365_1677510	Ga0436365_1677510_2601_3215	195
216	3300039438	Ga0436360_0524672	Ga0436360_0524672_87_701	195
217	3300039453	Ga0436362_0828113	Ga0436362_0828113_194_808	195
218	3300045051	Ga0451576_0077593	Ga0451576_0077593_227_841	195
219	3300045051	Ga0451576_0463948	Ga0451576_0463948_665_1282	195
220	3300046454	Ga0495592_0028010	Ga0495592_0028010_911_1525	195
221	3300046459	Ga0495629_0128423	Ga0495629_0128423_296_910	195
222	3300046461	Ga0495641_0022772	Ga0495641_0022772_985_1599	195
223	3300046462	Ga0495651_0029542	Ga0495651_0029542_92_706	195
224	3300046462	Ga0495651_0300104	Ga0495651_0300104_155_769	195
225	3300046463	Ga0495653_0014889	Ga0495653_0014889_2742_3356	195
226	3300046472	Ga0495580_0008928	Ga0495580_0008928_2967_3581	195
227	3300046476	Ga0495662_0013202	Ga0495662_0013202_1115_1729	195
228	3300046511	Ga0495608_0016292	Ga0495608_0016292_970_1584	195
229	3300046514	Ga0495618_0003828	Ga0495618_0003828_6126_6740	195
230	3300046517	Ga0495630_0001951	Ga0495630_0001951_7319_7933	195
231	3300046526	Ga0495666_0037019	Ga0495666_0037019_1438_2052	195
232	3300046531	Ga0495665_0018483	Ga0495665_0018483_1258_1872	195
233	3300046533	Ga0495640_0011525	Ga0495640_0011525_5401_6015	195
234	3300046535	Ga0495586_0014076	Ga0495586_0014076_2546_3160	195
235	3300046536	Ga0495587_0008649	Ga0495587_0008649_3390_4004	195
236	3300046557	Ga0495622_0089329	Ga0495622_0089329_93_707	195
237	3300046559	Ga0495667_0016277	Ga0495667_0016277_2546_3160	195
238	3300046642	Ga0495634_0033273	Ga0495634_0033273_1629_2243	195
239	3300046675	Ga0495657_0001733	Ga0495657_0001733_8199_8813	195
240	3300046678	Ga0495599_0013855	Ga0495599_0013855_2743_3357	195
241	3300046681	Ga0495647_0001806	Ga0495647_0001806_1327_1941	195
242	3300046683	Ga0495658_0005222	Ga0495658_0005222_3716_4330	195
243	3300046689	Ga0495613_0008236	Ga0495613_0008236_1089_1703	195
244	3300046690	Ga0495624_0098642	Ga0495624_0098642_332_946	195
245	3300046809	Ga0495600_0007585	Ga0495600_0007585_2697_3311	195
246	3300047317	Ga0495604_0042440	Ga0495604_0042440_628_1242	195
247	3300047322	Ga0495680_0015960	Ga0495680_0015960_4342_4956	195
248	3300047471	Ga0495684_0006779	Ga0495684_0006779_6092_6706	195
249	3300048904	Ga0496101_0143159	Ga0496101_0143159_176_790	195
250	3300048905	Ga0496102_0005652	Ga0496102_0005652_9858_10472	195
251	3300048906	Ga0496103_0009202	Ga0496103_0009202_3376_3990	195
252	3300048907	Ga0496104_0000346	Ga0496104_0000346_20298_20972	195
253	3300048907	Ga0496104_0068331	Ga0496104_0068331_1338_1952	195
254	3300048908	Ga0496105_0021581	Ga0496105_0021581_4032_4706	195
255	3300048909	Ga0496106_0000429	Ga0496106_0000429_4359_4973	195
256	3300048910	Ga0496107_0018006	Ga0496107_0018006_2614_3228	195
257	3300048911	Ga0496108_0007004	Ga0496108_0007004_513_1187	195
258	3300048912	Ga0496109_0003554	Ga0496109_0003554_11345_12019	195
259	3300048913	Ga0496110_0000209	Ga0496110_0000209_13584_14258	195
260	3300048914	Ga0496111_0003116	Ga0496111_0003116_8909_9523	195
261	3300048916	Ga0496113_0004702	Ga0496113_0004702_7247_7921	195
262	3300048917	Ga0496114_0423597	Ga0496114_0423597_461_1075	195
263	3300049572	Ga0501036_0133667	Ga0501036_0133667_1432_2052	195
264	3300049576	Ga0501040_0092949	Ga0501040_0092949_661_1275	195
265	3300049576	Ga0501040_0658284	Ga0501040_0658284_119_733	195
266	3300049578	Ga0501042_0187731	Ga0501042_0187731_765_1379	195
267	3300049580	Ga0501046_0015392	Ga0501046_0015392_3106_3720	195
268	3300049580	Ga0501046_0290058	Ga0501046_0290058_14_628	195
269	3300049584	Ga0501068_0529144	Ga0501068_0529144_69_683	195
270	3300049585	Ga0501069_0259369	Ga0501069_0259369_53_682	195
271	3300049587	Ga0501071_0629751	Ga0501071_0629751_156_770	195
272	3300049588	Ga0501072_0124062	Ga0501072_0124062_957_1571	195
273	3300049591	Ga0501075_0370689	Ga0501075_0370689_246_860	195
274	3300049592	Ga0501076_0117506	Ga0501076_0117506_1019_1633	195
275	3300049592	Ga0501076_0208342	Ga0501076_0208342_392_1006	195
276	3300049593	Ga0501077_0009752	Ga0501077_0009752_4069_4683	195
277	3300049741	Ga0501079_0037080	Ga0501079_0037080_31_645	195
278	3300049741	Ga0501079_0428773	Ga0501079_0428773_172_786	195
279	3300049743	Ga0501081_0020765	Ga0501081_0020765_1826_2440	195
280	3300049743	Ga0501081_0075676	Ga0501081_0075676_583_1197	195
281	3300049824	Ga0501045_0032017	Ga0501045_0032017_1245_1859	195
282	3300050490	nmdc:mga03n38_123575_c1	nmdc:mga03n38_123575_c1_423_1037	195
283	3300050490	nmdc:mga03n38_303_c1	nmdc:mga03n38_303_c1_1672_2286	195
284	3300050490	nmdc:mga03n38_499184_c1	nmdc:mga03n38_499184_c1_55_669	195
285	3300050490	nmdc:mga03n38_5304_c1	nmdc:mga03n38_5304_c1_445_1059	195
286	3300050492	nmdc:mga0yw44_5626_c1	nmdc:mga0yw44_5626_c1_1033_1647	195
287	3300050494	nmdc:mga06z11_1093_c1	nmdc:mga06z11_1093_c1_6736_7350	195
288	3300050494	nmdc:mga06z11_1406_c1	nmdc:mga06z11_1406_c1_3629_4243	195
289	3300050495	nmdc:mga04h51_2604_c1	nmdc:mga04h51_2604_c1_2739_3353	195
290	3300050496	nmdc:mga07m45_15663_c1	nmdc:mga07m45_15663_c1_2852_3466	195
291	3300050508	nmdc:mga09592_436604_c1	nmdc:mga09592_436604_c1_429_1043	195
292	3300050509	nmdc:mga0qj67_20203_c1	nmdc:mga0qj67_20203_c1_2531_3145	195
293	3300050510	nmdc:mga06r32_113559_c1	nmdc:mga06r32_113559_c1_1060_1674	195
294	3300050510	nmdc:mga06r32_43868_c1	nmdc:mga06r32_43868_c1_1679_2293	195
295	3300050513	nmdc:mga0rr50_549587_c1	nmdc:mga0rr50_549587_c1_44_658	195
296	3300053077	Ga0495601_0056621	Ga0495601_0056621_507_1121	195
297	3300053077	Ga0495601_0101775	Ga0495601_0101775_205_819	195
298	3300053078	Ga0495612_0148549	Ga0495612_0148549_374_988	195
299	3300053084	Ga0495595_0006805	Ga0495595_0006805_1492_2106	195
300	3300053085	Ga0495619_0024140	Ga0495619_0024140_962_1576	195
301	3300053085	Ga0495619_0072697	Ga0495619_0072697_785_1399	195
302	3300053103	Ga0500555_043848	Ga0500555_043848_502_1116	195
303	3300053153	Ga0500616_0065184	Ga0500616_0065184_131_745	195
304	3300054114	Ga0501084_0196584	Ga0501084_0196584_1057_1671	195
305	3300054114	Ga0501084_0387049	Ga0501084_0387049_484_1098	195
306	3300059426	Ga0590077_013474	Ga0590077_013474_724_1338	195
307	3300060353	Ga0501082_0580071	Ga0501082_0580071_41_655	195
308	3300009545	Ga0105237_10393560	Ga0105237_103935602	201
309	3300009551	Ga0105238_10030014	Ga0105238_100300142	201
310	3300025914	Ga0207671_10309850	Ga0207671_103098502	201
311	iso_pu_bacteria	2585428106	2587917758	201
312	iso_pu_bacteria	2643221583	2643924271	201
313	iso_pu_bacteria	2643221640	2644226723	201
314	iso_pu_bacteria	2643221642	2644233807	201
315	iso_pu_bacteria	2928531327	2928531407	201
316	3300006028	Ga0070717_10030076	Ga0070717_100300763	203
317	3300006881	Ga0068865_100028558	Ga0068865_1000285583	203
318	3300009176	Ga0105242_10284904	Ga0105242_102849042	203
319	3300009177	Ga0105248_10000384	Ga0105248_1000038426	203
320	3300013306	Ga0163162_10528053	Ga0163162_105280531	203
321	3300014325	Ga0163163_10056389	Ga0163163_100563895	203
322	3300025938	Ga0207704_10000784	Ga0207704_100007848	203
323	3300025941	Ga0207711_10000691	Ga0207711_1000069126	203
324	3300026095	Ga0207676_10725478	Ga0207676_107254782	203
325	3300028786	Ga0307517_10102918	Ga0307517_101029183	203
326	3300037312	Ga0395899_0000018	Ga0395899_0000018_17458_18069	203
327	3300037312	Ga0395899_0002171	Ga0395899_0002171_13963_14574	203
328	3300037418	Ga0395900_0000002	Ga0395900_0000002_184453_185064	203
329	3300037466	Ga0395898_0016636	Ga0395898_0016636_1531_2142	203
330	3300037471	Ga0395905_0005996	Ga0395905_0005996_8061_8672	203
331	3300037471	Ga0395905_0628469	Ga0395905_0628469_283_927	203
332	3300038443	Ga0395901_0000021	Ga0395901_0000021_109841_110452	203
333	3300045049	Ga0466959_0424420	Ga0466959_0424420_266_877	203
334	3300046471	Ga0495650_0025998	Ga0495650_0025998_1850_2461	203
335	3300046506	Ga0495583_0008677	Ga0495583_0008677_3610_4221	203
336	3300046543	Ga0495645_0226204	Ga0495645_0226204_134_745	203
337	3300046660	Ga0495625_0148332	Ga0495625_0148332_500_1111	203
338	3300046678	Ga0495599_0078102	Ga0495599_0078102_151_762	203
339	3300047319	Ga0495674_0124302	Ga0495674_0124302_708_1319	203
340	3300050489	nmdc:mga03683_169716_c1	nmdc:mga03683_169716_c1_177_788	203
341	3300053077	Ga0495601_0363801	Ga0495601_0363801_75_686	203
342	3300006195	Ga0075366_10015764	Ga0075366_100157643	205
343	3300006353	Ga0075370_10231690	Ga0075370_102316902	205
344	3300046453	Ga0495627_001159	Ga0495627_001159_4212_4829	205
345	3300046794	Ga0495589_0001649	Ga0495589_0001649_9420_10043	205
346	3300047469	Ga0495673_0000119	Ga0495673_0000119_106752_107375	205
347	3300047472	Ga0495686_0115150	Ga0495686_0115150_37_660	205
348	3300053090	Ga0500646_0022716	Ga0500646_0022716_794_1411	205
349	3300053136	Ga0500559_0004392	Ga0500559_0004392_3021_3644	205
350	3300053142	Ga0500577_0005108	Ga0500577_0005108_2572_3195	205
351	iso_pu_bacteria	2884298095	2884300650	207
352	3300005564	Ga0070664_100562838	Ga0070664_1005628381	211
353	3300005618	Ga0068864_100083525	Ga0068864_1000835254	211
354	3300014745	Ga0157377_10079293	Ga0157377_100792932	211
355	3300021377	Ga0213874_10022727	Ga0213874_100227271	211
356	3300025898	Ga0207692_10582358	Ga0207692_105823581	211
357	3300035089	Ga0373944_0072591	Ga0373944_0072591_365_1000	211
358	3300035725	Ga0373947_0087900	Ga0373947_0087900_38_673	211
359	3300037068	Ga0373925_0094392	Ga0373925_0094392_1308_1943	211
360	3300039450	Ga0436363_1634529	Ga0436363_1634529_301_936	211
361	3300046690	Ga0495624_0231269	Ga0495624_0231269_245_880	211
362	3300047321	Ga0495676_0053424	Ga0495676_0053424_1492_2127	211
363	3300048905	Ga0496102_0619913	Ga0496102_0619913_251_886	211
364	3300048907	Ga0496104_0016666	Ga0496104_0016666_1845_2480	211
365	3300048908	Ga0496105_0001039	Ga0496105_0001039_9192_9827	211
366	3300048911	Ga0496108_0009329	Ga0496108_0009329_5733_6368	211
367	3300048912	Ga0496109_0021276	Ga0496109_0021276_2744_3379	211
368	3300048913	Ga0496110_0380890	Ga0496110_0380890_541_1176	211
369	3300048914	Ga0496111_0054869	Ga0496111_0054869_1727_2362	211
370	3300048915	Ga0496112_0021288	Ga0496112_0021288_4348_4983	211
371	3300048916	Ga0496113_0000537	Ga0496113_0000537_11494_12129	211
372	3300048918	Ga0496115_0010217	Ga0496115_0010217_3022_3657	211
373	3300003203	JGI25406J46586_10032344	JGI25406J46586_100323443	213
374	3300005355	Ga0070671_100715670	Ga0070671_1007156701	213
375	3300005364	Ga0070673_100630402	Ga0070673_1006304021	213
376	3300005535	Ga0070684_100015047	Ga0070684_1000150475	213
377	3300005539	Ga0068853_100594060	Ga0068853_1005940602	213
378	3300005563	Ga0068855_100919990	Ga0068855_1009199902	213
379	3300005985	Ga0081539_10000798	Ga0081539_1000079824	213
380	3300009098	Ga0105245_10745499	Ga0105245_107454992	213
381	3300009545	Ga0105237_10788801	Ga0105237_107888011	213
382	3300009551	Ga0105238_10009368	Ga0105238_100093689	213
383	3300013307	Ga0157372_10773990	Ga0157372_107739902	213
384	3300021384	Ga0213876_10110564	Ga0213876_101105642	213
385	3300025914	Ga0207671_10651207	Ga0207671_106512071	213
386	3300025918	Ga0207662_10406329	Ga0207662_104063292	213
387	3300025918	Ga0207662_10477543	Ga0207662_104775431	213
388	3300025924	Ga0207694_10014334	Ga0207694_100143342	213
389	3300025949	Ga0207667_10834124	Ga0207667_108341241	213
390	3300026041	Ga0207639_10461197	Ga0207639_104611971	213
391	3300026118	Ga0207675_100595384	Ga0207675_1005953842	213
392	3300028381	Ga0268264_10706124	Ga0268264_107061241	213
393	3300035692	Ga0373935_0586930	Ga0373935_0586930_34_675	213
394	3300039437	Ga0436365_0875582	Ga0436365_0875582_3354_3995	213
395	3300039453	Ga0436362_0997883	Ga0436362_0997883_108_749	213
396	3300049744	Ga0501083_0021270	Ga0501083_0021270_2735_3376	213
397	3300060353	Ga0501082_0000040	Ga0501082_0000040_18908_19549	213

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

35

111

0.9 PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

148

218

0.89 PF14497

GST_C_3

Glutathione S-transferase, C-terminal domain

137

232

0.84 PF00043

GST_C

Glutathione S-transferase, C-terminal domain

135

223

0.83 PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

45

112

0.81 PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

39

117

0.74 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
2dsa-assembly2.cif.gz_C	ternary complex of bphk, a bacterial gst	0.9621	1	198
3uap-assembly1.cif.gz_A	crystal structure of glutathione transferase (target efi-501774) from methylococcus capsulatus str. bath	0.9581	2	198
1pmt-assembly1.cif.gz_A	glutathione transferase from proteus mirabilis	0.9551	1	198
4gci-assembly1.cif.gz_B	crystal structure of glutahtione s-transferase homolog from yersinia pestis, target efi-501894, with bound glutathione, monoclinic form	0.9483	2	198
2dsa-assembly2.cif.gz_C	ternary complex of bphk, a bacterial gst	0.948	1	198

ID	Description	Score	Start	End	Superfamily
4gf0B01	Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin	0.9839	1	81	3.40.30.10
af_P0A9D2_1_80_3.40.30.10	Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin	0.9591	1	80	3.40.30.10
4gf0B01	Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin	0.9528	1	81	3.40.30.10
af_P0A9D2_2_199_3.50.50.60	Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain	0.95	3	198	3.50.50.60
1n2aB01	Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin	0.9439	1	83	3.40.30.10

ID	Description	Score	Start	End	GO Terms
AF-A0A1W9IMN4-F1-model_v4	Glutathione S-transferase	0.9855	1	210	GO:0016740
AF-A0A363TLJ3-F1-model_v4	Glutathione S-transferase	0.9809	1	212	GO:0016740
AF-A0A3S0G9W8-F1-model_v4	Glutathione S-transferase	0.9806	1	212	GO:0016740
AF-A0A3A8KCX2-F1-model_v4	Glutathione S-transferase	0.978	1	212	GO:0016740
AF-A0A1L6LG51-F1-model_v4	deleted	0.9779	1	146

Feature Viewer

pLDDT	pTM	Quality
96.66	0.93	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F433770

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

35

111

0.9

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

148

218

0.89

PF14497

GST_C_3

Glutathione S-transferase, C-terminal domain

137

232

0.84

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

135

223

0.83

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

45

112

0.81

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

39

117

0.74

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map