F433756

General Info

Members Datasets Scaffolds Average Seq Length
397 233 794 137

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_12663009|Ga0105249_126630091
Length 156
Sequence MSGSFKTSRAASARMRGMDQRISLITLGVADLGRAMGFYSGLGWEGASPDGDVAFYQAGGMVFALWSRAKLQEDSAVADPGGWGGITLAYNARSPEEVDAVLAEAEAAGGTLGRAGAATFWGGYSGVFLDPDGHPWEVAHNPTWTINDDGTVSLGG

Samples

Sample ID Description Type Environment
1 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
73 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
132 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
134 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
137 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
138 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
139 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
140 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
141 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
142 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
145 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
146 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
147 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
148 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
149 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
155 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
156 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
157 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
158 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
159 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
160 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
161 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
162 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
163 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
164 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
165 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
166 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
167 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
168 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
169 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
170 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
171 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
172 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
173 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
174 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
175 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
176 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
177 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
178 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
179 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
180 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
181 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
182 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
183 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
184 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
185 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
186 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
187 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
188 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
189 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
190 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
191 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
198 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
217 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
218 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
219 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
220 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
221 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
222 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
223 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
224 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
225 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
226 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
228 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
229 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
230 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
231 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
232 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
233 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.5
Nodule 0
Rhizoplane 11.59
Rhizosphere 85.64
Stem 0
Stem Tuber 0
Unclassified 9.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105249_12663009 3300009553 Bacteria 572
2 JGI24743J22301_10072450 3300001991 Bacteria 720
3 Ga0070658_10367496 3300005327 Bacteria 1233
4 Ga0070676_10554769 3300005328 Bacteria 823
5 Ga0070683_100001307 3300005329 Bacteria 18992
6 Ga0070683_100724933 3300005329 Bacteria 952
7 Ga0070690_100573821 3300005330 Bacteria 853
8 Ga0068869_100396610 3300005334 Bacteria 1134
9 Ga0070682_100022436 3300005337 Bacteria 3739
10 Ga0068868_100411082 3300005338 Bacteria 1170
11 Ga0068868_100413106 3300005338 Unclassified 1167
12 Ga0068868_100568683 3300005338 Bacteria 1001
13 Ga0070660_100116651 3300005339 Unclassified 2129
14 Ga0070689_100149530 3300005340 Bacteria 1883
15 Ga0070691_10022061 3300005341 Bacteria 2952
16 Ga0070692_10322903 3300005345 Bacteria 950
17 Ga0070692_10810245 3300005345 Bacteria 640
18 Ga0070675_100117008 3300005354 Bacteria 2261
19 Ga0070675_100719532 3300005354 Bacteria 910
20 Ga0070671_100176502 3300005355 Bacteria 1808
21 Ga0070671_101518647 3300005355 Unclassified 593
22 Ga0070674_100276584 3300005356 Bacteria 1329
23 Ga0070659_100330347 3300005366 Bacteria 1276
24 Ga0070703_10011732 3300005406 Bacteria 2479
25 Ga0070703_10075418 3300005406 Bacteria 1136
26 Ga0070714_100252521 3300005435 Bacteria 1631
27 Ga0070711_100048928 3300005439 Bacteria 2893
28 Ga0070700_100007905 3300005441 Bacteria 5770
29 Ga0070694_100750399 3300005444 Unclassified 797
30 Ga0070708_100108348 3300005445 Bacteria 2551
31 Ga0070708_100216165 3300005445 Bacteria 1797
32 Ga0070708_100258952 3300005445 Bacteria 1635
33 Ga0070708_100288637 3300005445 Bacteria 1544
34 Ga0070708_100299689 3300005445 Bacteria 1514
35 Ga0070708_100477413 3300005445 Bacteria 1176
36 Ga0070663_100280884 3300005455 Bacteria 1327
37 Ga0070678_100001858 3300005456 Bacteria 11385
38 Ga0070678_100972810 3300005456 Unclassified 779
39 Ga0070662_100034182 3300005457 Bacteria 3584
40 Ga0070662_100138136 3300005457 Bacteria 1886
41 Ga0070681_10007045 3300005458 Bacteria 10949
42 Ga0070685_10839652 3300005466 Bacteria 680
43 Ga0070706_100009131 3300005467 Bacteria 9232
44 Ga0070706_100016191 3300005467 Bacteria 6886
45 Ga0070706_100018956 3300005467 Bacteria 6347
46 Ga0070706_100092139 3300005467 Bacteria 2811
47 Ga0070706_100241943 3300005467 Unclassified 1685
48 Ga0070706_100582249 3300005467 Bacteria 1040
49 Ga0070706_100771249 3300005467 Bacteria 891
50 Ga0070707_100001228 3300005468 Bacteria 25164
51 Ga0070707_100057943 3300005468 Bacteria 3716
52 Ga0070707_100125836 3300005468 Bacteria 2490
53 Ga0070707_100354927 3300005468 Bacteria 1424
54 Ga0070707_100526123 3300005468 Bacteria 1144
55 Ga0070707_100614506 3300005468 Bacteria 1049
56 Ga0070698_100000207 3300005471 Bacteria 56814
57 Ga0070698_100014754 3300005471 Bacteria 8253
58 Ga0070698_100040531 3300005471 Bacteria 4785
59 Ga0070698_100052646 3300005471 Bacteria 4140
60 Ga0070698_100068515 3300005471 Bacteria 3565
61 Ga0070698_100080985 3300005471 Unclassified 3241
62 Ga0070698_100136305 3300005471 Bacteria 2408
63 Ga0070698_100232342 3300005471 Bacteria 1777
64 Ga0070698_100379832 3300005471 Bacteria 1345
65 Ga0070698_100385178 3300005471 Bacteria 1335
66 Ga0070699_100000290 3300005518 Bacteria 48297
67 Ga0070699_100021191 3300005518 Bacteria 5603
68 Ga0070699_100299950 3300005518 Bacteria 1441
69 Ga0070699_100683363 3300005518 Bacteria 937
70 Ga0070699_101067348 3300005518 Bacteria 741
71 Ga0070679_100039716 3300005530 Bacteria 4678
72 Ga0070679_100450998 3300005530 Bacteria 1231
73 Ga0070684_100001050 3300005535 Bacteria 19730
74 Ga0070684_100006945 3300005535 Bacteria 8792
75 Ga0070697_100000817 3300005536 Bacteria 23340
76 Ga0070697_100001383 3300005536 Bacteria 18353
77 Ga0070697_100007634 3300005536 Bacteria 8419
78 Ga0070697_100197202 3300005536 Bacteria 1710
79 Ga0070697_100328812 3300005536 Bacteria 1317
80 Ga0070697_100438720 3300005536 Bacteria 1136
81 Ga0070697_101834192 3300005536 Unclassified 543
82 Ga0068853_100095294 3300005539 Bacteria 2624
83 Ga0070672_100709997 3300005543 Bacteria 881
84 Ga0070686_100148075 3300005544 Bacteria 1641
85 Ga0070693_100058991 3300005547 Bacteria 2223
86 Ga0070704_100061597 3300005549 Bacteria 2686
87 Ga0068855_100700133 3300005563 Bacteria 1084
88 Ga0070664_100006775 3300005564 Bacteria 9237
89 Ga0070664_100568091 3300005564 Unclassified 1050
90 Ga0068857_101482245 3300005577 Bacteria 661
91 Ga0068854_100310009 3300005578 Bacteria 1280
92 Ga0068856_100008275 3300005614 Bacteria 10137
93 Ga0068856_100072024 3300005614 Bacteria 3422
94 Ga0068856_100196885 3300005614 Bacteria 2029
95 Ga0070702_100112745 3300005615 Bacteria 1689
96 Ga0068852_100065473 3300005616 Bacteria 3171
97 Ga0068861_101606659 3300005719 Unclassified 641
98 Ga0068851_10219270 3300005834 Bacteria 1068
99 Ga0081455_10389544 3300005937 Bacteria 971
100 Ga0081538_10019008 3300005981 Bacteria 5130
101 Ga0081540_1000964 3300005983 Bacteria 25975
102 Ga0070717_10029099 3300006028 Bacteria 4429
103 Ga0070717_10345367 3300006028 Bacteria 1330
104 Ga0075368_10378517 3300006042 Bacteria 619
105 Ga0070716_100063833 3300006173 Bacteria 2140
106 Ga0070712_100140289 3300006175 Bacteria 1843
107 Ga0068871_100481840 3300006358 Unclassified 1116
108 Ga0075430_100076093 3300006846 Bacteria 2813
109 Ga0075431_100682684 3300006847 Bacteria 1005
110 Ga0075436_100065987 3300006914 Bacteria 2501
111 Ga0075435_100634176 3300007076 Bacteria 927
112 Ga0099795_10429651 3300007788 Unclassified 605
113 Ga0105240_11338866 3300009093 Bacteria 754
114 Ga0111539_10165064 3300009094 Bacteria 2590
115 Ga0105245_10007679 3300009098 Bacteria 9447
116 Ga0105245_10023189 3300009098 Bacteria 5447
117 Ga0105245_10115428 3300009098 Bacteria 2502
118 Ga0105245_11321851 3300009098 Bacteria 770
119 Ga0114129_10422344 3300009147 Bacteria 1753
120 Ga0105243_10068331 3300009148 Bacteria 2864
121 Ga0105243_11630400 3300009148 Bacteria 672
122 Ga0105241_10027423 3300009174 Bacteria 4242
123 Ga0105238_10909305 3300009551 Bacteria 899
124 Ga0105249_10180969 3300009553 Unclassified 2051
125 Ga0105249_10433664 3300009553 Bacteria 1350
126 Ga0105239_10009918 3300010375 Bacteria 10696
127 Ga0105246_10017549 3300011119 Bacteria 4551
128 Ga0105246_10036622 3300011119 Bacteria 3288
129 Ga0157313_1040715 3300012503 Bacteria 569
130 Ga0157324_1000389 3300012506 Bacteria 2043
131 Ga0157373_10608227 3300013100 Unclassified 796
132 Ga0157371_10287450 3300013102 Bacteria 1189
133 Ga0157370_11606702 3300013104 Bacteria 584
134 Ga0157374_10026347 3300013296 Bacteria 5231
135 Ga0157374_10132325 3300013296 Bacteria 2415
136 Ga0157374_11214933 3300013296 Unclassified 775
137 Ga0157372_10051981 3300013307 Bacteria 4561
138 Ga0157375_10180505 3300013308 Bacteria 2262
139 Ga0157375_10290828 3300013308 Bacteria 1797
140 Ga0157375_12437953 3300013308 Unclassified 624
141 Ga0163163_10517289 3300014325 Bacteria 1256
142 Ga0163163_11224408 3300014325 Bacteria 813
143 Ga0157377_10001337 3300014745 Bacteria 10586
144 Ga0157377_10169672 3300014745 Bacteria 1364
145 Ga0157377_10360348 3300014745 Bacteria 978
146 Ga0157379_11253192 3300014968 Bacteria 715
147 Ga0157376_10430583 3300014969 Bacteria 1282
148 Ga0157376_11093939 3300014969 Unclassified 823
149 Ga0207653_10327512 3300025885 Bacteria 596
150 Ga0207688_10002411 3300025901 Bacteria 10077
151 Ga0207647_10301390 3300025904 Bacteria 912
152 Ga0207645_10562118 3300025907 Bacteria 774
153 Ga0207643_10147049 3300025908 Bacteria 1410
154 Ga0207684_10000183 3300025910 Bacteria 100388
155 Ga0207684_10000299 3300025910 Bacteria 70378
156 Ga0207684_10003065 3300025910 Bacteria 16563
157 Ga0207684_10007131 3300025910 Bacteria 10098
158 Ga0207684_10077211 3300025910 Bacteria 2831
159 Ga0207684_10123223 3300025910 Bacteria 2223
160 Ga0207684_10243533 3300025910 Bacteria 1551
161 Ga0207684_10543888 3300025910 Bacteria 994
162 Ga0207654_10041754 3300025911 Bacteria 2592
163 Ga0207707_10005974 3300025912 Bacteria 10652
164 Ga0207693_10137803 3300025915 Bacteria 1919
165 Ga0207663_10046017 3300025916 Bacteria 2686
166 Ga0207660_10878429 3300025917 Bacteria 732
167 Ga0207657_10027869 3300025919 Bacteria 5165
168 Ga0207652_10030647 3300025921 Bacteria 4506
169 Ga0207652_11006042 3300025921 Bacteria 732
170 Ga0207646_10000043 3300025922 Bacteria 184713
171 Ga0207646_10000944 3300025922 Bacteria 37384
172 Ga0207646_10001502 3300025922 Bacteria 28678
173 Ga0207646_10002794 3300025922 Bacteria 20342
174 Ga0207646_10010160 3300025922 Bacteria 9223
175 Ga0207646_10011110 3300025922 Bacteria 8743
176 Ga0207646_10013103 3300025922 Bacteria 7936
177 Ga0207646_10085573 3300025922 Bacteria 2820
178 Ga0207646_10408981 3300025922 Bacteria 1225
179 Ga0207646_10559615 3300025922 Bacteria 1028
180 Ga0207646_11568478 3300025922 Unclassified 569
181 Ga0207694_10788203 3300025924 Bacteria 803
182 Ga0207659_10523959 3300025926 Bacteria 1005
183 Ga0207659_10611197 3300025926 Bacteria 930
184 Ga0207659_11018393 3300025926 Bacteria 713
185 Ga0207687_10015123 3300025927 Bacteria 5056
186 Ga0207687_10143532 3300025927 Bacteria 1814
187 Ga0207687_10330788 3300025927 Bacteria 1236
188 Ga0207664_11116625 3300025929 Bacteria 704
189 Ga0207644_10286461 3300025931 Bacteria 1324
190 Ga0207690_10414445 3300025932 Unclassified 1077
191 Ga0207690_10625461 3300025932 Bacteria 880
192 Ga0207706_10026999 3300025933 Bacteria 5136
193 Ga0207706_10037182 3300025933 Bacteria 4323
194 Ga0207706_10461237 3300025933 Bacteria 1098
195 Ga0207709_10131327 3300025935 Bacteria 1707
196 Ga0207709_10934283 3300025935 Bacteria 706
197 Ga0207670_10184188 3300025936 Bacteria 1575
198 Ga0207669_10216903 3300025937 Bacteria 1401
199 Ga0207704_10371818 3300025938 Bacteria 1119
200 Ga0207665_10043391 3300025939 Bacteria 3006
201 Ga0207691_11196014 3300025940 Bacteria 630
202 Ga0207689_10225636 3300025942 Bacteria 1548
203 Ga0207661_10001095 3300025944 Bacteria 17995
204 Ga0207661_10175424 3300025944 Bacteria 1868
205 Ga0207661_10440916 3300025944 Bacteria 1185
206 Ga0207679_10123485 3300025945 Bacteria 2065
207 Ga0207679_10526534 3300025945 Unclassified 1058
208 Ga0207667_10731466 3300025949 Bacteria 990
209 Ga0207651_10541890 3300025960 Bacteria 1011
210 Ga0207712_10778509 3300025961 Unclassified 840
211 Ga0207640_10033139 3300025981 Bacteria 3211
212 Ga0207640_10990049 3300025981 Bacteria 739
213 Ga0207658_10442247 3300025986 Bacteria 1150
214 Ga0207658_10531321 3300025986 Bacteria 1051
215 Ga0207677_10076474 3300026023 Bacteria 2383
216 Ga0207677_10232025 3300026023 Bacteria 1487
217 Ga0207639_10086371 3300026041 Bacteria 2498
218 Ga0207678_10072287 3300026067 Bacteria 2956
219 Ga0207678_10154205 3300026067 Bacteria 1961
220 Ga0207708_10014519 3300026075 Bacteria 5895
221 Ga0207708_10201117 3300026075 Bacteria 1589
222 Ga0207708_10337788 3300026075 Bacteria 1233
223 Ga0207702_10014027 3300026078 Bacteria 6655
224 Ga0207702_10149195 3300026078 Bacteria 2125
225 Ga0207648_10283744 3300026089 Bacteria 1481
226 Ga0207648_11181854 3300026089 Unclassified 718
227 Ga0207674_10182502 3300026116 Bacteria 2050
228 Ga0207674_11754724 3300026116 Bacteria 588
229 Ga0207675_100508105 3300026118 Bacteria 1200
230 Ga0207683_10001941 3300026121 Bacteria 18312
231 Ga0209968_1040877 3300027526 Unclassified 792
232 Ga0209588_1230723 3300027671 Bacteria 570
233 Ga0268266_10285508 3300028379 Bacteria 1536
234 Ga0307515_10165393 3300028794 Bacteria 2233
235 Ga0265762_1100444 3300030760 Bacteria 641
236 Ga0265327_10013040 3300031251 Bacteria 5552
237 Ga0307513_10432361 3300031456 Bacteria 1044
238 Ga0307408_101168403 3300031548 Bacteria 717
239 Ga0307405_10014510 3300031731 Bacteria 4239
240 Ga0307413_10215783 3300031824 Bacteria 1397
241 Ga0307410_10413468 3300031852 Bacteria 1092
242 Ga0307406_10010851 3300031901 Bacteria 5150
243 Ga0307407_10680960 3300031903 Bacteria 773
244 Ga0307412_10250618 3300031911 Bacteria 1375
245 Ga0307409_100055981 3300031995 Bacteria 3048
246 Ga0307416_100054297 3300032002 Bacteria 3220
247 Ga0307416_100195003 3300032002 Bacteria 1915
248 Ga0307414_10129022 3300032004 Bacteria 1959
249 Ga0307411_10074457 3300032005 Bacteria 2314
250 Ga0307411_10665125 3300032005 Bacteria 903
251 Ga0307415_100120756 3300032126 Bacteria 1964
252 Ga0373928_0214746 3300035084 Bacteria 560
253 Ga0373935_0683607 3300035692 Bacteria 754
254 Ga0395899_0093078 3300037312 Bacteria 2182
255 Ga0395900_0046761 3300037418 Bacteria 4456
256 Ga0395900_0209461 3300037418 Bacteria 1969
257 Ga0395900_1527229 3300037418 Bacteria 580
258 Ga0395898_0698764 3300037466 Bacteria 956
259 Ga0395905_0023630 3300037471 Bacteria 5804
260 Ga0395901_0036836 3300038443 Bacteria 5057
261 Ga0451789_0198688 3300041443 Bacteria 655
262 Ga0451793_0064195 3300041452 Bacteria 3455
263 Ga0451802_0710051 3300041460 Unclassified 866
264 Ga0451802_1701409 3300041460 Bacteria 1262
265 Ga0451804_0004695 3300041463 Bacteria 1648
266 Ga0451807_0958355 3300041486 Bacteria 1051
267 Ga0451835_1169728 3300041492 Bacteria 2403
268 Ga0451839_0045805 3300041496 Bacteria 2123
269 Ga0451847_0078978 3300041503 Bacteria 1368
270 Ga0451849_1294748 3300041505 Unclassified 1174
271 Ga0451851_0088561 3300041507 Bacteria 1770
272 Ga0451855_1295135 3300041511 Bacteria 1547
273 Ga0451853_1013068 3300041512 Bacteria 1375
274 Ga0439454_002137 3300042011 Bacteria 2036
275 Ga0466972_0259323 3300044658 Bacteria 813
276 Ga0453683_0183608 3300044673 Unclassified 1327
277 Ga0466960_0496398 3300044901 Bacteria 715
278 Ga0466959_0422172 3300045049 Bacteria 905
279 Ga0466967_0162198 3300045976 Bacteria 2099
280 Ga0466967_0194146 3300045976 Bacteria 1920
281 Ga0466967_0449090 3300045976 Bacteria 1260
282 Ga0466967_0515901 3300045976 Bacteria 1174
283 Ga0466967_0726767 3300045976 Unclassified 984
284 Ga0466967_1165875 3300045976 Bacteria 768
285 Ga0495592_0080724 3300046454 Bacteria 2352
286 Ga0495651_0117141 3300046462 Bacteria 1961
287 Ga0495582_0407683 3300046473 Bacteria 784
288 Ga0495594_0357460 3300046499 Bacteria 832
289 Ga0495594_0491609 3300046499 Bacteria 697
290 Ga0495596_0300787 3300046500 Bacteria 624
291 Ga0495608_0150009 3300046511 Bacteria 1486
292 Ga0495618_0027277 3300046514 Bacteria 3556
293 Ga0495628_0236880 3300046516 Bacteria 1366
294 Ga0495631_0213278 3300046518 Unclassified 825
295 Ga0495644_0120452 3300046523 Unclassified 998
296 Ga0495621_0266414 3300046539 Unclassified 703
297 Ga0495656_0302139 3300046615 Bacteria 820
298 Ga0495635_0442648 3300046663 Bacteria 860
299 Ga0495588_0543281 3300046674 Bacteria 609
300 Ga0495588_0599106 3300046674 Bacteria 577
301 Ga0495613_0127293 3300046689 Bacteria 1826
302 Ga0495589_0413081 3300046794 Unclassified 619
303 Ga0495674_0688564 3300047319 Bacteria 803
304 Ga0495680_0258747 3300047322 Bacteria 1231
305 Ga0496100_0001389 3300048903 Bacteria 11866
306 Ga0496100_0237635 3300048903 Bacteria 1343
307 Ga0496101_0047052 3300048904 Bacteria 3096
308 Ga0496101_0083811 3300048904 Bacteria 2360
309 Ga0496102_0000860 3300048905 Bacteria 29107
310 Ga0496102_0002348 3300048905 Bacteria 16134
311 Ga0496102_0005761 3300048905 Bacteria 10533
312 Ga0496103_0004127 3300048906 Bacteria 8819
313 Ga0496103_0051493 3300048906 Bacteria 2549
314 Ga0496104_0074765 3300048907 Bacteria 3226
315 Ga0496104_0168406 3300048907 Bacteria 2101
316 Ga0496105_0006947 3300048908 Bacteria 8720
317 Ga0496105_0009864 3300048908 Bacteria 7488
318 Ga0496105_0119673 3300048908 Bacteria 2172
319 Ga0496105_0203794 3300048908 Bacteria 1614
320 Ga0496106_0000412 3300048909 Bacteria 30346
321 Ga0496106_0016702 3300048909 Bacteria 5431
322 Ga0496107_0049460 3300048910 Bacteria 3029
323 Ga0496108_0204957 3300048911 Bacteria 1711
324 Ga0496108_0294064 3300048911 Bacteria 1414
325 Ga0496108_1219922 3300048911 Bacteria 635
326 Ga0496108_1745079 3300048911 Bacteria 511
327 Ga0496109_0032795 3300048912 Bacteria 4671
328 Ga0496109_0044731 3300048912 Bacteria 4017
329 Ga0496109_0174588 3300048912 Bacteria 2017
330 Ga0496109_0385870 3300048912 Bacteria 1323
331 Ga0496110_0001732 3300048913 Bacteria 16076
332 Ga0496110_0280701 3300048913 Bacteria 1517
333 Ga0496110_0421105 3300048913 Unclassified 1217
334 Ga0496111_0082505 3300048914 Bacteria 2348
335 Ga0496111_0095678 3300048914 Bacteria 2179
336 Ga0496111_0351806 3300048914 Bacteria 1091
337 Ga0496112_0097291 3300048915 Bacteria 2914
338 Ga0496112_0667534 3300048915 Bacteria 968
339 Ga0496113_0338047 3300048916 Bacteria 1207
340 Ga0496114_0000706 3300048917 Bacteria 24901
341 Ga0496114_0092970 3300048917 Bacteria 2563
342 Ga0496114_0233529 3300048917 Bacteria 1616
343 Ga0496114_0984206 3300048917 Unclassified 726
344 Ga0496115_0220189 3300048918 Bacteria 1566
345 Ga0501031_0594000 3300049568 Bacteria 712
346 Ga0501033_0592337 3300049570 Bacteria 761
347 Ga0501034_0009028 3300049571 Bacteria 10470
348 Ga0501034_0150931 3300049571 Bacteria 2299
349 Ga0501034_0606898 3300049571 Bacteria 999
350 Ga0501036_0658491 3300049572 Bacteria 867
351 Ga0501038_0081458 3300049574 Bacteria 2727
352 Ga0501038_0363560 3300049574 Bacteria 1125
353 Ga0501039_0814381 3300049575 Bacteria 728
354 Ga0501040_0028387 3300049576 Bacteria 3772
355 Ga0501040_0248545 3300049576 Bacteria 1268
356 Ga0501041_0184430 3300049577 Bacteria 1306
357 Ga0501041_0892029 3300049577 Unclassified 571
358 Ga0501043_0475116 3300049579 Bacteria 937
359 Ga0501043_0497701 3300049579 Bacteria 911
360 Ga0501047_1178158 3300049581 Bacteria 580
361 Ga0501070_0000120 3300049586 Bacteria 70354
362 Ga0501070_0223215 3300049586 Bacteria 1545
363 Ga0501070_0335246 3300049586 Bacteria 1229
364 Ga0501070_0397994 3300049586 Bacteria 1114
365 Ga0501071_0291853 3300049587 Bacteria 1235
366 Ga0501072_1156721 3300049588 Bacteria 601
367 Ga0501073_0147285 3300049589 Bacteria 1631
368 Ga0501073_0174913 3300049589 Bacteria 1486
369 Ga0501074_0348097 3300049590 Bacteria 1052
370 Ga0501077_0057651 3300049593 Bacteria 2466
371 Ga0501077_0285554 3300049593 Bacteria 1050
372 Ga0501077_0344893 3300049593 Bacteria 950
373 Ga0501079_0411992 3300049741 Bacteria 1060
374 Ga0501080_0090049 3300049742 Bacteria 2850
375 Ga0501080_0123606 3300049742 Bacteria 2397
376 Ga0501080_0347829 3300049742 Bacteria 1339
377 Ga0501080_0368375 3300049742 Bacteria 1296
378 Ga0501081_0144013 3300049743 Bacteria 1709
379 Ga0501083_0392635 3300049744 Bacteria 903
380 Ga0501044_0336778 3300049823 Bacteria 1430
381 Ga0501045_0005513 3300049824 Bacteria 8755
382 Ga0501045_0129555 3300049824 Bacteria 1875
383 Ga0501045_0281321 3300049824 Bacteria 1238
384 Ga0501045_0490419 3300049824 Bacteria 912
385 nmdc:mga0yw44_317582_c1 3300050492 Bacteria 1045
386 nmdc:mga0qj67_1237608_c1 3300050509 Bacteria 580
387 nmdc:mga0qj67_136854_c1 3300050509 Bacteria 1985
388 nmdc:mga0qj67_212780_c1 3300050509 Bacteria 1570
389 nmdc:mga0qj67_488068_c1 3300050509 Bacteria 991
390 nmdc:mga0qj67_58776_c1 3300050509 Unclassified 3049
391 nmdc:mga0rr50_194637_c1 3300050513 Bacteria 1663
392 nmdc:mga0rr50_598708_c1 3300050513 Unclassified 940
393 Ga0495595_0056282 3300053084 Bacteria 1832
394 Ga0501082_0739243 3300060353 Bacteria 861
395 Ga0501082_0813289 3300060353 Bacteria 817
396 Ga0530510_0076402 3300061734 Bacteria 2433
397 Ga0530510_1397752 3300061734 Bacteria 537
398 Ga0105249_12663009
399 JGI24743J22301_10072450
400 Ga0070658_10367496
401 Ga0070676_10554769
402 Ga0070683_100001307
403 Ga0070683_100724933
404 Ga0070690_100573821
405 Ga0068869_100396610
406 Ga0070682_100022436
407 Ga0068868_100411082
408 Ga0068868_100413106
409 Ga0068868_100568683
410 Ga0070660_100116651
411 Ga0070689_100149530
412 Ga0070691_10022061
413 Ga0070692_10322903
414 Ga0070692_10810245
415 Ga0070675_100117008
416 Ga0070675_100719532
417 Ga0070671_100176502
418 Ga0070671_101518647
419 Ga0070674_100276584
420 Ga0070659_100330347
421 Ga0070703_10011732
422 Ga0070703_10075418
423 Ga0070714_100252521
424 Ga0070711_100048928
425 Ga0070700_100007905
426 Ga0070694_100750399
427 Ga0070708_100108348
428 Ga0070708_100216165
429 Ga0070708_100258952
430 Ga0070708_100288637
431 Ga0070708_100299689
432 Ga0070708_100477413
433 Ga0070663_100280884
434 Ga0070678_100001858
435 Ga0070678_100972810
436 Ga0070662_100034182
437 Ga0070662_100138136
438 Ga0070681_10007045
439 Ga0070685_10839652
440 Ga0070706_100009131
441 Ga0070706_100016191
442 Ga0070706_100018956
443 Ga0070706_100092139
444 Ga0070706_100241943
445 Ga0070706_100582249
446 Ga0070706_100771249
447 Ga0070707_100001228
448 Ga0070707_100057943
449 Ga0070707_100125836
450 Ga0070707_100354927
451 Ga0070707_100526123
452 Ga0070707_100614506
453 Ga0070698_100000207
454 Ga0070698_100014754
455 Ga0070698_100040531
456 Ga0070698_100052646
457 Ga0070698_100068515
458 Ga0070698_100080985
459 Ga0070698_100136305
460 Ga0070698_100232342
461 Ga0070698_100379832
462 Ga0070698_100385178
463 Ga0070699_100000290
464 Ga0070699_100021191
465 Ga0070699_100299950
466 Ga0070699_100683363
467 Ga0070699_101067348
468 Ga0070679_100039716
469 Ga0070679_100450998
470 Ga0070684_100001050
471 Ga0070684_100006945
472 Ga0070697_100000817
473 Ga0070697_100001383
474 Ga0070697_100007634
475 Ga0070697_100197202
476 Ga0070697_100328812
477 Ga0070697_100438720
478 Ga0070697_101834192
479 Ga0068853_100095294
480 Ga0070672_100709997
481 Ga0070686_100148075
482 Ga0070693_100058991
483 Ga0070704_100061597
484 Ga0068855_100700133
485 Ga0070664_100006775
486 Ga0070664_100568091
487 Ga0068857_101482245
488 Ga0068854_100310009
489 Ga0068856_100008275
490 Ga0068856_100072024
491 Ga0068856_100196885
492 Ga0070702_100112745
493 Ga0068852_100065473
494 Ga0068861_101606659
495 Ga0068851_10219270
496 Ga0081455_10389544
497 Ga0081538_10019008
498 Ga0081540_1000964
499 Ga0070717_10029099
500 Ga0070717_10345367
501 Ga0075368_10378517
502 Ga0070716_100063833
503 Ga0070712_100140289
504 Ga0068871_100481840
505 Ga0075430_100076093
506 Ga0075431_100682684
507 Ga0075436_100065987
508 Ga0075435_100634176
509 Ga0099795_10429651
510 Ga0105240_11338866
511 Ga0111539_10165064
512 Ga0105245_10007679
513 Ga0105245_10023189
514 Ga0105245_10115428
515 Ga0105245_11321851
516 Ga0114129_10422344
517 Ga0105243_10068331
518 Ga0105243_11630400
519 Ga0105241_10027423
520 Ga0105238_10909305
521 Ga0105249_10180969
522 Ga0105249_10433664
523 Ga0105239_10009918
524 Ga0105246_10017549
525 Ga0105246_10036622
526 Ga0157313_1040715
527 Ga0157324_1000389
528 Ga0157373_10608227
529 Ga0157371_10287450
530 Ga0157370_11606702
531 Ga0157374_10026347
532 Ga0157374_10132325
533 Ga0157374_11214933
534 Ga0157372_10051981
535 Ga0157375_10180505
536 Ga0157375_10290828
537 Ga0157375_12437953
538 Ga0163163_10517289
539 Ga0163163_11224408
540 Ga0157377_10001337
541 Ga0157377_10169672
542 Ga0157377_10360348
543 Ga0157379_11253192
544 Ga0157376_10430583
545 Ga0157376_11093939
546 Ga0207653_10327512
547 Ga0207688_10002411
548 Ga0207647_10301390
549 Ga0207645_10562118
550 Ga0207643_10147049
551 Ga0207684_10000183
552 Ga0207684_10000299
553 Ga0207684_10003065
554 Ga0207684_10007131
555 Ga0207684_10077211
556 Ga0207684_10123223
557 Ga0207684_10243533
558 Ga0207684_10543888
559 Ga0207654_10041754
560 Ga0207707_10005974
561 Ga0207693_10137803
562 Ga0207663_10046017
563 Ga0207660_10878429
564 Ga0207657_10027869
565 Ga0207652_10030647
566 Ga0207652_11006042
567 Ga0207646_10000043
568 Ga0207646_10000944
569 Ga0207646_10001502
570 Ga0207646_10002794
571 Ga0207646_10010160
572 Ga0207646_10011110
573 Ga0207646_10013103
574 Ga0207646_10085573
575 Ga0207646_10408981
576 Ga0207646_10559615
577 Ga0207646_11568478
578 Ga0207694_10788203
579 Ga0207659_10523959
580 Ga0207659_10611197
581 Ga0207659_11018393
582 Ga0207687_10015123
583 Ga0207687_10143532
584 Ga0207687_10330788
585 Ga0207664_11116625
586 Ga0207644_10286461
587 Ga0207690_10414445
588 Ga0207690_10625461
589 Ga0207706_10026999
590 Ga0207706_10037182
591 Ga0207706_10461237
592 Ga0207709_10131327
593 Ga0207709_10934283
594 Ga0207670_10184188
595 Ga0207669_10216903
596 Ga0207704_10371818
597 Ga0207665_10043391
598 Ga0207691_11196014
599 Ga0207689_10225636
600 Ga0207661_10001095
601 Ga0207661_10175424
602 Ga0207661_10440916
603 Ga0207679_10123485
604 Ga0207679_10526534
605 Ga0207667_10731466
606 Ga0207651_10541890
607 Ga0207712_10778509
608 Ga0207640_10033139
609 Ga0207640_10990049
610 Ga0207658_10442247
611 Ga0207658_10531321
612 Ga0207677_10076474
613 Ga0207677_10232025
614 Ga0207639_10086371
615 Ga0207678_10072287
616 Ga0207678_10154205
617 Ga0207708_10014519
618 Ga0207708_10201117
619 Ga0207708_10337788
620 Ga0207702_10014027
621 Ga0207702_10149195
622 Ga0207648_10283744
623 Ga0207648_11181854
624 Ga0207674_10182502
625 Ga0207674_11754724
626 Ga0207675_100508105
627 Ga0207683_10001941
628 Ga0209968_1040877
629 Ga0209588_1230723
630 Ga0268266_10285508
631 Ga0307515_10165393
632 Ga0265762_1100444
633 Ga0265327_10013040
634 Ga0307513_10432361
635 Ga0307408_101168403
636 Ga0307405_10014510
637 Ga0307413_10215783
638 Ga0307410_10413468
639 Ga0307406_10010851
640 Ga0307407_10680960
641 Ga0307412_10250618
642 Ga0307409_100055981
643 Ga0307416_100054297
644 Ga0307416_100195003
645 Ga0307414_10129022
646 Ga0307411_10074457
647 Ga0307411_10665125
648 Ga0307415_100120756
649 Ga0373928_0214746
650 Ga0373935_0683607
651 Ga0395899_0093078
652 Ga0395900_0046761
653 Ga0395900_0209461
654 Ga0395900_1527229
655 Ga0395898_0698764
656 Ga0395905_0023630
657 Ga0395901_0036836
658 Ga0451789_0198688
659 Ga0451793_0064195
660 Ga0451802_0710051
661 Ga0451802_1701409
662 Ga0451804_0004695
663 Ga0451807_0958355
664 Ga0451835_1169728
665 Ga0451839_0045805
666 Ga0451847_0078978
667 Ga0451849_1294748
668 Ga0451851_0088561
669 Ga0451855_1295135
670 Ga0451853_1013068
671 Ga0439454_002137
672 Ga0466972_0259323
673 Ga0453683_0183608
674 Ga0466960_0496398
675 Ga0466959_0422172
676 Ga0466967_0162198
677 Ga0466967_0194146
678 Ga0466967_0449090
679 Ga0466967_0515901
680 Ga0466967_0726767
681 Ga0466967_1165875
682 Ga0495592_0080724
683 Ga0495651_0117141
684 Ga0495582_0407683
685 Ga0495594_0357460
686 Ga0495594_0491609
687 Ga0495596_0300787
688 Ga0495608_0150009
689 Ga0495618_0027277
690 Ga0495628_0236880
691 Ga0495631_0213278
692 Ga0495644_0120452
693 Ga0495621_0266414
694 Ga0495656_0302139
695 Ga0495635_0442648
696 Ga0495588_0543281
697 Ga0495588_0599106
698 Ga0495613_0127293
699 Ga0495589_0413081
700 Ga0495674_0688564
701 Ga0495680_0258747
702 Ga0496100_0001389
703 Ga0496100_0237635
704 Ga0496101_0047052
705 Ga0496101_0083811
706 Ga0496102_0000860
707 Ga0496102_0002348
708 Ga0496102_0005761
709 Ga0496103_0004127
710 Ga0496103_0051493
711 Ga0496104_0074765
712 Ga0496104_0168406
713 Ga0496105_0006947
714 Ga0496105_0009864
715 Ga0496105_0119673
716 Ga0496105_0203794
717 Ga0496106_0000412
718 Ga0496106_0016702
719 Ga0496107_0049460
720 Ga0496108_0204957
721 Ga0496108_0294064
722 Ga0496108_1219922
723 Ga0496108_1745079
724 Ga0496109_0032795
725 Ga0496109_0044731
726 Ga0496109_0174588
727 Ga0496109_0385870
728 Ga0496110_0001732
729 Ga0496110_0280701
730 Ga0496110_0421105
731 Ga0496111_0082505
732 Ga0496111_0095678
733 Ga0496111_0351806
734 Ga0496112_0097291
735 Ga0496112_0667534
736 Ga0496113_0338047
737 Ga0496114_0000706
738 Ga0496114_0092970
739 Ga0496114_0233529
740 Ga0496114_0984206
741 Ga0496115_0220189
742 Ga0501031_0594000
743 Ga0501033_0592337
744 Ga0501034_0009028
745 Ga0501034_0150931
746 Ga0501034_0606898
747 Ga0501036_0658491
748 Ga0501038_0081458
749 Ga0501038_0363560
750 Ga0501039_0814381
751 Ga0501040_0028387
752 Ga0501040_0248545
753 Ga0501041_0184430
754 Ga0501041_0892029
755 Ga0501043_0475116
756 Ga0501043_0497701
757 Ga0501047_1178158
758 Ga0501070_0000120
759 Ga0501070_0223215
760 Ga0501070_0335246
761 Ga0501070_0397994
762 Ga0501071_0291853
763 Ga0501072_1156721
764 Ga0501073_0147285
765 Ga0501073_0174913
766 Ga0501074_0348097
767 Ga0501077_0057651
768 Ga0501077_0285554
769 Ga0501077_0344893
770 Ga0501079_0411992
771 Ga0501080_0090049
772 Ga0501080_0123606
773 Ga0501080_0347829
774 Ga0501080_0368375
775 Ga0501081_0144013
776 Ga0501083_0392635
777 Ga0501044_0336778
778 Ga0501045_0005513
779 Ga0501045_0129555
780 Ga0501045_0281321
781 Ga0501045_0490419
782 nmdc:mga0yw44_317582_c1
783 nmdc:mga0qj67_1237608_c1
784 nmdc:mga0qj67_136854_c1
785 nmdc:mga0qj67_212780_c1
786 nmdc:mga0qj67_488068_c1
787 nmdc:mga0qj67_58776_c1
788 nmdc:mga0rr50_194637_c1
789 nmdc:mga0rr50_598708_c1
790 Ga0495595_0056282
791 Ga0501082_0739243
792 Ga0501082_0813289
793 Ga0530510_0076402
794 Ga0530510_1397752

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

21

138

0.87

PF18029

Glyoxalase_6

Glyoxalase-like domain

24

139

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rhe-assembly1.cif.gz_A the crystal structure of nad-dependent benzaldehyde dehydrogenase from legionella pneumophila 0.8376 7 124
1kmz-assembly1.cif.gz_A molecular basis of mitomycin c resictance in streptomyces: crystal structures of the mrd protein with and without a drug derivative 0.8094 4 124
3rhe-assembly1.cif.gz_A the crystal structure of nad-dependent benzaldehyde dehydrogenase from legionella pneumophila 0.8052 7 124
1kmz-assembly1.cif.gz_A molecular basis of mitomycin c resictance in streptomyces: crystal structures of the mrd protein with and without a drug derivative 0.7811 4 124
4rt5-assembly1.cif.gz_B the crystal structure of a glyoxalase/bleomycin resistance protein/dioxygenase protein from planctomyces limnophilus dsm 3776 0.7624 5 124
ID Description Score Start End Superfamily
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9214 71 124 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8422 71 124 3.30.720.110
3rheA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8187 7 124 3.10.180.10
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8121 71 122 3.30.720.110
3sk1C01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7969 1 51 3.30.720.120
ID Description Score Start End GO Terms
AF-A0A7W0G7P7-F1-model_v4 VOC family protein 0.9993 74 139
AF-A0A537NX92-F1-model_v4 VOC family protein 0.9988 75 126
AF-A0A527VME6-F1-model_v4 VOC family protein 0.9966 71 126
AF-A0A6L7X5H9-F1-model_v4 VOC family protein 0.9938 73 126
AF-N9MQE2-F1-model_v4 VOC domain-containing protein 0.9922 71 126

Map