F433646

General Info

Members Datasets Scaffolds Average Seq Length
396 171 381 151

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221664|2644356055
Length 179
Sequence KAAISAGPASPARGAAPRLAPGLPPSLAPSLARRCLLHAAAALPLLALVRPACATPEELRAAIAAYTGGAVPATGKVTFDIAKLIDNGNAVPVTITVDSPMTAAAHVTGIAIFNERNPETDIARFTLGPRSGKAEVSTRIRLATSQKLVAVARLSDGSYWQQAMDVIVALAACIEGEAP

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
3 2643221645 Massilia sp. Root351 Isolate Unclassified
4 2643221664 Massilia sp. Root418 Isolate Unclassified
5 2738541280 Massilia sp. GV090 Isolate Unclassified
6 2738541297 Duganella sp. GV083 Isolate Unclassified
7 2738541300 Massilia sp. GV016 Isolate Unclassified
8 2738541357 Duganella sp. GV053 Isolate Unclassified
9 2738543003 Duganella sp. GV066 Isolate Unclassified
10 2738543018 Massilia sp. GV045 Isolate Unclassified
11 2738543026 Duganella sp. GV089 Isolate Unclassified
12 2738543029 Duganella sp. GV039 Isolate Unclassified
13 2738543030 Massilia sp. GV097 Isolate Unclassified
14 2821131069 Duganella sp. 1224 Isolate Unclassified
15 2904424332 Duganella sp. 1411 Isolate Rhizosphere
16 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
17 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
18 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
19 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
20 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
21 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
22 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
23 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
24 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
25 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
26 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
27 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
28 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
29 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
30 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
31 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
32 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
33 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
34 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
35 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
36 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
45 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
46 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
51 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
52 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
53 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
54 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
55 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
56 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
57 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
58 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
59 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
62 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
65 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
67 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
70 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
77 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
79 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
80 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
81 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
82 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
83 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
84 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
85 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
86 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
87 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
88 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
89 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
90 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
91 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
92 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
93 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
94 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
95 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
96 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
97 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
98 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
99 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
100 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
101 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
102 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
103 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
104 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
105 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
106 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
107 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
108 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
109 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
110 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
111 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
112 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
113 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
114 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
115 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
116 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
117 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
118 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
119 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
120 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
121 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
122 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
123 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
124 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
125 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
126 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
127 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
128 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
129 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
130 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
131 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
132 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
133 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
134 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
135 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
136 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
137 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
138 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
139 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
140 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
141 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
142 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
143 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
144 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
145 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
146 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
147 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
148 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
149 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
150 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
151 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
152 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
153 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
154 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
155 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
156 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
157 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
158 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
159 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
160 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
162 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
163 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
164 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
165 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
166 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
167 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
168 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
169 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
170 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
171 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.96
Metatranscriptomes 0.25
Isolates 3.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 30.05
Nodule 0.76
Rhizoplane 1.77
Rhizosphere 58.59
Stem 0
Stem Tuber 0
Unclassified 8.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000025 3300002705 Bacteria 136287
2 JGI25154J39366_1000045 3300002738 Bacteria 136302
3 JGI25157J39369_1000034 3300002741 Bacteria 136301
4 JGI25150J39212_1011038 3300002774 Bacteria 1653
5 JGI25150J39212_1016409 3300002774 Bacteria 1216
6 JGI25159J45721_1000348 3300002987 Bacteria 21410
7 JGI25159J45721_1009889 3300002987 Bacteria 2480
8 JGI25159J45721_1030755 3300002987 Bacteria 868
9 JGI25151J46595_10011919 3300003187 Bacteria 3974
10 rootH1_10095860 3300003316 Bacteria 1026
11 JGI25160J50197_1000379 3300003354 Bacteria 29058
12 JGI25160J50197_1000400 3300003354 Bacteria 27971
13 JGI25160J50197_1051698 3300003354 Bacteria 868
14 JGI25161J50226_1000222 3300003374 Bacteria 35113
15 JGI25161J50226_1000247 3300003374 Bacteria 32339
16 Ga0055526_1000306 3300003771 Bacteria 40960
17 Ga0055526_1001433 3300003771 Bacteria 16981
18 Ga0055526_1039082 3300003771 Bacteria 1213
19 Ga0055526_1053003 3300003771 Bacteria 911
20 Ga0055537_1000008 3300003773 Bacteria 142572
21 Ga0055537_1000119 3300003773 Bacteria 59684
22 Ga0055537_1017485 3300003773 Bacteria 1177
23 Ga0055537_1023836 3300003773 Bacteria 869
24 Ga0055537_1027546 3300003773 Bacteria 762
25 Ga0055524_1000075 3300003775 Bacteria 121897
26 Ga0055524_1007019 3300003775 Bacteria 4838
27 Ga0055524_1017662 3300003775 Bacteria 2509
28 Ga0055524_1044388 3300003775 Bacteria 1081
29 Ga0055536_1006581 3300003781 Bacteria 5382
30 Ga0055534_1000047 3300003784 Bacteria 94932
31 Ga0055534_1000809 3300003784 Bacteria 14478
32 Ga0055534_1017776 3300003784 Bacteria 1250
33 Ga0055528_1000049 3300003790 Bacteria 94814
34 Ga0055528_1000272 3300003790 Bacteria 43798
35 Ga0055530_10000152 3300003791 Bacteria 62435
36 Ga0055530_10001546 3300003791 Bacteria 16531
37 Ga0055530_10029756 3300003791 Bacteria 1455
38 Ga0055540_1000160 3300003792 Bacteria 66881
39 Ga0055531_10000366 3300003794 Bacteria 43612
40 Ga0055531_10000652 3300003794 Bacteria 29887
41 Ga0055531_10007406 3300003794 Bacteria 6001
42 Ga0055531_10059006 3300003794 Bacteria 951
43 Ga0055543_1000185 3300004625 Bacteria 50666
44 Ga0055543_1000925 3300004625 Bacteria 13667
45 Ga0065165_1000167 3300005262 Bacteria 115630
46 Ga0065165_1001481 3300005262 Bacteria 24964
47 Ga0065165_1017928 3300005262 Bacteria 2585
48 Ga0065165_1033251 3300005262 Bacteria 1606
49 Ga0065165_1046968 3300005262 Bacteria 1249
50 Ga0068869_100793449 3300005334 Bacteria 813
51 Ga0070678_100443635 3300005456 Bacteria 1135
52 Ga0070662_100531911 3300005457 Bacteria 983
53 Ga0068867_100122554 3300005459 Bacteria 2011
54 Ga0068854_100372163 3300005578 Bacteria 1175
55 Ga0068862_100406263 3300005844 Bacteria 1275
56 Ga0075363_100309920 3300006048 Bacteria 917
57 Ga0068871_100254427 3300006358 Bacteria 1531
58 Ga0079104_1065140 3300006946 Bacteria 776
59 Ga0099826_10000048 3300006948 Bacteria 74895
60 Ga0105244_10002531 3300009036 Bacteria 13730
61 Ga0163162_10683708 3300013306 Bacteria 1149
62 Ga0157380_10231923 3300014326 Bacteria 1659
63 Ga0157379_10242792 3300014968 Bacteria 1634
64 Ga0163161_10014363 3300017792 Bacteria 5512
65 Ga0213872_10000981 3300021361 Bacteria 19948
66 Ga0213872_10006546 3300021361 Bacteria 5827
67 Ga0213872_10330837 3300021361 Bacteria 628
68 Ga0209435_100001 3300025206 Bacteria 1424171
69 Ga0209436_100148 3300025208 Bacteria 33690
70 Ga0209436_104982 3300025208 Bacteria 3166
71 Ga0209436_111930 3300025208 Bacteria 1500
72 Ga0209436_120974 3300025208 Bacteria 870
73 Ga0207425_1000093 3300025245 Bacteria 87038
74 Ga0207425_1001279 3300025245 Bacteria 10933
75 Ga0207425_1009193 3300025245 Bacteria 2473
76 Ga0209646_1000001 3300025246 Bacteria 3092932
77 Ga0209026_1000003 3300025250 Bacteria 1060571
78 Ga0209759_1000001 3300025256 Bacteria 2799452
79 Ga0209129_1000344 3300025258 Bacteria 39975
80 Ga0209129_1008401 3300025258 Bacteria 2877
81 Ga0209565_1000004 3300025263 Bacteria 983150
82 Ga0209565_1000112 3300025263 Bacteria 117209
83 Ga0209565_1001307 3300025263 Bacteria 11476
84 Ga0209565_1005330 3300025263 Bacteria 3753
85 Ga0209565_1006531 3300025263 Bacteria 3261
86 Ga0209565_1012246 3300025263 Bacteria 2054
87 Ga0209565_1019690 3300025263 Bacteria 1436
88 Ga0209673_1000210 3300025273 Bacteria 117276
89 Ga0209673_1000275 3300025273 Bacteria 96728
90 Ga0209130_1000016 3300025284 Bacteria 395540
91 Ga0209130_1000129 3300025284 Bacteria 123096
92 Ga0209130_1000299 3300025284 Bacteria 60368
93 Ga0209130_1000369 3300025284 Bacteria 51132
94 Ga0209130_1014636 3300025284 Bacteria 1961
95 Ga0209675_1000044 3300025291 Bacteria 230392
96 Ga0209675_1000142 3300025291 Bacteria 95327
97 Ga0209675_1008043 3300025291 Bacteria 3939
98 Ga0209675_1018592 3300025291 Bacteria 1940
99 Ga0209676_1000029 3300025292 Bacteria 520536
100 Ga0209676_1008637 3300025292 Bacteria 4511
101 Ga0209025_1002883 3300025294 Bacteria 17225
102 Ga0209025_1005351 3300025294 Bacteria 10521
103 Ga0209564_1000042 3300025295 Bacteria 392805
104 Ga0209564_1000245 3300025295 Bacteria 117378
105 Ga0209564_1000356 3300025295 Bacteria 85562
106 Ga0209564_1000448 3300025295 Bacteria 70600
107 Ga0209564_1009484 3300025295 Bacteria 4625
108 Ga0209564_1014928 3300025295 Bacteria 3196
109 Ga0209564_1021137 3300025295 Bacteria 2354
110 Ga0209564_1036838 3300025295 Bacteria 1388
111 Ga0209758_1063563 3300025297 Bacteria 1201
112 Ga0209050_1000003 3300025298 Bacteria 1609245
113 Ga0209050_1000086 3300025298 Bacteria 262009
114 Ga0209050_1000211 3300025298 Bacteria 129614
115 Ga0209050_1001147 3300025298 Bacteria 31733
116 Ga0209050_1002834 3300025298 Bacteria 13772
117 Ga0209050_1006363 3300025298 Bacteria 7017
118 Ga0209256_1000001 3300025299 Bacteria 2166974
119 Ga0209256_1000252 3300025299 Bacteria 94936
120 Ga0209256_1000268 3300025299 Bacteria 91897
121 Ga0209256_1000929 3300025299 Bacteria 35648
122 Ga0209256_1002063 3300025299 Bacteria 17738
123 Ga0209256_1023696 3300025299 Bacteria 1824
124 Ga0209256_1050700 3300025299 Bacteria 1005
125 Ga0207426_1000071 3300025302 Bacteria 329539
126 Ga0207426_1004111 3300025302 Bacteria 7313
127 Ga0207426_1004151 3300025302 Bacteria 7255
128 Ga0207426_1026693 3300025302 Bacteria 1931
129 Ga0207426_1086941 3300025302 Bacteria 835
130 Ga0209051_1000003 3300025303 Bacteria 1609245
131 Ga0209051_1028385 3300025303 Bacteria 2211
132 Ga0209257_1000018 3300025304 Bacteria 836016
133 Ga0209257_1000087 3300025304 Bacteria 282503
134 Ga0209257_1001799 3300025304 Bacteria 23534
135 Ga0209257_1016115 3300025304 Bacteria 3048
136 Ga0207655_1004090 3300025728 Bacteria 10499
137 Ga0207669_10142221 3300025937 Bacteria 1667
138 Ga0207648_10070558 3300026089 Bacteria 3046
139 Ga0207683_10243188 3300026121 Bacteria 1642
140 Ga0209282_1000066 3300027666 Bacteria 87072
141 Ga0268265_10447315 3300028380 Bacteria 1206
142 Ga0307515_10228770 3300028794 Bacteria 1658
143 Ga0307515_10439350 3300028794 Bacteria 922
144 Ga0316177_1159406 3300030731 Bacteria 2709
145 Ga0316180_1051715 3300030736 Bacteria 1718
146 Ga0316181_1067271 3300030744 Bacteria 2972
147 Ga0307513_10000006 3300031456 Bacteria 470848
148 Ga0307513_10000014 3300031456 Bacteria 303157
149 Ga0307408_100000106 3300031548 Bacteria 91438
150 Ga0307408_100000289 3300031548 Bacteria 49603
151 Ga0307408_100000326 3300031548 Bacteria 45638
152 Ga0307408_100011010 3300031548 Bacteria 5968
153 Ga0307408_100058417 3300031548 Bacteria 2804
154 Ga0307516_10117227 3300031730 Bacteria 2457
155 Ga0307405_10893210 3300031731 Bacteria 751
156 Ga0307412_10443772 3300031911 Bacteria 1067
157 Ga0307412_11762183 3300031911 Bacteria 569
158 Ga0307416_100020241 3300032002 Bacteria 4742
159 Ga0373939_0132434 3300035114 Bacteria 891
160 Ga0436361_0324047 3300039447 Bacteria 25390
161 Ga0436361_0470245 3300039447 Bacteria 1406
162 Ga0436361_1158315 3300039447 Bacteria 8002
163 Ga0451791_0185433 3300041451 Bacteria 585
164 Ga0451839_0707710 3300041496 Bacteria 613
165 Ga0451853_0244838 3300041512 Bacteria 958
166 Ga0451853_1391320 3300041512 Bacteria 1554
167 Ga0451577_0253127 3300042876 Bacteria 1594
168 Ga0453684_0873213 3300044712 Bacteria 965
169 Ga0495617_002298 3300046452 Bacteria 7715
170 Ga0495617_002348 3300046452 Bacteria 7579
171 Ga0495617_009698 3300046452 Bacteria 3303
172 Ga0495617_025256 3300046452 Bacteria 2003
173 Ga0495590_0000056 3300046457 Bacteria 96913
174 Ga0495590_0011115 3300046457 Bacteria 3373
175 Ga0495638_0000170 3300046460 Bacteria 101629
176 Ga0495638_0006602 3300046460 Bacteria 8430
177 Ga0495638_0018858 3300046460 Bacteria 4574
178 Ga0495638_0239732 3300046460 Bacteria 1005
179 Ga0495638_0340005 3300046460 Bacteria 796
180 Ga0495653_0000066 3300046463 Bacteria 91671
181 Ga0495650_0000553 3300046471 Bacteria 53302
182 Ga0495650_0001888 3300046471 Bacteria 18636
183 Ga0495650_0003450 3300046471 Bacteria 11527
184 Ga0495650_0026921 3300046471 Bacteria 2665
185 Ga0495650_0065614 3300046471 Bacteria 1440
186 Ga0495605_0000315 3300046474 Bacteria 50714
187 Ga0495605_0006948 3300046474 Bacteria 6463
188 Ga0495639_0020556 3300046475 Bacteria 2885
189 Ga0495584_0000365 3300046491 Bacteria 31489
190 Ga0495584_0001822 3300046491 Bacteria 12380
191 Ga0495585_0000646 3300046492 Bacteria 32025
192 Ga0495585_0027344 3300046492 Bacteria 3255
193 Ga0495585_0036737 3300046492 Bacteria 2760
194 Ga0495585_0089739 3300046492 Bacteria 1656
195 Ga0495585_0118033 3300046492 Bacteria 1405
196 Ga0495594_0047325 3300046499 Bacteria 2362
197 Ga0495596_0002901 3300046500 Bacteria 8917
198 Ga0495607_0001697 3300046501 Bacteria 18946
199 Ga0495607_0014081 3300046501 Bacteria 5220
200 Ga0495607_0022969 3300046501 Bacteria 3909
201 Ga0495607_0031611 3300046501 Bacteria 3239
202 Ga0495607_0068419 3300046501 Bacteria 1991
203 Ga0495607_0145084 3300046501 Bacteria 1220
204 Ga0495607_0242291 3300046501 Unclassified 872
205 Ga0495607_0389714 3300046501 Bacteria 636
206 Ga0495583_0000417 3300046506 Bacteria 64786
207 Ga0495583_0003284 3300046506 Bacteria 12546
208 Ga0495583_0037555 3300046506 Bacteria 2295
209 Ga0495606_0000063 3300046507 Bacteria 184610
210 Ga0495606_0000431 3300046507 Bacteria 69714
211 Ga0495606_0001347 3300046507 Bacteria 33360
212 Ga0495606_0003374 3300046507 Bacteria 16993
213 Ga0495606_0004107 3300046507 Bacteria 14789
214 Ga0495606_0008520 3300046507 Bacteria 8892
215 Ga0495606_0151700 3300046507 Bacteria 1359
216 Ga0495606_0422276 3300046507 Bacteria 689
217 Ga0495610_0000014 3300046512 Bacteria 444708
218 Ga0495610_0000353 3300046512 Bacteria 48216
219 Ga0495610_0001670 3300046512 Bacteria 19517
220 Ga0495610_0005618 3300046512 Bacteria 8852
221 Ga0495610_0009648 3300046512 Bacteria 6077
222 Ga0495610_0043076 3300046512 Bacteria 2252
223 Ga0495616_0004391 3300046513 Bacteria 8897
224 Ga0495616_0011359 3300046513 Bacteria 5108
225 Ga0495631_0040983 3300046518 Bacteria 2050
226 Ga0495637_0000150 3300046520 Bacteria 53429
227 Ga0495637_0006039 3300046520 Bacteria 6115
228 Ga0495643_0000246 3300046522 Bacteria 80483
229 Ga0495643_0000302 3300046522 Bacteria 68932
230 Ga0495643_0235310 3300046522 Bacteria 862
231 Ga0495643_0369349 3300046522 Bacteria 638
232 Ga0495644_0000451 3300046523 Bacteria 18007
233 Ga0495644_0000622 3300046523 Bacteria 14853
234 Ga0495648_0000119 3300046524 Bacteria 95682
235 Ga0495648_0000240 3300046524 Bacteria 62286
236 Ga0495648_0000486 3300046524 Bacteria 42701
237 Ga0495648_0003471 3300046524 Bacteria 13857
238 Ga0495648_0013106 3300046524 Bacteria 6146
239 Ga0495648_0094281 3300046524 Bacteria 1667
240 Ga0495642_0001364 3300046528 Bacteria 10919
241 Ga0495642_0194277 3300046528 Bacteria 884
242 Ga0495642_0403013 3300046528 Bacteria 603
243 Ga0495654_0000014 3300046530 Bacteria 312126
244 Ga0495654_0006366 3300046530 Bacteria 6713
245 Ga0495654_0006588 3300046530 Bacteria 6576
246 Ga0495609_0000816 3300046538 Bacteria 23247
247 Ga0495609_0001962 3300046538 Bacteria 13050
248 Ga0495609_0003738 3300046538 Bacteria 8596
249 Ga0495609_0014881 3300046538 Bacteria 3650
250 Ga0495609_0023045 3300046538 Bacteria 2863
251 Ga0495597_0000069 3300046542 Bacteria 89990
252 Ga0495597_0000123 3300046542 Bacteria 70236
253 Ga0495597_0002767 3300046542 Bacteria 10803
254 Ga0495597_0012964 3300046542 Bacteria 4003
255 Ga0495622_0000109 3300046557 Bacteria 71936
256 Ga0495622_0000246 3300046557 Bacteria 42141
257 Ga0495622_0189670 3300046557 Bacteria 919
258 Ga0495633_0000088 3300046558 Bacteria 124193
259 Ga0495633_0000131 3300046558 Bacteria 100408
260 Ga0495633_0005902 3300046558 Bacteria 7365
261 Ga0495633_0008968 3300046558 Bacteria 5570
262 Ga0495633_0012055 3300046558 Bacteria 4618
263 Ga0495633_0013013 3300046558 Bacteria 4402
264 Ga0495633_0017386 3300046558 Bacteria 3679
265 Ga0495633_0115375 3300046558 Bacteria 1244
266 Ga0495633_0468835 3300046558 Bacteria 568
267 Ga0495656_0006949 3300046615 Bacteria 3981
268 Ga0495656_0023540 3300046615 Bacteria 2424
269 Ga0495656_0248698 3300046615 Bacteria 897
270 Ga0495668_0000152 3300046616 Bacteria 104716
271 Ga0495668_0000188 3300046616 Bacteria 92177
272 Ga0495668_0000574 3300046616 Bacteria 45013
273 Ga0495668_0000636 3300046616 Bacteria 42184
274 Ga0495668_0027065 3300046616 Bacteria 3249
275 Ga0495668_0151915 3300046616 Bacteria 1268
276 Ga0495611_0004697 3300046648 Bacteria 5865
277 Ga0495611_0004729 3300046648 Bacteria 5847
278 Ga0495611_0028671 3300046648 Bacteria 2439
279 Ga0495625_0000386 3300046660 Bacteria 67356
280 Ga0495625_0004123 3300046660 Bacteria 13868
281 Ga0495625_0010047 3300046660 Bacteria 7865
282 Ga0495625_0065999 3300046660 Bacteria 2550
283 Ga0495625_0066294 3300046660 Bacteria 2543
284 Ga0495625_0122456 3300046660 Bacteria 1768
285 Ga0495625_0216235 3300046660 Bacteria 1258
286 Ga0495659_0000026 3300046664 Bacteria 69038
287 Ga0495659_0000364 3300046664 Bacteria 17652
288 Ga0495661_0044139 3300046665 Bacteria 2735
289 Ga0495661_0054321 3300046665 Bacteria 2405
290 Ga0495661_0078641 3300046665 Bacteria 1907
291 Ga0495661_0105039 3300046665 Bacteria 1583
292 Ga0495661_0197919 3300046665 Bacteria 1054
293 Ga0495669_0060196 3300046684 Bacteria 1716
294 Ga0495670_0001843 3300046691 Bacteria 10427
295 Ga0495670_0009901 3300046691 Bacteria 4686
296 Ga0495671_0000005 3300046692 Bacteria 509397
297 Ga0495671_0000144 3300046692 Bacteria 63224
298 Ga0495671_0003189 3300046692 Bacteria 10190
299 Ga0495671_0007388 3300046692 Bacteria 6270
300 Ga0495671_0019087 3300046692 Bacteria 3628
301 Ga0495671_0053365 3300046692 Bacteria 2006
302 Ga0495649_0000600 3300046694 Bacteria 30004
303 Ga0495649_0011122 3300046694 Bacteria 5296
304 Ga0495649_0016777 3300046694 Bacteria 4147
305 Ga0495649_0045495 3300046694 Bacteria 2393
306 Ga0495649_0137334 3300046694 Bacteria 1288
307 Ga0495589_0193612 3300046794 Bacteria 961
308 Ga0495660_0000229 3300046810 Bacteria 55150
309 Ga0495660_0000962 3300046810 Bacteria 21017
310 Ga0495660_0007303 3300046810 Bacteria 6495
311 Ga0495660_0399723 3300046810 Bacteria 602
312 Ga0495636_0000861 3300047318 Bacteria 11216
313 Ga0495636_0140506 3300047318 Bacteria 1078
314 Ga0495672_0000232 3300047320 Bacteria 79561
315 Ga0495672_0000260 3300047320 Bacteria 73347
316 Ga0495672_0002347 3300047320 Bacteria 17504
317 Ga0495672_0004556 3300047320 Bacteria 11276
318 Ga0495683_0002158 3300047323 Bacteria 12082
319 Ga0495683_0003420 3300047323 Bacteria 9263
320 Ga0495683_0189136 3300047323 Bacteria 935
321 Ga0495687_000629 3300047443 Bacteria 40470
322 Ga0495687_003552 3300047443 Bacteria 11207
323 Ga0495687_003553 3300047443 Bacteria 11205
324 Ga0495687_031070 3300047443 Bacteria 2453
325 Ga0495687_047192 3300047443 Bacteria 1854
326 Ga0495677_0003543 3300047445 Bacteria 6056
327 Ga0495677_0010891 3300047445 Bacteria 3332
328 Ga0495677_0031753 3300047445 Bacteria 1922
329 Ga0495677_0050566 3300047445 Bacteria 1529
330 Ga0495679_021392 3300047446 Bacteria 2234
331 Ga0495685_000147 3300047447 Bacteria 24129
332 Ga0495685_014082 3300047447 Bacteria 2714
333 Ga0495673_0000009 3300047469 Bacteria 731993
334 Ga0495673_0000012 3300047469 Bacteria 656908
335 Ga0495673_0000146 3300047469 Bacteria 127378
336 Ga0495673_0013580 3300047469 Bacteria 4272
337 Ga0495673_0062229 3300047469 Bacteria 1595
338 Ga0495673_0273710 3300047469 Bacteria 611
339 Ga0495681_0028587 3300047470 Bacteria 2866
340 Ga0495681_0068982 3300047470 Bacteria 1607
341 Ga0495681_0202504 3300047470 Bacteria 804
342 Ga0495686_0002750 3300047472 Bacteria 16073
343 Ga0495686_0005943 3300047472 Bacteria 9496
344 Ga0495686_0032478 3300047472 Bacteria 3378
345 Ga0495686_0058995 3300047472 Bacteria 2391
346 Ga0495615_0001327 3300048090 Bacteria 3631
347 Ga0495626_0093521 3300048091 Bacteria 1319
348 Ga0496100_0450680 3300048903 Unclassified 986
349 Ga0496103_0001127 3300048906 Bacteria 18573
350 Ga0496107_0883337 3300048910 Bacteria 652
351 Ga0496109_1002587 3300048912 Bacteria 773
352 Ga0496111_1054109 3300048914 Bacteria 581
353 Ga0496114_0162557 3300048917 Bacteria 1942
354 Ga0496119_0139778 3300048922 Bacteria 1309
355 Ga0496121_0227366 3300048924 Bacteria 1309
356 Ga0496122_0069316 3300048925 Bacteria 2526
357 Ga0496123_0008272 3300048926 Bacteria 9587
358 Ga0496124_0156391 3300048927 Bacteria 1782
359 Ga0496126_0043656 3300048929 Bacteria 4133
360 Ga0495678_000278 3300049459 Bacteria 56511
361 Ga0495678_004335 3300049459 Bacteria 8261
362 Ga0495678_022953 3300049459 Bacteria 2720
363 Ga0495678_023903 3300049459 Bacteria 2647
364 Ga0495678_107438 3300049459 Bacteria 957
365 Ga0495682_0000515 3300049460 Bacteria 26766
366 Ga0495682_0000614 3300049460 Bacteria 23998
367 Ga0495682_0129548 3300049460 Bacteria 902
368 Ga0501315_073780 3300049531 Bacteria 570
369 Ga0501227_067565 3300049665 Bacteria 924
370 Ga0501249_010931 3300049679 Bacteria 1902
371 Ga0501269_001658 3300049766 Bacteria 2847
372 Ga0501279_025529 3300049775 Bacteria 859
373 Ga0500644_0001775 3300053088 Bacteria 5580
374 Ga0500593_001823 3300053117 Bacteria 7657
375 Ga0500594_0203563 3300053118 Bacteria 651
376 Ga0500618_001265 3300053125 Bacteria 11758
377 Ga0500586_012053 3300053145 Bacteria 2501
378 Ga0500645_000631 3300053730 Bacteria 22397
379 Ga0500645_001912 3300053730 Bacteria 9900
380 Ga0500645_064946 3300053730 Bacteria 1052
381 Ga0500661_004900 3300055283 Bacteria 2504

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046507 Ga0495606_0001347 Ga0495606_0001347_27986_28426 117
2 3300046520 Ga0495637_0006039 Ga0495637_0006039_727_1167 119
3 3300025295 Ga0209564_1000042 Ga0209564_1000042312 142
4 3300035114 Ga0373939_0132434 Ga0373939_0132434_303_734 142
5 3300048910 Ga0496107_0883337 Ga0496107_0883337_95_526 142
6 3300048914 Ga0496111_1054109 Ga0496111_1054109_64_495 142
7 3300048927 Ga0496124_0156391 Ga0496124_0156391_1096_1527 142
8 3300021361 Ga0213872_10000981 Ga0213872_1000098114 144
9 3300021361 Ga0213872_10006546 Ga0213872_100065463 144
10 3300021361 Ga0213872_10330837 Ga0213872_103308371 144
11 3300039447 Ga0436361_0324047 Ga0436361_0324047_5241_5684 144
12 3300039447 Ga0436361_0470245 Ga0436361_0470245_397_840 144
13 3300039447 Ga0436361_1158315 Ga0436361_1158315_5223_5666 144
14 3300047469 Ga0495673_0000012 Ga0495673_0000012_605234_605671 144
15 3300048929 Ga0496126_0043656 Ga0496126_0043656_2598_3035 144
16 iso_pu_bacteria 2738541297 2738826064 144
17 iso_pu_bacteria 2738541357 2739149861 144
18 iso_pu_bacteria 2738543003 2739191780 144
19 iso_pu_bacteria 2738543026 2739318257 144
20 iso_pu_bacteria 2738543029 2739336498 144
21 iso_pu_bacteria 2821131069 2821136404 144
22 iso_pu_bacteria 2904424332 2904428484 144
23 3300003316 rootH1_10095860 rootH1_100958602 145
24 3300028794 Ga0307515_10228770 Ga0307515_102287701 145
25 3300028794 Ga0307515_10439350 Ga0307515_104393502 145
26 3300046452 Ga0495617_002298 Ga0495617_002298_4975_5415 145
27 3300046460 Ga0495638_0018858 Ga0495638_0018858_3384_3824 145
28 3300046460 Ga0495638_0239732 Ga0495638_0239732_41_481 145
29 3300046471 Ga0495650_0003450 Ga0495650_0003450_752_1192 145
30 3300046471 Ga0495650_0026921 Ga0495650_0026921_565_1005 145
31 3300046501 Ga0495607_0031611 Ga0495607_0031611_2372_2812 145
32 3300046507 Ga0495606_0000063 Ga0495606_0000063_21408_21848 145
33 3300046507 Ga0495606_0004107 Ga0495606_0004107_4937_5377 145
34 3300046512 Ga0495610_0000353 Ga0495610_0000353_11864_12304 145
35 3300046512 Ga0495610_0001670 Ga0495610_0001670_10010_10450 145
36 3300046512 Ga0495610_0005618 Ga0495610_0005618_7235_7675 145
37 3300046520 Ga0495637_0000150 Ga0495637_0000150_52454_52894 145
38 3300046522 Ga0495643_0000246 Ga0495643_0000246_23845_24285 145
39 3300046522 Ga0495643_0235310 Ga0495643_0235310_289_729 145
40 3300046524 Ga0495648_0013106 Ga0495648_0013106_2969_3409 145
41 3300046530 Ga0495654_0000014 Ga0495654_0000014_304474_304914 145
42 3300046538 Ga0495609_0003738 Ga0495609_0003738_1350_1790 145
43 3300046542 Ga0495597_0000069 Ga0495597_0000069_71495_71935 145
44 3300046558 Ga0495633_0008968 Ga0495633_0008968_3496_3936 145
45 3300046616 Ga0495668_0000152 Ga0495668_0000152_32164_32604 145
46 3300046660 Ga0495625_0066294 Ga0495625_0066294_310_750 145
47 3300046660 Ga0495625_0216235 Ga0495625_0216235_519_959 145
48 3300046692 Ga0495671_0007388 Ga0495671_0007388_1632_2072 145
49 3300046694 Ga0495649_0000600 Ga0495649_0000600_27327_27767 145
50 3300046694 Ga0495649_0016777 Ga0495649_0016777_2084_2524 145
51 3300046694 Ga0495649_0137334 Ga0495649_0137334_376_816 145
52 3300046810 Ga0495660_0399723 Ga0495660_0399723_50_490 145
53 3300047320 Ga0495672_0000232 Ga0495672_0000232_25930_26370 145
54 3300047469 Ga0495673_0273710 Ga0495673_0273710_67_507 145
55 3300047472 Ga0495686_0032478 Ga0495686_0032478_1131_1571 145
56 3300049459 Ga0495678_000278 Ga0495678_000278_30100_30540 145
57 3300053118 Ga0500594_0203563 Ga0500594_0203563_78_518 145
58 3300053125 Ga0500618_001265 Ga0500618_001265_4504_4944 145
59 iso_pu_bacteria 2738541300 2738842384 145
60 iso_pu_bacteria 2738543018 2739273131 145
61 iso_pu_bacteria 2738543030 2739342175 145
62 3300002774 JGI25150J39212_1011038 JGI25150J39212_10110382 146
63 3300002774 JGI25150J39212_1016409 JGI25150J39212_10164093 146
64 3300002987 JGI25159J45721_1000348 JGI25159J45721_10003483 146
65 3300002987 JGI25159J45721_1030755 JGI25159J45721_10307552 146
66 3300003354 JGI25160J50197_1051698 JGI25160J50197_10516982 146
67 3300003374 JGI25161J50226_1000222 JGI25161J50226_10002223 146
68 3300003771 Ga0055526_1001433 Ga0055526_100143314 146
69 3300003771 Ga0055526_1039082 Ga0055526_10390822 146
70 3300003771 Ga0055526_1053003 Ga0055526_10530032 146
71 3300003773 Ga0055537_1000119 Ga0055537_100011920 146
72 3300003773 Ga0055537_1017485 Ga0055537_10174852 146
73 3300003773 Ga0055537_1023836 Ga0055537_10238362 146
74 3300003773 Ga0055537_1027546 Ga0055537_10275462 146
75 3300003775 Ga0055524_1007019 Ga0055524_10070192 146
76 3300003775 Ga0055524_1017662 Ga0055524_10176623 146
77 3300003775 Ga0055524_1044388 Ga0055524_10443881 146
78 3300003784 Ga0055534_1000047 Ga0055534_100004731 146
79 3300003784 Ga0055534_1017776 Ga0055534_10177762 146
80 3300003790 Ga0055528_1000049 Ga0055528_100004936 146
81 3300003790 Ga0055528_1000272 Ga0055528_100027235 146
82 3300003791 Ga0055530_10001546 Ga0055530_1000154616 146
83 3300003794 Ga0055531_10000652 Ga0055531_1000065224 146
84 3300003794 Ga0055531_10007406 Ga0055531_100074063 146
85 3300004625 Ga0055543_1000185 Ga0055543_100018518 146
86 3300005262 Ga0065165_1001481 Ga0065165_10014813 146
87 3300025208 Ga0209436_100148 Ga0209436_10014832 146
88 3300025208 Ga0209436_104982 Ga0209436_1049822 146
89 3300025245 Ga0207425_1000093 Ga0207425_10000935 146
90 3300025245 Ga0207425_1009193 Ga0207425_10091933 146
91 3300025258 Ga0209129_1000344 Ga0209129_100034410 146
92 3300025263 Ga0209565_1000112 Ga0209565_100011237 146
93 3300025263 Ga0209565_1001307 Ga0209565_10013078 146
94 3300025263 Ga0209565_1005330 Ga0209565_10053302 146
95 3300025263 Ga0209565_1012246 Ga0209565_10122464 146
96 3300025263 Ga0209565_1019690 Ga0209565_10196903 146
97 3300025273 Ga0209673_1000210 Ga0209673_100021050 146
98 3300025284 Ga0209130_1000369 Ga0209130_100036918 146
99 3300025284 Ga0209130_1014636 Ga0209130_10146364 146
100 3300025291 Ga0209675_1000142 Ga0209675_100014228 146
101 3300025291 Ga0209675_1008043 Ga0209675_10080433 146
102 3300025291 Ga0209675_1018592 Ga0209675_10185922 146
103 3300025295 Ga0209564_1000245 Ga0209564_100024549 146
104 3300025295 Ga0209564_1000448 Ga0209564_100044812 146
105 3300025295 Ga0209564_1021137 Ga0209564_10211373 146
106 3300025295 Ga0209564_1036838 Ga0209564_10368383 146
107 3300025298 Ga0209050_1000086 Ga0209050_1000086186 146
108 3300025298 Ga0209050_1000211 Ga0209050_100021176 146
109 3300025298 Ga0209050_1002834 Ga0209050_10028343 146
110 3300025299 Ga0209256_1000252 Ga0209256_100025228 146
111 3300025299 Ga0209256_1000929 Ga0209256_10009293 146
112 3300025299 Ga0209256_1002063 Ga0209256_100206310 146
113 3300025299 Ga0209256_1023696 Ga0209256_10236964 146
114 3300025299 Ga0209256_1050700 Ga0209256_10507002 146
115 3300025302 Ga0207426_1004151 Ga0207426_10041513 146
116 3300025303 Ga0209051_1028385 Ga0209051_10283853 146
117 3300025304 Ga0209257_1000087 Ga0209257_1000087231 146
118 3300025304 Ga0209257_1001799 Ga0209257_10017994 146
119 3300031548 Ga0307408_100000106 Ga0307408_10000010618 146
120 3300031548 Ga0307408_100000289 Ga0307408_10000028910 146
121 3300031548 Ga0307408_100011010 Ga0307408_1000110106 146
122 3300031548 Ga0307408_100058417 Ga0307408_1000584173 146
123 3300031911 Ga0307412_11762183 Ga0307412_117621831 146
124 3300032002 Ga0307416_100020241 Ga0307416_1000202413 146
125 3300046499 Ga0495594_0047325 Ga0495594_0047325_66_539 146
126 3300046616 Ga0495668_0000188 Ga0495668_0000188_55120_55563 146
127 3300048903 Ga0496100_0450680 Ga0496100_0450680_246_689 146
128 3300049459 Ga0495678_107438 Ga0495678_107438_452_895 146
129 3300049531 Ga0501315_073780 Ga0501315_073780_26_469 146
130 3300049665 Ga0501227_067565 Ga0501227_067565_400_843 146
131 3300049775 Ga0501279_025529 Ga0501279_025529_232_675 146
132 3300005262 Ga0065165_1000167 Ga0065165_100016741 147
133 3300005334 Ga0068869_100793449 Ga0068869_1007934492 147
134 3300025208 Ga0209436_120974 Ga0209436_1209742 147
135 3300025284 Ga0209130_1000016 Ga0209130_1000016298 147
136 3300025302 Ga0207426_1026693 Ga0207426_10266933 147
137 3300046528 Ga0495642_0403013 Ga0495642_0403013_116_562 147
138 3300046616 Ga0495668_0027065 Ga0495668_0027065_2570_3016 147
139 3300046660 Ga0495625_0122456 Ga0495625_0122456_304_750 147
140 3300046665 Ga0495661_0044139 Ga0495661_0044139_2072_2518 147
141 3300046684 Ga0495669_0060196 Ga0495669_0060196_1049_1495 147
142 3300046694 Ga0495649_0011122 Ga0495649_0011122_3374_3820 147
143 3300047443 Ga0495687_031070 Ga0495687_031070_220_666 147
144 3300047443 Ga0495687_047192 Ga0495687_047192_359_805 147
145 3300047445 Ga0495677_0031753 Ga0495677_0031753_1443_1889 147
146 3300047447 Ga0495685_014082 Ga0495685_014082_2223_2669 147
147 3300047470 Ga0495681_0028587 Ga0495681_0028587_1820_2266 147
148 3300047470 Ga0495681_0202504 Ga0495681_0202504_56_502 147
149 3300047472 Ga0495686_0002750 Ga0495686_0002750_9702_10148 147
150 3300009036 Ga0105244_10002531 Ga0105244_100025315 148
151 3300025728 Ga0207655_1004090 Ga0207655_10040907 148
152 3300030731 Ga0316177_1159406 Ga0316177_11594063 148
153 3300030736 Ga0316180_1051715 Ga0316180_10517153 148
154 3300030744 Ga0316181_1067271 Ga0316181_10672712 148
155 3300041512 Ga0451853_0244838 Ga0451853_0244838_302_751 148
156 3300046457 Ga0495590_0000056 Ga0495590_0000056_56571_57020 148
157 3300046460 Ga0495638_0000170 Ga0495638_0000170_66286_66735 148
158 3300046463 Ga0495653_0000066 Ga0495653_0000066_43464_43913 148
159 3300046471 Ga0495650_0001888 Ga0495650_0001888_15408_15857 148
160 3300046471 Ga0495650_0065614 Ga0495650_0065614_623_1072 148
161 3300046475 Ga0495639_0020556 Ga0495639_0020556_798_1247 148
162 3300046492 Ga0495585_0000646 Ga0495585_0000646_3870_4319 148
163 3300046501 Ga0495607_0001697 Ga0495607_0001697_6674_7123 148
164 3300046501 Ga0495607_0389714 Ga0495607_0389714_83_532 148
165 3300046506 Ga0495583_0000417 Ga0495583_0000417_35756_36205 148
166 3300046507 Ga0495606_0000431 Ga0495606_0000431_32246_32695 148
167 3300046507 Ga0495606_0003374 Ga0495606_0003374_6770_7219 148
168 3300046507 Ga0495606_0422276 Ga0495606_0422276_63_512 148
169 3300046512 Ga0495610_0000014 Ga0495610_0000014_387289_387738 148
170 3300046512 Ga0495610_0043076 Ga0495610_0043076_378_827 148
171 3300046522 Ga0495643_0000302 Ga0495643_0000302_34769_35218 148
172 3300046524 Ga0495648_0000119 Ga0495648_0000119_51036_51485 148
173 3300046524 Ga0495648_0000240 Ga0495648_0000240_60395_60844 148
174 3300046524 Ga0495648_0003471 Ga0495648_0003471_9682_10131 148
175 3300046528 Ga0495642_0001364 Ga0495642_0001364_9504_9953 148
176 3300046530 Ga0495654_0006366 Ga0495654_0006366_4024_4473 148
177 3300046538 Ga0495609_0014881 Ga0495609_0014881_2853_3302 148
178 3300046542 Ga0495597_0000123 Ga0495597_0000123_34439_34888 148
179 3300046557 Ga0495622_0000246 Ga0495622_0000246_31966_32415 148
180 3300046558 Ga0495633_0000088 Ga0495633_0000088_75233_75682 148
181 3300046558 Ga0495633_0000131 Ga0495633_0000131_21185_21634 148
182 3300046558 Ga0495633_0005902 Ga0495633_0005902_1939_2388 148
183 3300046558 Ga0495633_0012055 Ga0495633_0012055_1300_1749 148
184 3300046558 Ga0495633_0013013 Ga0495633_0013013_1119_1568 148
185 3300046616 Ga0495668_0000574 Ga0495668_0000574_36447_36896 148
186 3300046616 Ga0495668_0000636 Ga0495668_0000636_3670_4119 148
187 3300046660 Ga0495625_0000386 Ga0495625_0000386_57221_57670 148
188 3300046660 Ga0495625_0004123 Ga0495625_0004123_6633_7082 148
189 3300046660 Ga0495625_0065999 Ga0495625_0065999_1809_2258 148
190 3300046665 Ga0495661_0197919 Ga0495661_0197919_362_811 148
191 3300046692 Ga0495671_0000005 Ga0495671_0000005_24685_25134 148
192 3300046692 Ga0495671_0053365 Ga0495671_0053365_181_630 148
193 3300046794 Ga0495589_0193612 Ga0495589_0193612_56_505 148
194 3300046810 Ga0495660_0000962 Ga0495660_0000962_12774_13223 148
195 3300046810 Ga0495660_0007303 Ga0495660_0007303_1107_1556 148
196 3300047323 Ga0495683_0003420 Ga0495683_0003420_5359_5808 148
197 3300047443 Ga0495687_003552 Ga0495687_003552_3616_4065 148
198 3300047443 Ga0495687_003553 Ga0495687_003553_7141_7590 148
199 3300047446 Ga0495679_021392 Ga0495679_021392_999_1448 148
200 3300047469 Ga0495673_0000009 Ga0495673_0000009_715254_715703 148
201 3300047469 Ga0495673_0000146 Ga0495673_0000146_63176_63625 148
202 3300047470 Ga0495681_0068982 Ga0495681_0068982_1002_1454 148
203 3300048090 Ga0495615_0001327 Ga0495615_0001327_2462_2911 148
204 3300048906 Ga0496103_0001127 Ga0496103_0001127_11038_11487 148
205 3300048912 Ga0496109_1002587 Ga0496109_1002587_49_498 148
206 3300048917 Ga0496114_0162557 Ga0496114_0162557_1306_1755 148
207 3300048922 Ga0496119_0139778 Ga0496119_0139778_577_1026 148
208 3300048924 Ga0496121_0227366 Ga0496121_0227366_642_1091 148
209 3300048925 Ga0496122_0069316 Ga0496122_0069316_309_758 148
210 3300048926 Ga0496123_0008272 Ga0496123_0008272_8855_9304 148
211 3300049459 Ga0495678_004335 Ga0495678_004335_1285_1734 148
212 3300049459 Ga0495678_022953 Ga0495678_022953_1285_1734 148
213 3300049679 Ga0501249_010931 Ga0501249_010931_1287_1739 148
214 3300049766 Ga0501269_001658 Ga0501269_001658_195_647 148
215 3300053145 Ga0500586_012053 Ga0500586_012053_1676_2125 148
216 3300005262 Ga0065165_1046968 Ga0065165_10469682 149
217 3300006946 Ga0079104_1065140 Ga0079104_10651402 149
218 3300006948 Ga0099826_10000048 Ga0099826_1000004837 149
219 3300025263 Ga0209565_1006531 Ga0209565_10065311 149
220 3300025295 Ga0209564_1014928 Ga0209564_10149283 149
221 3300025299 Ga0209256_1000268 Ga0209256_100026843 149
222 3300027666 Ga0209282_1000066 Ga0209282_100006644 149
223 3300046507 Ga0495606_0151700 Ga0495606_0151700_569_1021 149
224 3300046538 Ga0495609_0023045 Ga0495609_0023045_2100_2552 149
225 3300046542 Ga0495597_0012964 Ga0495597_0012964_1044_1496 149
226 3300046616 Ga0495668_0151915 Ga0495668_0151915_766_1218 149
227 3300046694 Ga0495649_0045495 Ga0495649_0045495_1318_1770 149
228 3300046810 Ga0495660_0000229 Ga0495660_0000229_23157_23609 149
229 3300047472 Ga0495686_0005943 Ga0495686_0005943_1232_1684 149
230 3300005456 Ga0070678_100443635 Ga0070678_1004436352 150
231 3300005457 Ga0070662_100531911 Ga0070662_1005319112 150
232 3300005459 Ga0068867_100122554 Ga0068867_1001225542 150
233 3300005844 Ga0068862_100406263 Ga0068862_1004062633 150
234 3300006358 Ga0068871_100254427 Ga0068871_1002544273 150
235 3300013306 Ga0163162_10683708 Ga0163162_106837082 150
236 3300014326 Ga0157380_10231923 Ga0157380_102319233 150
237 3300014968 Ga0157379_10242792 Ga0157379_102427922 150
238 3300017792 Ga0163161_10014363 Ga0163161_100143633 150
239 3300025937 Ga0207669_10142221 Ga0207669_101422213 150
240 3300026089 Ga0207648_10070558 Ga0207648_100705584 150
241 3300026121 Ga0207683_10243188 Ga0207683_102431883 150
242 3300028380 Ga0268265_10447315 Ga0268265_104473152 150
243 3300031548 Ga0307408_100000326 Ga0307408_10000032614 150
244 3300046524 Ga0495648_0094281 Ga0495648_0094281_53_505 150
245 3300046665 Ga0495661_0105039 Ga0495661_0105039_1027_1479 150
246 iso_pu_bacteria 2643221645 2644250423 150
247 3300031730 Ga0307516_10117227 Ga0307516_101172273 151
248 3300046471 Ga0495650_0000553 Ga0495650_0000553_46240_46710 151
249 3300046507 Ga0495606_0008520 Ga0495606_0008520_275_745 151
250 3300046460 Ga0495638_0340005 Ga0495638_0340005_220_681 152
251 3300046474 Ga0495605_0000315 Ga0495605_0000315_38035_38496 152
252 3300046452 Ga0495617_002348 Ga0495617_002348_3253_3717 153
253 3300046452 Ga0495617_009698 Ga0495617_009698_2275_2739 153
254 3300046457 Ga0495590_0011115 Ga0495590_0011115_2076_2540 153
255 3300046460 Ga0495638_0006602 Ga0495638_0006602_5629_6093 153
256 3300046474 Ga0495605_0006948 Ga0495605_0006948_4093_4557 153
257 3300046491 Ga0495584_0001822 Ga0495584_0001822_10421_10885 153
258 3300046492 Ga0495585_0027344 Ga0495585_0027344_2728_3192 153
259 3300046501 Ga0495607_0014081 Ga0495607_0014081_1432_1896 153
260 3300046506 Ga0495583_0003284 Ga0495583_0003284_11539_12003 153
261 3300046513 Ga0495616_0011359 Ga0495616_0011359_1460_1924 153
262 3300046523 Ga0495644_0000451 Ga0495644_0000451_6129_6593 153
263 3300046524 Ga0495648_0000486 Ga0495648_0000486_9729_10193 153
264 3300046530 Ga0495654_0006588 Ga0495654_0006588_557_1099 153
265 3300046538 Ga0495609_0000816 Ga0495609_0000816_1439_1903 153
266 3300046538 Ga0495609_0001962 Ga0495609_0001962_5794_6258 153
267 3300046557 Ga0495622_0000109 Ga0495622_0000109_39160_39636 153
268 3300046558 Ga0495633_0017386 Ga0495633_0017386_2017_2481 153
269 3300046648 Ga0495611_0004697 Ga0495611_0004697_5242_5706 153
270 3300046660 Ga0495625_0010047 Ga0495625_0010047_1838_2302 153
271 3300046664 Ga0495659_0000026 Ga0495659_0000026_39911_40453 153
272 3300046664 Ga0495659_0000364 Ga0495659_0000364_9891_10355 153
273 3300046691 Ga0495670_0001843 Ga0495670_0001843_825_1289 153
274 3300046692 Ga0495671_0000144 Ga0495671_0000144_22686_23228 153
275 3300046692 Ga0495671_0003189 Ga0495671_0003189_2391_2855 153
276 3300046692 Ga0495671_0019087 Ga0495671_0019087_1820_2284 153
277 3300047318 Ga0495636_0000861 Ga0495636_0000861_5727_6191 153
278 3300047320 Ga0495672_0000260 Ga0495672_0000260_43973_44515 153
279 3300047320 Ga0495672_0004556 Ga0495672_0004556_9619_10083 153
280 3300047323 Ga0495683_0002158 Ga0495683_0002158_5866_6330 153
281 3300047443 Ga0495687_000629 Ga0495687_000629_2521_2985 153
282 3300047445 Ga0495677_0003543 Ga0495677_0003543_2183_2647 153
283 3300047447 Ga0495685_000147 Ga0495685_000147_7137_7601 153
284 3300047469 Ga0495673_0013580 Ga0495673_0013580_355_819 153
285 3300047472 Ga0495686_0058995 Ga0495686_0058995_863_1327 153
286 3300049459 Ga0495678_023903 Ga0495678_023903_1584_2048 153
287 3300049460 Ga0495682_0000515 Ga0495682_0000515_8659_9123 153
288 3300049460 Ga0495682_0000614 Ga0495682_0000614_11423_11887 153
289 3300042876 Ga0451577_0253127 Ga0451577_0253127_605_1072 154
290 3300044712 Ga0453684_0873213 Ga0453684_0873213_136_603 154
291 3300046542 Ga0495597_0002767 Ga0495597_0002767_4684_5226 154
292 iso_pu_bacteria 2511231002 2511242713 154
293 3300046452 Ga0495617_025256 Ga0495617_025256_212_682 155
294 3300046491 Ga0495584_0000365 Ga0495584_0000365_27871_28341 155
295 3300046492 Ga0495585_0036737 Ga0495585_0036737_381_851 155
296 3300046492 Ga0495585_0089739 Ga0495585_0089739_66_536 155
297 3300046492 Ga0495585_0118033 Ga0495585_0118033_29_499 155
298 3300046501 Ga0495607_0022969 Ga0495607_0022969_160_630 155
299 3300046501 Ga0495607_0068419 Ga0495607_0068419_720_1190 155
300 3300046501 Ga0495607_0145084 Ga0495607_0145084_29_499 155
301 3300046506 Ga0495583_0037555 Ga0495583_0037555_1148_1618 155
302 3300046512 Ga0495610_0009648 Ga0495610_0009648_2123_2593 155
303 3300046513 Ga0495616_0004391 Ga0495616_0004391_7303_7773 155
304 3300046523 Ga0495644_0000622 Ga0495644_0000622_6170_6640 155
305 3300046557 Ga0495622_0189670 Ga0495622_0189670_181_651 155
306 3300046558 Ga0495633_0115375 Ga0495633_0115375_248_718 155
307 3300046558 Ga0495633_0468835 Ga0495633_0468835_55_525 155
308 3300046615 Ga0495656_0006949 Ga0495656_0006949_1273_1743 155
309 3300046615 Ga0495656_0023540 Ga0495656_0023540_877_1347 155
310 3300046615 Ga0495656_0248698 Ga0495656_0248698_405_875 155
311 3300046648 Ga0495611_0004729 Ga0495611_0004729_5218_5688 155
312 3300046648 Ga0495611_0028671 Ga0495611_0028671_297_767 155
313 3300046665 Ga0495661_0054321 Ga0495661_0054321_894_1364 155
314 3300046665 Ga0495661_0078641 Ga0495661_0078641_374_844 155
315 3300046691 Ga0495670_0009901 Ga0495670_0009901_1047_1517 155
316 3300047318 Ga0495636_0140506 Ga0495636_0140506_447_917 155
317 3300047320 Ga0495672_0002347 Ga0495672_0002347_758_1228 155
318 3300047445 Ga0495677_0050566 Ga0495677_0050566_913_1383 155
319 3300047469 Ga0495673_0062229 Ga0495673_0062229_781_1251 155
320 3300049460 Ga0495682_0129548 Ga0495682_0129548_418_888 155
321 3300031456 Ga0307513_10000006 Ga0307513_1000000639 156
322 3300041451 Ga0451791_0185433 Ga0451791_0185433_37_507 156
323 3300041496 Ga0451839_0707710 Ga0451839_0707710_131_601 156
324 3300041512 Ga0451853_1391320 Ga0451853_1391320_497_967 156
325 3300006048 Ga0075363_100309920 Ga0075363_1003099202 157
326 3300031456 Ga0307513_10000014 Ga0307513_1000001456 157
327 3300046500 Ga0495596_0002901 Ga0495596_0002901_2504_2977 157
328 3300046501 Ga0495607_0242291 Ga0495607_0242291_319_792 157
329 3300046518 Ga0495631_0040983 Ga0495631_0040983_1169_1642 157
330 3300046522 Ga0495643_0369349 Ga0495643_0369349_35_508 157
331 3300046528 Ga0495642_0194277 Ga0495642_0194277_271_744 157
332 3300047323 Ga0495683_0189136 Ga0495683_0189136_245_718 157
333 3300047445 Ga0495677_0010891 Ga0495677_0010891_334_807 157
334 3300048091 Ga0495626_0093521 Ga0495626_0093521_185_658 157
335 3300053730 Ga0500645_000631 Ga0500645_000631_4706_5179 157
336 3300053730 Ga0500645_001912 Ga0500645_001912_6770_7243 157
337 3300053730 Ga0500645_064946 Ga0500645_064946_354_827 157
338 3300055283 Ga0500661_004900 Ga0500661_004900_1142_1615 157
339 iso_pu_bacteria 2643221603 2644031337 157
340 3300002705 JGI25156J39149_1000025 JGI25156J39149_100002582 158
341 3300002738 JGI25154J39366_1000045 JGI25154J39366_100004582 158
342 3300002741 JGI25157J39369_1000034 JGI25157J39369_100003482 158
343 3300002987 JGI25159J45721_1009889 JGI25159J45721_10098894 158
344 3300003187 JGI25151J46595_10011919 JGI25151J46595_100119193 158
345 3300003354 JGI25160J50197_1000379 JGI25160J50197_10003794 158
346 3300003354 JGI25160J50197_1000400 JGI25160J50197_100040013 158
347 3300003374 JGI25161J50226_1000247 JGI25161J50226_100024720 158
348 3300003771 Ga0055526_1000306 Ga0055526_100030637 158
349 3300003773 Ga0055537_1000008 Ga0055537_10000085 158
350 3300003775 Ga0055524_1000075 Ga0055524_100007555 158
351 3300003781 Ga0055536_1006581 Ga0055536_10065813 158
352 3300003784 Ga0055534_1000809 Ga0055534_10008098 158
353 3300003791 Ga0055530_10000152 Ga0055530_100001525 158
354 3300003791 Ga0055530_10029756 Ga0055530_100297563 158
355 3300003792 Ga0055540_1000160 Ga0055540_100016056 158
356 3300003794 Ga0055531_10000366 Ga0055531_1000036639 158
357 3300003794 Ga0055531_10059006 Ga0055531_100590062 158
358 3300004625 Ga0055543_1000925 Ga0055543_10009257 158
359 3300005262 Ga0065165_1017928 Ga0065165_10179282 158
360 3300005262 Ga0065165_1033251 Ga0065165_10332512 158
361 3300005578 Ga0068854_100372163 Ga0068854_1003721632 158
362 3300025206 Ga0209435_100001 Ga0209435_100001900 158
363 3300025208 Ga0209436_111930 Ga0209436_1119303 158
364 3300025245 Ga0207425_1001279 Ga0207425_10012795 158
365 3300025246 Ga0209646_1000001 Ga0209646_10000011269 158
366 3300025250 Ga0209026_1000003 Ga0209026_1000003900 158
367 3300025256 Ga0209759_1000001 Ga0209759_1000001900 158
368 3300025258 Ga0209129_1008401 Ga0209129_10084013 158
369 3300025263 Ga0209565_1000004 Ga0209565_1000004809 158
370 3300025273 Ga0209673_1000275 Ga0209673_100027529 158
371 3300025284 Ga0209130_1000129 Ga0209130_100012957 158
372 3300025284 Ga0209130_1000299 Ga0209130_100029919 158
373 3300025291 Ga0209675_1000044 Ga0209675_1000044232 158
374 3300025292 Ga0209676_1000029 Ga0209676_100002995 158
375 3300025292 Ga0209676_1008637 Ga0209676_10086378 158
376 3300025294 Ga0209025_1002883 Ga0209025_10028839 158
377 3300025294 Ga0209025_1005351 Ga0209025_100535110 158
378 3300025295 Ga0209564_1000356 Ga0209564_100035623 158
379 3300025295 Ga0209564_1009484 Ga0209564_10094842 158
380 3300025297 Ga0209758_1063563 Ga0209758_10635633 158
381 3300025298 Ga0209050_1000003 Ga0209050_1000003157 158
382 3300025298 Ga0209050_1001147 Ga0209050_100114721 158
383 3300025298 Ga0209050_1006363 Ga0209050_10063634 158
384 3300025299 Ga0209256_1000001 Ga0209256_1000001159 158
385 3300025302 Ga0207426_1000071 Ga0207426_1000071311 158
386 3300025302 Ga0207426_1004111 Ga0207426_10041115 158
387 3300025302 Ga0207426_1086941 Ga0207426_10869412 158
388 3300025303 Ga0209051_1000003 Ga0209051_1000003157 158
389 3300025304 Ga0209257_1000018 Ga0209257_1000018157 158
390 3300025304 Ga0209257_1016115 Ga0209257_10161156 158
391 3300031731 Ga0307405_10893210 Ga0307405_108932102 158
392 3300031911 Ga0307412_10443772 Ga0307412_104437722 158
393 3300053088 Ga0500644_0001775 Ga0500644_0001775_3128_3604 158
394 3300053117 Ga0500593_001823 Ga0500593_001823_3348_3824 158
395 iso_pu_bacteria 2643221664 2644356055 158
396 iso_pu_bacteria 2738541280 2738742612 158

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13501

SoxY

Sulfur oxidation protein SoxY

63

173

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oxh-assembly3.cif.gz_D the soxyz complex of paracoccus pantotrophus 0.8729 38 150
4brj-assembly1.cif.gz_A superoxide reductase (neelaredoxin) from ignicoccus hospitalis t24k 0.8727 56 149
4brv-assembly1.cif.gz_D superoxide reductase (neelaredoxin) from ignicoccus hospitalis e23a 0.8648 56 149
2oxg-assembly4.cif.gz_E the soxyz complex of paracoccus pantotrophus 0.8616 56 149
2ox5-assembly3.cif.gz_C the soxyz complex of paracoccus pantotrophus 0.8589 56 149
ID Description Score Start End Superfamily
2ox5B00 Mainly Beta;Sandwich;Immunoglobulin-like;SoxY domain 0.8865 38 150 2.60.40.2470
2oxgE00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8616 56 149 2.60.40.10
af_Q58151_5_116_2.60.40.730 Mainly Beta;Sandwich;Immunoglobulin-like;SOR catalytic domain 0.8582 50 149 2.60.40.730
2ox5B00 Mainly Beta;Sandwich;Immunoglobulin-like;SoxY domain 0.849 38 150 2.60.40.2470
2nncA00 Mainly Beta;Sandwich;Immunoglobulin-like;SoxY domain 0.8446 36 149 2.60.40.2470
ID Description Score Start End GO Terms
AF-A0A526YJA9-F1-model_v4 Sulfur oxidation protein SoxY 0.9404 44 133
AF-A0A2V6WSE4-F1-model_v4 Ig-like SoxY domain-containing protein 0.9202 72 153
AF-W6KAT5-F1-model_v4 Putative thiosulfate-binding protein SoxY 0.918 37 149
AF-A0A7W3UBD8-F1-model_v4 deleted 0.9159 69 153
AF-A0A526YJA9-F1-model_v4 Sulfur oxidation protein SoxY 0.9113 44 133

Feature Viewer

pLDDT pTM Quality
77.76 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map