F433724

General Info

Members Datasets Scaffolds Average Seq Length
397 201 794 356

Family's Representative Sequence

Representative Sequence 3300005719|Ga0068861_100031890|Ga0068861_1000318903
Length 400
Sequence MAEQPGDRRADAGAKAGPRTLRRRQTSVDSTVTVTRASRGGSTASVVRMQNRPVEVSLDVNPASRLDVIDIGQAVKDEHGDTLQPFPRALYCSFHTTAGYLDQSLATRLQQEGEPGVEPQTIFPEGAGYEHDKLELRTELSEEQKRNEPQNADSHLAFIGAGLRNCVTYVNRPDEPVYFVDLDGVNEGQPRHRQTTVVGFNHEEEVVRERLVIPVSAHPIDSVNLKDPRLGLYEQIQALTDKYDVAKGRVVIELAPGERHAGLTVNEYETLLMRHDLAEVLREPLRFMREKASHLFARPGAIANRSLDYAKYDMVRVFNQLFDHFAMNESMVERLAARVLAVPASRFLRMKRSVSLLVSDRETEGRGRPVQGTYQSPILVQWAKAQPQQREVDVILTRFR

Samples

Sample ID Description Type Environment
1 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
117 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
118 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
119 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
120 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
121 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
122 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
130 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
131 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
132 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
133 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
134 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
135 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
136 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
137 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
138 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
139 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
140 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
141 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
142 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
143 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
146 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
152 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
153 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
160 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
161 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
162 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
163 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
164 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
165 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
166 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
167 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
168 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
169 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
170 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
171 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
172 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
174 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
175 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
176 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
177 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
178 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
179 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
182 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
183 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
187 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
188 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
189 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
190 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
191 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
192 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
193 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
194 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
195 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
196 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
197 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
198 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
199 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
200 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
201 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.32
Nodule 0
Rhizoplane 3.78
Rhizosphere 86.9
Stem 0
Stem Tuber 0
Unclassified 20.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068861_100031890 3300005719 Bacteria 3876
2 Ga0065712_10018982 3300005290 Bacteria 2233
3 Ga0065712_10068004 3300005290 Bacteria 17424
4 Ga0065715_10008569 3300005293 Unclassified 2463
5 Ga0070683_100026825 3300005329 Bacteria 5191
6 Ga0070690_100187426 3300005330 Bacteria 1432
7 Ga0070670_100022840 3300005331 Bacteria 5383
8 Ga0070670_100027840 3300005331 Bacteria 4863
9 Ga0070670_100032287 3300005331 Bacteria 4509
10 Ga0070670_100070518 3300005331 Bacteria 3000
11 Ga0070670_100095766 3300005331 Unclassified 2553
12 Ga0070677_10002192 3300005333 Bacteria 6243
13 Ga0070677_10105006 3300005333 Bacteria 1252
14 Ga0068869_100052831 3300005334 Bacteria 2952
15 Ga0070666_10168207 3300005335 Bacteria 1534
16 Ga0070666_10267700 3300005335 Bacteria 1212
17 Ga0068868_100119046 3300005338 Bacteria 2153
18 Ga0070687_100043971 3300005343 Bacteria 2273
19 Ga0070692_10013455 3300005345 Bacteria 3815
20 Ga0070669_100000637 3300005353 Bacteria 25990
21 Ga0070669_100065719 3300005353 Bacteria 2672
22 Ga0070675_100032911 3300005354 Bacteria 4199
23 Ga0070675_100070483 3300005354 Unclassified 2897
24 Ga0070675_100219108 3300005354 Bacteria 1657
25 Ga0070671_100002314 3300005355 Bacteria 14710
26 Ga0070671_100028469 3300005355 Bacteria 4600
27 Ga0070674_100001755 3300005356 Bacteria 11764
28 Ga0070674_100012042 3300005356 Bacteria 5297
29 Ga0070673_100041802 3300005364 Bacteria 3529
30 Ga0070673_100054910 3300005364 Bacteria 3136
31 Ga0070673_100195567 3300005364 Bacteria 1739
32 Ga0070688_100049763 3300005365 Bacteria 2609
33 Ga0070701_10043123 3300005438 Bacteria 2306
34 Ga0070705_100120752 3300005440 Bacteria 1692
35 Ga0070700_100020638 3300005441 Bacteria 3820
36 Ga0070694_100030915 3300005444 Bacteria 3508
37 Ga0070708_100037152 3300005445 Bacteria 4247
38 Ga0070663_100031390 3300005455 Bacteria 3651
39 Ga0070663_100077066 3300005455 Bacteria 2440
40 Ga0070663_100230847 3300005455 Bacteria 1457
41 Ga0070678_100064351 3300005456 Bacteria 2718
42 Ga0070678_100067049 3300005456 Bacteria 2670
43 Ga0070678_100221406 3300005456 Archaea 1573
44 Ga0070678_100320239 3300005456 Unclassified 1324
45 Ga0070662_100019155 3300005457 Unclassified 4642
46 Ga0070662_100037937 3300005457 Unclassified 3419
47 Ga0068867_100009767 3300005459 Bacteria 6761
48 Ga0068867_100236367 3300005459 Bacteria 1480
49 Ga0070698_100027403 3300005471 Bacteria 5926
50 Ga0070698_100403060 3300005471 Bacteria 1301
51 Ga0070699_100018138 3300005518 Bacteria 6046
52 Ga0070684_100000998 3300005535 Bacteria 20154
53 Ga0070697_100348944 3300005536 Unclassified 1278
54 Ga0070672_100081059 3300005543 Bacteria 2601
55 Ga0070672_100182877 3300005543 Unclassified 1747
56 Ga0070672_100203472 3300005543 Bacteria 1656
57 Ga0070695_100009980 3300005545 Bacteria 5662
58 Ga0070693_100067369 3300005547 Unclassified 2098
59 Ga0070665_100050396 3300005548 Bacteria 4177
60 Ga0070704_100031226 3300005549 Unclassified 3581
61 Ga0070704_100068604 3300005549 Bacteria 2566
62 Ga0070664_100009801 3300005564 Bacteria 7763
63 Ga0070664_100037675 3300005564 Bacteria 4066
64 Ga0070664_100147771 3300005564 Unclassified 2074
65 Ga0068857_100046443 3300005577 Bacteria 3854
66 Ga0068854_100028950 3300005578 Bacteria 3831
67 Ga0068859_100341473 3300005617 Unclassified 1592
68 Ga0068864_100057934 3300005618 Bacteria 3347
69 Ga0068864_100118460 3300005618 Bacteria 2364
70 Ga0068866_10041819 3300005718 Bacteria 2276
71 Ga0068861_100010566 3300005719 Bacteria 6410
72 Ga0068861_100051762 3300005719 Unclassified 3119
73 Ga0068861_100100248 3300005719 Unclassified 2302
74 Ga0068863_100462409 3300005841 Bacteria 1246
75 Ga0068860_100068365 3300005843 Bacteria 3375
76 Ga0068862_100072196 3300005844 Bacteria 2981
77 Ga0068862_100319119 3300005844 Bacteria 1433
78 Ga0075365_10006577 3300006038 Bacteria 6411
79 Ga0075368_10056566 3300006042 Bacteria 1565
80 Ga0075363_100030805 3300006048 Bacteria 2779
81 Ga0075364_10014482 3300006051 Unclassified 4874
82 Ga0075364_10091511 3300006051 Bacteria 2018
83 Ga0075367_10005489 3300006178 Bacteria 6305
84 Ga0075367_10023044 3300006178 Bacteria 3500
85 Ga0075367_10136550 3300006178 Unclassified 1517
86 Ga0075366_10001321 3300006195 Bacteria 12373
87 Ga0075366_10005980 3300006195 Bacteria 6626
88 Ga0075366_10032486 3300006195 Unclassified 3072
89 Ga0075366_10126167 3300006195 Unclassified 1543
90 Ga0075370_10006716 3300006353 Bacteria 5804
91 Ga0075428_100000143 3300006844 Bacteria 64121
92 Ga0075428_100001079 3300006844 Bacteria 28987
93 Ga0075428_100004332 3300006844 Bacteria 15651
94 Ga0075428_100004557 3300006844 Bacteria 15327
95 Ga0075428_100009288 3300006844 Bacteria 10901
96 Ga0075428_100080359 3300006844 Bacteria 3558
97 Ga0075430_100001864 3300006846 Bacteria 17240
98 Ga0075430_100002006 3300006846 Bacteria 16763
99 Ga0075430_100002493 3300006846 Bacteria 15342
100 Ga0075430_100007560 3300006846 Bacteria 9177
101 Ga0075430_100009046 3300006846 Bacteria 8418
102 Ga0075431_100000711 3300006847 Bacteria 28704
103 Ga0075431_100002417 3300006847 Bacteria 17965
104 Ga0075431_100010151 3300006847 Bacteria 9467
105 Ga0075431_100020050 3300006847 Bacteria 6828
106 Ga0075431_100030980 3300006847 Bacteria 5509
107 Ga0075431_100060865 3300006847 Bacteria 3896
108 Ga0075431_100071242 3300006847 Bacteria 3587
109 Ga0075431_100151125 3300006847 Unclassified 2391
110 Ga0075431_100202043 3300006847 Unclassified 2033
111 Ga0075433_10006905 3300006852 Bacteria 8996
112 Ga0075433_10009224 3300006852 Bacteria 7886
113 Ga0075433_10069888 3300006852 Bacteria 3085
114 Ga0075434_100001383 3300006871 Bacteria 20371
115 Ga0075429_100000029 3300006880 Bacteria 65769
116 Ga0075429_100001199 3300006880 Bacteria 20997
117 Ga0075429_100021010 3300006880 Bacteria 5664
118 Ga0075429_100317367 3300006880 Unclassified 1364
119 Ga0075436_100018315 3300006914 Bacteria 4795
120 Ga0097620_100341474 3300006931 Unclassified 1592
121 Ga0075435_100024234 3300007076 Bacteria 4706
122 Ga0075435_100227093 3300007076 Bacteria 1586
123 Ga0105240_10085739 3300009093 Bacteria 3858
124 Ga0111539_10000876 3300009094 Bacteria 39324
125 Ga0111539_10005229 3300009094 Bacteria 16810
126 Ga0111539_10024860 3300009094 Bacteria 7345
127 Ga0111539_10181893 3300009094 Bacteria 2455
128 Ga0114129_10000133 3300009147 Bacteria 76429
129 Ga0114129_10000895 3300009147 Bacteria 38835
130 Ga0114129_10003277 3300009147 Bacteria 22723
131 Ga0114129_10006336 3300009147 Bacteria 16780
132 Ga0114129_10006679 3300009147 Bacteria 16386
133 Ga0114129_10009323 3300009147 Bacteria 14005
134 Ga0114129_10012128 3300009147 Bacteria 12269
135 Ga0114129_10012404 3300009147 Bacteria 12131
136 Ga0114129_10209920 3300009147 Unclassified 2633
137 Ga0114129_10309522 3300009147 Unclassified 2103
138 Ga0114129_10467964 3300009147 Unclassified 1651
139 Ga0105243_10031578 3300009148 Bacteria 4084
140 Ga0105241_10026467 3300009174 Bacteria 4316
141 Ga0105242_10004186 3300009176 Bacteria 11245
142 Ga0105248_10103554 3300009177 Bacteria 3208
143 Ga0105248_10115857 3300009177 Unclassified 3022
144 Ga0105237_10159433 3300009545 Bacteria 2254
145 Ga0105249_10002058 3300009553 Bacteria 17439
146 Ga0105249_10467438 3300009553 Bacteria 1302
147 Ga0105246_10083564 3300011119 Bacteria 2282
148 Ga0157375_10425522 3300013308 Archaea 1494
149 Ga0163163_10023578 3300014325 Bacteria 5842
150 Ga0163163_10051801 3300014325 Bacteria 4047
151 Ga0163163_10295782 3300014325 Unclassified 1671
152 Ga0157377_10099706 3300014745 Bacteria 1728
153 Ga0157376_10153219 3300014969 Bacteria 2081
154 Ga0157376_10311889 3300014969 Bacteria 1493
155 Ga0207697_10016034 3300025315 Unclassified 3090
156 Ga0207682_10010867 3300025893 Bacteria 3563
157 Ga0207682_10027250 3300025893 Bacteria 2274
158 Ga0207682_10057692 3300025893 Bacteria 1619
159 Ga0207642_10015840 3300025899 Bacteria 2823
160 Ga0207688_10002099 3300025901 Bacteria 10715
161 Ga0207688_10003312 3300025901 Bacteria 8804
162 Ga0207688_10036631 3300025901 Unclassified 2719
163 Ga0207688_10062319 3300025901 Bacteria 2102
164 Ga0207647_10098334 3300025904 Bacteria 1739
165 Ga0207645_10010494 3300025907 Bacteria 6360
166 Ga0207643_10003084 3300025908 Bacteria 8958
167 Ga0207684_10048757 3300025910 Unclassified 3592
168 Ga0207654_10080920 3300025911 Unclassified 1955
169 Ga0207695_10285096 3300025913 Bacteria 1545
170 Ga0207662_10013516 3300025918 Bacteria 4565
171 Ga0207646_10090146 3300025922 Unclassified 2745
172 Ga0207681_10018105 3300025923 Bacteria 4434
173 Ga0207681_10050428 3300025923 Bacteria 2816
174 Ga0207650_10003638 3300025925 Bacteria 10560
175 Ga0207650_10078997 3300025925 Unclassified 2491
176 Ga0207650_10084712 3300025925 Bacteria 2410
177 Ga0207659_10096029 3300025926 Bacteria 2224
178 Ga0207644_10093373 3300025931 Bacteria 2246
179 Ga0207706_10017194 3300025933 Bacteria 6518
180 Ga0207706_10074360 3300025933 Bacteria 2988
181 Ga0207669_10040021 3300025937 Bacteria 2715
182 Ga0207669_10191184 3300025937 Bacteria 1477
183 Ga0207704_10046302 3300025938 Bacteria 2591
184 Ga0207691_10002157 3300025940 Bacteria 19248
185 Ga0207691_10005905 3300025940 Bacteria 11827
186 Ga0207691_10014535 3300025940 Bacteria 7509
187 Ga0207691_10082626 3300025940 Bacteria 2885
188 Ga0207711_10060095 3300025941 Bacteria 3274
189 Ga0207689_10049627 3300025942 Bacteria 3462
190 Ga0207689_10061450 3300025942 Unclassified 3089
191 Ga0207689_10103521 3300025942 Unclassified 2339
192 Ga0207661_10264703 3300025944 Bacteria 1532
193 Ga0207679_10011986 3300025945 Bacteria 5635
194 Ga0207679_10092456 3300025945 Bacteria 2344
195 Ga0207679_10124988 3300025945 Bacteria 2054
196 Ga0207651_10011835 3300025960 Bacteria 4901
197 Ga0207651_10321777 3300025960 Bacteria 1293
198 Ga0207712_10007391 3300025961 Bacteria 6936
199 Ga0207703_10178766 3300026035 Bacteria 1871
200 Ga0207678_10022358 3300026067 Bacteria 5540
201 Ga0207678_10024824 3300026067 Bacteria 5233
202 Ga0207678_10236558 3300026067 Bacteria 1564
203 Ga0207708_10002573 3300026075 Bacteria 13351
204 Ga0207708_10183386 3300026075 Bacteria 1662
205 Ga0207708_10266265 3300026075 Unclassified 1384
206 Ga0207641_10027410 3300026088 Bacteria 4705
207 Ga0207648_10001437 3300026089 Bacteria 26214
208 Ga0207676_10036033 3300026095 Bacteria 3761
209 Ga0207674_10147461 3300026116 Bacteria 2311
210 Ga0207675_100002677 3300026118 Bacteria 17572
211 Ga0207675_100009198 3300026118 Bacteria 9267
212 Ga0207675_100020700 3300026118 Bacteria 6132
213 Ga0207675_100242515 3300026118 Bacteria 1742
214 Ga0207683_10046303 3300026121 Unclassified 3806
215 Ga0207683_10335020 3300026121 Unclassified 1387
216 Ga0207683_10345291 3300026121 Bacteria 1365
217 Ga0207698_10498891 3300026142 Bacteria 1184
218 Ga0209971_1020757 3300027682 Bacteria 1563
219 Ga0207428_10004308 3300027907 Bacteria 13588
220 Ga0207428_10011114 3300027907 Bacteria 7994
221 Ga0207428_10123103 3300027907 Bacteria 1987
222 Ga0268266_10271441 3300028379 Bacteria 1574
223 Ga0268265_10019083 3300028380 Bacteria 4760
224 Ga0268265_10137876 3300028380 Unclassified 2038
225 Ga0268265_10174635 3300028380 Bacteria 1840
226 Ga0268265_10229964 3300028380 Unclassified 1629
227 Ga0268265_10372553 3300028380 Bacteria 1311
228 Ga0307408_100007411 3300031548 Bacteria 7255
229 Ga0307408_100037074 3300031548 Bacteria 3432
230 Ga0307408_100046598 3300031548 Bacteria 3101
231 Ga0307408_100277267 3300031548 Bacteria 1395
232 Ga0316578_10130675 3300031728 Bacteria 1511
233 Ga0307405_10055958 3300031731 Bacteria 2471
234 Ga0307405_10092525 3300031731 Unclassified 2006
235 Ga0307413_10055475 3300031824 Bacteria 2411
236 Ga0307413_10094378 3300031824 Bacteria 1958
237 Ga0307410_10037116 3300031852 Unclassified 3180
238 Ga0307406_10136119 3300031901 Unclassified 1731
239 Ga0307407_10013290 3300031903 Bacteria 3990
240 Ga0307407_10016724 3300031903 Bacteria 3659
241 Ga0307407_10113174 3300031903 Unclassified 1707
242 Ga0307412_10010056 3300031911 Bacteria 5441
243 Ga0307412_10058189 3300031911 Bacteria 2584
244 Ga0307412_10208498 3300031911 Unclassified 1489
245 Ga0307409_100009832 3300031995 Bacteria 5901
246 Ga0307409_100178440 3300031995 Bacteria 1877
247 Ga0307409_100345784 3300031995 Bacteria 1401
248 Ga0307416_100008390 3300032002 Bacteria 6662
249 Ga0307416_100076436 3300032002 Bacteria 2806
250 Ga0307416_100314609 3300032002 Bacteria 1564
251 Ga0307416_100513028 3300032002 Bacteria 1265
252 Ga0307414_10053699 3300032004 Unclassified 2812
253 Ga0307411_10000360 3300032005 Bacteria 15443
254 Ga0307411_10116009 3300032005 Bacteria 1927
255 Ga0307415_100034172 3300032126 Bacteria 3307
256 Ga0307415_100162022 3300032126 Bacteria 1735
257 Ga0373942_0009094 3300035207 Bacteria 2321
258 Ga0373947_0061755 3300035725 Unclassified 2278
259 Ga0316584_0128256 3300036712 Bacteria 1895
260 Ga0451802_0000773 3300041460 Bacteria 1215
261 Ga0451807_1862955 3300041486 Bacteria 1286
262 Ga0439449_0027622 3300042007 Bacteria 2118
263 Ga0439446_0004337 3300042156 Unclassified 3593
264 Ga0450908_002202 3300042184 Bacteria 3825
265 Ga0439435_0011830 3300042436 Bacteria 2100
266 Ga0439464_0003604 3300042439 Bacteria 3923
267 Ga0451577_0073813 3300042876 Bacteria 3043
268 Ga0451577_0130462 3300042876 Bacteria 2254
269 Ga0453684_0074028 3300044712 Bacteria 4291
270 Ga0451576_0360418 3300045051 Unclassified 1523
271 Ga0451576_0382692 3300045051 Bacteria 1475
272 Ga0495638_0013553 3300046460 Bacteria 5543
273 Ga0495638_0040511 3300046460 Bacteria 2952
274 Ga0496102_0160213 3300048905 Bacteria 2116
275 Ga0496102_0425567 3300048905 Bacteria 1247
276 Ga0496104_0032956 3300048907 Bacteria 4823
277 Ga0496106_0143775 3300048909 Bacteria 1878
278 Ga0496108_0011308 3300048911 Bacteria 7251
279 Ga0496108_0315651 3300048911 Bacteria 1362
280 Ga0496109_0004956 3300048912 Bacteria 11119
281 Ga0496109_0395792 3300048912 Unclassified 1305
282 Ga0496110_0004355 3300048913 Bacteria 10960
283 Ga0496111_0010761 3300048914 Bacteria 6150
284 Ga0496112_0002090 3300048915 Bacteria 15841
285 Ga0496112_0294429 3300048915 Bacteria 1569
286 Ga0496114_0187422 3300048917 Bacteria 1809
287 Ga0501299_004072 3300049522 Unclassified 2161
288 Ga0501036_0269927 3300049572 Bacteria 1424
289 Ga0501039_0146417 3300049575 Bacteria 1856
290 Ga0501040_0133590 3300049576 Bacteria 1746
291 Ga0501040_0208816 3300049576 Unclassified 1388
292 Ga0501041_0048446 3300049577 Unclassified 2588
293 Ga0501041_0049361 3300049577 Bacteria 2563
294 Ga0501042_0012865 3300049578 Bacteria 5682
295 Ga0501042_0128899 3300049578 Bacteria 1823
296 Ga0501048_0190262 3300049582 Unclassified 1454
297 Ga0501068_0084371 3300049584 Bacteria 1954
298 Ga0501071_0008608 3300049587 Bacteria 6744
299 Ga0501071_0034716 3300049587 Unclassified 3591
300 Ga0501071_0086656 3300049587 Bacteria 2297
301 Ga0501072_0029694 3300049588 Bacteria 4272
302 Ga0501072_0039587 3300049588 Bacteria 3700
303 Ga0501072_0062959 3300049588 Bacteria 2926
304 Ga0501072_0291447 3300049588 Unclassified 1297
305 Ga0501073_0096860 3300049589 Bacteria 2049
306 Ga0501074_0123886 3300049590 Bacteria 1848
307 Ga0501074_0274754 3300049590 Bacteria 1198
308 Ga0501075_0018124 3300049591 Bacteria 5091
309 Ga0501075_0042178 3300049591 Bacteria 3421
310 Ga0501075_0056685 3300049591 Unclassified 2950
311 Ga0501075_0100356 3300049591 Bacteria 2198
312 Ga0501076_0063625 3300049592 Unclassified 2940
313 Ga0501076_0080522 3300049592 Unclassified 2614
314 Ga0501076_0221774 3300049592 Bacteria 1545
315 Ga0501076_0370389 3300049592 Bacteria 1177
316 Ga0501077_0212561 3300049593 Bacteria 1229
317 Ga0501079_0156597 3300049741 Bacteria 1776
318 Ga0501080_0279080 3300049742 Unclassified 1519
319 Ga0501081_0024394 3300049743 Bacteria 4061
320 Ga0501081_0026608 3300049743 Bacteria 3902
321 Ga0501081_0120622 3300049743 Unclassified 1867
322 Ga0501081_0249316 3300049743 Unclassified 1296
323 Ga0501083_0237100 3300049744 Unclassified 1188
324 Ga0501283_014698 3300049779 Bacteria 1199
325 Ga0501035_0168194 3300049822 Unclassified 1895
326 Ga0501045_0009208 3300049824 Bacteria 6901
327 Ga0501045_0047535 3300049824 Unclassified 3126
328 Ga0501045_0156337 3300049824 Unclassified 1696
329 nmdc:mga03n38_18672_c1 3300050490 Unclassified 2741
330 nmdc:mga00v17_26613_c1 3300050491 Bacteria 3373
331 nmdc:mga0yw44_11451_c1 3300050492 Bacteria 4580
332 nmdc:mga0yw44_48363_c1 3300050492 Bacteria 2564
333 nmdc:mga0k408_10248_c1 3300050493 Bacteria 5067
334 nmdc:mga0k408_10911_c1 3300050493 Bacteria 4928
335 nmdc:mga0k408_167224_c1 3300050493 Unclassified 1311
336 nmdc:mga0k408_23878_c1 3300050493 Unclassified 2466
337 nmdc:mga0k408_49642_c1 3300050493 Bacteria 2429
338 nmdc:mga0k408_95445_c1 3300050493 Bacteria 1750
339 nmdc:mga06z11_28737_c1 3300050494 Unclassified 2671
340 nmdc:mga06z11_3973_c1 3300050494 Bacteria 4513
341 nmdc:mga06z11_49034_c1 3300050494 Bacteria 2152
342 nmdc:mga06z11_5065_c1 3300050494 Bacteria 5246
343 nmdc:mga06z11_6160_c1 3300050494 Unclassified 4859
344 nmdc:mga07m45_31180_c1 3300050496 Bacteria 2954
345 nmdc:mga07m45_72772_c1 3300050496 Bacteria 1957
346 nmdc:mga05p37_12045_c1 3300050507 Bacteria 10320
347 nmdc:mga05p37_1665_c1 3300050507 Bacteria 25824
348 nmdc:mga05p37_189684_c1 3300050507 Bacteria 2497
349 nmdc:mga05p37_276687_c1 3300050507 Unclassified 2004
350 nmdc:mga05p37_43516_c1 3300050507 Bacteria 5525
351 nmdc:mga05p37_4355_c1 3300050507 Bacteria 5267
352 nmdc:mga05p37_643431_c1 3300050507 Bacteria 1189
353 nmdc:mga05p37_84807_c2 3300050507 Unclassified 2539
354 nmdc:mga05p37_85_c1 3300050507 Bacteria 83588
355 nmdc:mga09592_3444_c1 3300050508 Bacteria 12779
356 nmdc:mga09592_41_c1 3300050508 Bacteria 71018
357 nmdc:mga09592_604_c1 3300050508 Bacteria 27278
358 nmdc:mga09592_67218_c1 3300050508 Bacteria 3039
359 nmdc:mga0qj67_163_c1 3300050509 Bacteria 44837
360 nmdc:mga0qj67_169123_c1 3300050509 Unclassified 1775
361 nmdc:mga0qj67_17470_c1 3300050509 Bacteria 5454
362 nmdc:mga0qj67_44068_c1 3300050509 Bacteria 3515
363 nmdc:mga0qj67_9631_c1 3300050509 Bacteria 7199
364 nmdc:mga06r32_13043_c1 3300050510 Bacteria 7519
365 nmdc:mga06r32_154189_c1 3300050510 Bacteria 2277
366 nmdc:mga06r32_1797_c1 3300050510 Bacteria 19208
367 nmdc:mga06r32_185850_c1 3300050510 Unclassified 2065
368 nmdc:mga06r32_32979_c1 3300050510 Bacteria 4876
369 nmdc:mga06r32_360_c1 3300050510 Bacteria 38181
370 nmdc:mga06r32_6369_c1 3300050510 Bacteria 10609
371 nmdc:mga08y16_15538_c1 3300050511 Bacteria 8006
372 nmdc:mga08y16_15972_c1 3300050511 Bacteria 7891
373 nmdc:mga08y16_254500_c1 3300050511 Unclassified 1814
374 nmdc:mga08y16_38460_c1 3300050511 Bacteria 5023
375 nmdc:mga0n895_1159_c1 3300050512 Bacteria 19270
376 nmdc:mga0rr50_49532_c1 3300050513 Bacteria 3110
377 nmdc:mga08x19_101219_c1 3300050514 Bacteria 1912
378 nmdc:mga08x19_4365_c1 3300050514 Bacteria 8384
379 nmdc:mga0a205_307_c3 3300050515 Bacteria 4397
380 nmdc:mga0a205_431158_c1 3300050515 Unclassified 1180
381 nmdc:mga0a205_93267_c1 3300050515 Bacteria 2909
382 Ga0500651_0109249 3300053093 Bacteria 1689
383 Ga0500641_0002768 3300053096 Bacteria 6201
384 Ga0500555_000330 3300053103 Bacteria 20383
385 Ga0500568_0005971 3300053139 Bacteria 6189
386 Ga0500616_0001368 3300053153 Bacteria 23686
387 Ga0500645_000454 3300053730 Bacteria 28118
388 Ga0500599_001129 3300053736 Unclassified 3024
389 Ga0501084_0180989 3300054114 Unclassified 1779
390 Ga0590071_000245 3300059421 Bacteria 15907
391 Ga0590074_000137 3300059423 Bacteria 8694
392 Ga0590074_002283 3300059423 Bacteria 3149
393 Ga0590075_000476 3300059424 Bacteria 10773
394 Ga0590075_000758 3300059424 Bacteria 8551
395 Ga0501082_0093214 3300060353 Unclassified 2602
396 Ga0501082_0105337 3300060353 Unclassified 2440
397 Ga0530510_0062719 3300061734 Bacteria 2690
398 Ga0068861_100031890
399 Ga0065712_10018982
400 Ga0065712_10068004
401 Ga0065715_10008569
402 Ga0070683_100026825
403 Ga0070690_100187426
404 Ga0070670_100022840
405 Ga0070670_100027840
406 Ga0070670_100032287
407 Ga0070670_100070518
408 Ga0070670_100095766
409 Ga0070677_10002192
410 Ga0070677_10105006
411 Ga0068869_100052831
412 Ga0070666_10168207
413 Ga0070666_10267700
414 Ga0068868_100119046
415 Ga0070687_100043971
416 Ga0070692_10013455
417 Ga0070669_100000637
418 Ga0070669_100065719
419 Ga0070675_100032911
420 Ga0070675_100070483
421 Ga0070675_100219108
422 Ga0070671_100002314
423 Ga0070671_100028469
424 Ga0070674_100001755
425 Ga0070674_100012042
426 Ga0070673_100041802
427 Ga0070673_100054910
428 Ga0070673_100195567
429 Ga0070688_100049763
430 Ga0070701_10043123
431 Ga0070705_100120752
432 Ga0070700_100020638
433 Ga0070694_100030915
434 Ga0070708_100037152
435 Ga0070663_100031390
436 Ga0070663_100077066
437 Ga0070663_100230847
438 Ga0070678_100064351
439 Ga0070678_100067049
440 Ga0070678_100221406
441 Ga0070678_100320239
442 Ga0070662_100019155
443 Ga0070662_100037937
444 Ga0068867_100009767
445 Ga0068867_100236367
446 Ga0070698_100027403
447 Ga0070698_100403060
448 Ga0070699_100018138
449 Ga0070684_100000998
450 Ga0070697_100348944
451 Ga0070672_100081059
452 Ga0070672_100182877
453 Ga0070672_100203472
454 Ga0070695_100009980
455 Ga0070693_100067369
456 Ga0070665_100050396
457 Ga0070704_100031226
458 Ga0070704_100068604
459 Ga0070664_100009801
460 Ga0070664_100037675
461 Ga0070664_100147771
462 Ga0068857_100046443
463 Ga0068854_100028950
464 Ga0068859_100341473
465 Ga0068864_100057934
466 Ga0068864_100118460
467 Ga0068866_10041819
468 Ga0068861_100010566
469 Ga0068861_100051762
470 Ga0068861_100100248
471 Ga0068863_100462409
472 Ga0068860_100068365
473 Ga0068862_100072196
474 Ga0068862_100319119
475 Ga0075365_10006577
476 Ga0075368_10056566
477 Ga0075363_100030805
478 Ga0075364_10014482
479 Ga0075364_10091511
480 Ga0075367_10005489
481 Ga0075367_10023044
482 Ga0075367_10136550
483 Ga0075366_10001321
484 Ga0075366_10005980
485 Ga0075366_10032486
486 Ga0075366_10126167
487 Ga0075370_10006716
488 Ga0075428_100000143
489 Ga0075428_100001079
490 Ga0075428_100004332
491 Ga0075428_100004557
492 Ga0075428_100009288
493 Ga0075428_100080359
494 Ga0075430_100001864
495 Ga0075430_100002006
496 Ga0075430_100002493
497 Ga0075430_100007560
498 Ga0075430_100009046
499 Ga0075431_100000711
500 Ga0075431_100002417
501 Ga0075431_100010151
502 Ga0075431_100020050
503 Ga0075431_100030980
504 Ga0075431_100060865
505 Ga0075431_100071242
506 Ga0075431_100151125
507 Ga0075431_100202043
508 Ga0075433_10006905
509 Ga0075433_10009224
510 Ga0075433_10069888
511 Ga0075434_100001383
512 Ga0075429_100000029
513 Ga0075429_100001199
514 Ga0075429_100021010
515 Ga0075429_100317367
516 Ga0075436_100018315
517 Ga0097620_100341474
518 Ga0075435_100024234
519 Ga0075435_100227093
520 Ga0105240_10085739
521 Ga0111539_10000876
522 Ga0111539_10005229
523 Ga0111539_10024860
524 Ga0111539_10181893
525 Ga0114129_10000133
526 Ga0114129_10000895
527 Ga0114129_10003277
528 Ga0114129_10006336
529 Ga0114129_10006679
530 Ga0114129_10009323
531 Ga0114129_10012128
532 Ga0114129_10012404
533 Ga0114129_10209920
534 Ga0114129_10309522
535 Ga0114129_10467964
536 Ga0105243_10031578
537 Ga0105241_10026467
538 Ga0105242_10004186
539 Ga0105248_10103554
540 Ga0105248_10115857
541 Ga0105237_10159433
542 Ga0105249_10002058
543 Ga0105249_10467438
544 Ga0105246_10083564
545 Ga0157375_10425522
546 Ga0163163_10023578
547 Ga0163163_10051801
548 Ga0163163_10295782
549 Ga0157377_10099706
550 Ga0157376_10153219
551 Ga0157376_10311889
552 Ga0207697_10016034
553 Ga0207682_10010867
554 Ga0207682_10027250
555 Ga0207682_10057692
556 Ga0207642_10015840
557 Ga0207688_10002099
558 Ga0207688_10003312
559 Ga0207688_10036631
560 Ga0207688_10062319
561 Ga0207647_10098334
562 Ga0207645_10010494
563 Ga0207643_10003084
564 Ga0207684_10048757
565 Ga0207654_10080920
566 Ga0207695_10285096
567 Ga0207662_10013516
568 Ga0207646_10090146
569 Ga0207681_10018105
570 Ga0207681_10050428
571 Ga0207650_10003638
572 Ga0207650_10078997
573 Ga0207650_10084712
574 Ga0207659_10096029
575 Ga0207644_10093373
576 Ga0207706_10017194
577 Ga0207706_10074360
578 Ga0207669_10040021
579 Ga0207669_10191184
580 Ga0207704_10046302
581 Ga0207691_10002157
582 Ga0207691_10005905
583 Ga0207691_10014535
584 Ga0207691_10082626
585 Ga0207711_10060095
586 Ga0207689_10049627
587 Ga0207689_10061450
588 Ga0207689_10103521
589 Ga0207661_10264703
590 Ga0207679_10011986
591 Ga0207679_10092456
592 Ga0207679_10124988
593 Ga0207651_10011835
594 Ga0207651_10321777
595 Ga0207712_10007391
596 Ga0207703_10178766
597 Ga0207678_10022358
598 Ga0207678_10024824
599 Ga0207678_10236558
600 Ga0207708_10002573
601 Ga0207708_10183386
602 Ga0207708_10266265
603 Ga0207641_10027410
604 Ga0207648_10001437
605 Ga0207676_10036033
606 Ga0207674_10147461
607 Ga0207675_100002677
608 Ga0207675_100009198
609 Ga0207675_100020700
610 Ga0207675_100242515
611 Ga0207683_10046303
612 Ga0207683_10335020
613 Ga0207683_10345291
614 Ga0207698_10498891
615 Ga0209971_1020757
616 Ga0207428_10004308
617 Ga0207428_10011114
618 Ga0207428_10123103
619 Ga0268266_10271441
620 Ga0268265_10019083
621 Ga0268265_10137876
622 Ga0268265_10174635
623 Ga0268265_10229964
624 Ga0268265_10372553
625 Ga0307408_100007411
626 Ga0307408_100037074
627 Ga0307408_100046598
628 Ga0307408_100277267
629 Ga0316578_10130675
630 Ga0307405_10055958
631 Ga0307405_10092525
632 Ga0307413_10055475
633 Ga0307413_10094378
634 Ga0307410_10037116
635 Ga0307406_10136119
636 Ga0307407_10013290
637 Ga0307407_10016724
638 Ga0307407_10113174
639 Ga0307412_10010056
640 Ga0307412_10058189
641 Ga0307412_10208498
642 Ga0307409_100009832
643 Ga0307409_100178440
644 Ga0307409_100345784
645 Ga0307416_100008390
646 Ga0307416_100076436
647 Ga0307416_100314609
648 Ga0307416_100513028
649 Ga0307414_10053699
650 Ga0307411_10000360
651 Ga0307411_10116009
652 Ga0307415_100034172
653 Ga0307415_100162022
654 Ga0373942_0009094
655 Ga0373947_0061755
656 Ga0316584_0128256
657 Ga0451802_0000773
658 Ga0451807_1862955
659 Ga0439449_0027622
660 Ga0439446_0004337
661 Ga0450908_002202
662 Ga0439435_0011830
663 Ga0439464_0003604
664 Ga0451577_0073813
665 Ga0451577_0130462
666 Ga0453684_0074028
667 Ga0451576_0360418
668 Ga0451576_0382692
669 Ga0495638_0013553
670 Ga0495638_0040511
671 Ga0496102_0160213
672 Ga0496102_0425567
673 Ga0496104_0032956
674 Ga0496106_0143775
675 Ga0496108_0011308
676 Ga0496108_0315651
677 Ga0496109_0004956
678 Ga0496109_0395792
679 Ga0496110_0004355
680 Ga0496111_0010761
681 Ga0496112_0002090
682 Ga0496112_0294429
683 Ga0496114_0187422
684 Ga0501299_004072
685 Ga0501036_0269927
686 Ga0501039_0146417
687 Ga0501040_0133590
688 Ga0501040_0208816
689 Ga0501041_0048446
690 Ga0501041_0049361
691 Ga0501042_0012865
692 Ga0501042_0128899
693 Ga0501048_0190262
694 Ga0501068_0084371
695 Ga0501071_0008608
696 Ga0501071_0034716
697 Ga0501071_0086656
698 Ga0501072_0029694
699 Ga0501072_0039587
700 Ga0501072_0062959
701 Ga0501072_0291447
702 Ga0501073_0096860
703 Ga0501074_0123886
704 Ga0501074_0274754
705 Ga0501075_0018124
706 Ga0501075_0042178
707 Ga0501075_0056685
708 Ga0501075_0100356
709 Ga0501076_0063625
710 Ga0501076_0080522
711 Ga0501076_0221774
712 Ga0501076_0370389
713 Ga0501077_0212561
714 Ga0501079_0156597
715 Ga0501080_0279080
716 Ga0501081_0024394
717 Ga0501081_0026608
718 Ga0501081_0120622
719 Ga0501081_0249316
720 Ga0501083_0237100
721 Ga0501283_014698
722 Ga0501035_0168194
723 Ga0501045_0009208
724 Ga0501045_0047535
725 Ga0501045_0156337
726 nmdc:mga03n38_18672_c1
727 nmdc:mga00v17_26613_c1
728 nmdc:mga0yw44_11451_c1
729 nmdc:mga0yw44_48363_c1
730 nmdc:mga0k408_10248_c1
731 nmdc:mga0k408_10911_c1
732 nmdc:mga0k408_167224_c1
733 nmdc:mga0k408_23878_c1
734 nmdc:mga0k408_49642_c1
735 nmdc:mga0k408_95445_c1
736 nmdc:mga06z11_28737_c1
737 nmdc:mga06z11_3973_c1
738 nmdc:mga06z11_49034_c1
739 nmdc:mga06z11_5065_c1
740 nmdc:mga06z11_6160_c1
741 nmdc:mga07m45_31180_c1
742 nmdc:mga07m45_72772_c1
743 nmdc:mga05p37_12045_c1
744 nmdc:mga05p37_1665_c1
745 nmdc:mga05p37_189684_c1
746 nmdc:mga05p37_276687_c1
747 nmdc:mga05p37_43516_c1
748 nmdc:mga05p37_4355_c1
749 nmdc:mga05p37_643431_c1
750 nmdc:mga05p37_84807_c2
751 nmdc:mga05p37_85_c1
752 nmdc:mga09592_3444_c1
753 nmdc:mga09592_41_c1
754 nmdc:mga09592_604_c1
755 nmdc:mga09592_67218_c1
756 nmdc:mga0qj67_163_c1
757 nmdc:mga0qj67_169123_c1
758 nmdc:mga0qj67_17470_c1
759 nmdc:mga0qj67_44068_c1
760 nmdc:mga0qj67_9631_c1
761 nmdc:mga06r32_13043_c1
762 nmdc:mga06r32_154189_c1
763 nmdc:mga06r32_1797_c1
764 nmdc:mga06r32_185850_c1
765 nmdc:mga06r32_32979_c1
766 nmdc:mga06r32_360_c1
767 nmdc:mga06r32_6369_c1
768 nmdc:mga08y16_15538_c1
769 nmdc:mga08y16_15972_c1
770 nmdc:mga08y16_254500_c1
771 nmdc:mga08y16_38460_c1
772 nmdc:mga0n895_1159_c1
773 nmdc:mga0rr50_49532_c1
774 nmdc:mga08x19_101219_c1
775 nmdc:mga08x19_4365_c1
776 nmdc:mga0a205_307_c3
777 nmdc:mga0a205_431158_c1
778 nmdc:mga0a205_93267_c1
779 Ga0500651_0109249
780 Ga0500641_0002768
781 Ga0500555_000330
782 Ga0500568_0005971
783 Ga0500616_0001368
784 Ga0500645_000454
785 Ga0500599_001129
786 Ga0501084_0180989
787 Ga0590071_000245
788 Ga0590074_000137
789 Ga0590074_002283
790 Ga0590075_000476
791 Ga0590075_000758
792 Ga0501082_0093214
793 Ga0501082_0105337
794 Ga0530510_0062719

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2p6h-assembly1.cif.gz_A crystal structure of hypothetical protein ape1520 from aeropyrum pernix k1 0.7708 160 348
1vmf-assembly1.cif.gz_C crystal structure of a ybjq-like fold protein of unknown function (bh3498) from bacillus halodurans at 1.46 a resolution 0.7623 161 348
1vph-assembly2.cif.gz_E crystal structure of a ybjq-like protein of unknown function (sso2532) from sulfolobus solfataricus p2 at 1.76 a resolution 0.7609 155 350
1ve0-assembly1.cif.gz_A crystal structure of uncharacterized protein st2072 from sulfolobus tokodaii 0.7593 157 348
1vph-assembly2.cif.gz_E crystal structure of a ybjq-like protein of unknown function (sso2532) from sulfolobus solfataricus p2 at 1.76 a resolution 0.7509 155 350
ID Description Score Start End Superfamily
af_O14155_1_138_2.60.120.460 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.7723 160 348 2.60.120.460
1vphC00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.7543 154 350 2.60.120.460
af_O14155_1_138_2.60.120.460 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.7422 160 348 2.60.120.460
1vphC00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.7217 154 350 2.60.120.460
2p6hB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.7162 6 155 2.60.120.460
ID Description Score Start End GO Terms
AF-A0A2E9ME02-F1-model_v4 YjbQ family protein 0.9382 4 144
AF-A0A2V8G0Z3-F1-model_v4 Transposase 0.9316 4 221
AF-A0A6B1I7L0-F1-model_v4 Uncharacterized protein 0.9302 1 179
AF-A0A2T2TSP5-F1-model_v4 Uncharacterized protein 0.9262 4 183
AF-A0A2T2UDE2-F1-model_v4 Uncharacterized protein 0.9245 1 229

Map