F433625

General Info

Members Datasets Scaffolds Average Seq Length
396 241 792 239

Family's Representative Sequence

Representative Sequence 3300049589|Ga0501073_0000896|Ga0501073_0000896_11771_12634
Length 287
Sequence MPKKPETGHIRQIRTRIRHDPALNRNLIDFRGRLVQIVRPRQACRRMNGYVDIYTLIFLAIAVVIFLRLRSVLGRRTGSERPPFDPFSKRPDARPESRDDKVVSLPRRTEERGAPAPRASIEATAEERVKTVAPPGSPVAAGLKAIAQVDAEFETTRFIAGAKAAYEMIVTAFAEGDRKVLKQLLSKDVFDGFIAAITQRETRQEKIEFRFVGIDKAEITGAALKNGTAQVTVKFLSKLISATRDKAGAVIDGDPFHVSDVTDIWTFARDVASRDPNWKLIATESVE

Samples

Sample ID Description Type Environment
1 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
86 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
88 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
127 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
128 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
129 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
130 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
131 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
132 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
133 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
134 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
135 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
136 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
137 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
138 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
141 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
142 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
145 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
146 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
147 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
148 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
149 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
150 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
151 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
152 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
153 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
154 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
155 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
156 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
159 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
166 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
167 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
168 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
169 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
170 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
171 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
172 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
173 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
174 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
175 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
176 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
189 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
190 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
191 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
200 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
201 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
202 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
203 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
204 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
205 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
206 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
209 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
210 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
211 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
212 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
213 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
214 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
215 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
216 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
217 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
218 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
219 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
220 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
221 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
222 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
223 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
224 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
225 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
226 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
227 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
228 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
229 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
230 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
231 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
232 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
233 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
234 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
236 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
237 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
238 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
239 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
240 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
241 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.22
Metatranscriptomes 1.52
Isolates 1.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.85
Nodule 0
Rhizoplane 7.32
Rhizosphere 80.56
Stem 0
Stem Tuber 0
Unclassified 15.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501073_0000896 3300049589 Bacteria 21361
2 MBSR1b_contig_11937103 2162886012 Bacteria 3665
3 Ga0065715_10131104 3300005293 Bacteria 2014
4 Ga0070658_10004070 3300005327 Bacteria 11985
5 Ga0070690_100143387 3300005330 Bacteria 1623
6 Ga0068869_100081190 3300005334 Bacteria 2421
7 Ga0070680_100002429 3300005336 Bacteria 13799
8 Ga0070680_100004020 3300005336 Bacteria 11005
9 Ga0070680_100354019 3300005336 Unclassified 1249
10 Ga0070680_100651615 3300005336 Unclassified 905
11 Ga0068868_100195670 3300005338 Bacteria 1683
12 Ga0070689_100009702 3300005340 Bacteria 6830
13 Ga0070689_100329077 3300005340 Bacteria 1278
14 Ga0070689_100501579 3300005340 Bacteria 1040
15 Ga0070691_10001921 3300005341 Bacteria 9125
16 Ga0070691_10008144 3300005341 Bacteria 4800
17 Ga0070691_10009985 3300005341 Bacteria 4325
18 Ga0070661_100031738 3300005344 Bacteria 3820
19 Ga0070661_100146443 3300005344 Bacteria 1783
20 Ga0070692_10086459 3300005345 Bacteria 1697
21 Ga0070669_100226202 3300005353 Unclassified 1481
22 Ga0070669_100290909 3300005353 Bacteria 1311
23 Ga0070673_100164922 3300005364 Bacteria 1887
24 Ga0070659_100080499 3300005366 Bacteria 2601
25 Ga0070703_10006756 3300005406 Bacteria 3217
26 Ga0070713_100019108 3300005436 Bacteria 5222
27 Ga0070705_100001191 3300005440 Bacteria 14159
28 Ga0070705_100239291 3300005440 Unclassified 1268
29 Ga0070705_100357086 3300005440 Unclassified 1068
30 Ga0070700_100003138 3300005441 Bacteria 8490
31 Ga0070694_100003405 3300005444 Bacteria 9533
32 Ga0070708_100162751 3300005445 Bacteria 2080
33 Ga0070708_100335977 3300005445 Bacteria 1424
34 Ga0070663_100692623 3300005455 Unclassified 865
35 Ga0070681_10001080 3300005458 Bacteria 23262
36 Ga0070681_10014577 3300005458 Bacteria 7823
37 Ga0070681_10038983 3300005458 Bacteria 4764
38 Ga0070707_100328255 3300005468 Bacteria 1487
39 Ga0070698_100002001 3300005471 Bacteria 22625
40 Ga0070699_100000576 3300005518 Bacteria 34772
41 Ga0070679_100012577 3300005530 Bacteria 8092
42 Ga0070684_100031254 3300005535 Bacteria 4531
43 Ga0070697_100029756 3300005536 Bacteria 4382
44 Ga0070697_100315280 3300005536 Unclassified 1346
45 Ga0070697_100348133 3300005536 Bacteria 1279
46 Ga0068853_100115526 3300005539 Bacteria 2388
47 Ga0070695_100004237 3300005545 Bacteria 8395
48 Ga0070695_100008859 3300005545 Bacteria 5978
49 Ga0070696_100000306 3300005546 Bacteria 29692
50 Ga0070696_100242106 3300005546 Bacteria 1361
51 Ga0070693_100051494 3300005547 Bacteria 2358
52 Ga0070665_100003491 3300005548 Bacteria 16737
53 Ga0070665_100064747 3300005548 Bacteria 3666
54 Ga0070665_100140375 3300005548 Bacteria 2419
55 Ga0068855_100011830 3300005563 Bacteria 10549
56 Ga0070664_100025936 3300005564 Bacteria 4859
57 Ga0068857_100002806 3300005577 Bacteria 14326
58 Ga0068857_100093339 3300005577 Bacteria 2695
59 Ga0068856_100047586 3300005614 Bacteria 4225
60 Ga0068852_100276049 3300005616 Bacteria 1619
61 Ga0068859_100000758 3300005617 Bacteria 32556
62 Ga0068861_100045098 3300005719 Bacteria 3318
63 Ga0068863_100513623 3300005841 Unclassified 1181
64 Ga0068863_100789698 3300005841 Bacteria 947
65 Ga0068860_100005957 3300005843 Bacteria 12262
66 Ga0068860_100310317 3300005843 Bacteria 1546
67 Ga0068860_100347047 3300005843 Unclassified 1460
68 Ga0068862_100003289 3300005844 Bacteria 13980
69 Ga0068862_100103542 3300005844 Unclassified 2493
70 Ga0081455_10000559 3300005937 Bacteria 48458
71 Ga0081455_10003778 3300005937 Bacteria 17289
72 Ga0081538_10033689 3300005981 Bacteria 3403
73 Ga0081540_1000034 3300005983 Bacteria 142197
74 Ga0081540_1009289 3300005983 Bacteria 6783
75 Ga0081540_1036545 3300005983 Bacteria 2617
76 Ga0081540_1062561 3300005983 Bacteria 1766
77 Ga0081539_10001625 3300005985 Bacteria 36847
78 Ga0081539_10007126 3300005985 Bacteria 10325
79 Ga0075365_10017418 3300006038 Bacteria 4395
80 Ga0075365_10019493 3300006038 Bacteria 4188
81 Ga0075365_10077886 3300006038 Bacteria 2241
82 Ga0075365_10104197 3300006038 Bacteria 1945
83 Ga0075365_10273128 3300006038 Bacteria 1189
84 Ga0075368_10012691 3300006042 Bacteria 3086
85 Ga0075364_10014752 3300006051 Bacteria 4833
86 Ga0075364_10033938 3300006051 Bacteria 3289
87 Ga0075362_10035907 3300006177 Bacteria 2166
88 Ga0075362_10046256 3300006177 Bacteria 1935
89 Ga0075362_10049643 3300006177 Bacteria 1875
90 Ga0075367_10030065 3300006178 Bacteria 3111
91 Ga0075367_10058757 3300006178 Bacteria 2289
92 Ga0075367_10128229 3300006178 Unclassified 1567
93 Ga0075366_10004023 3300006195 Bacteria 7859
94 Ga0075428_100003163 3300006844 Bacteria 17988
95 Ga0075428_100025496 3300006844 Bacteria 6545
96 Ga0075430_100017713 3300006846 Bacteria 6064
97 Ga0075430_100239351 3300006846 Bacteria 1504
98 Ga0075431_100003540 3300006847 Bacteria 15121
99 Ga0075431_100008143 3300006847 Bacteria 10473
100 Ga0075433_10034716 3300006852 Bacteria 4333
101 Ga0075433_10270057 3300006852 Bacteria 1507
102 Ga0075433_10280989 3300006852 Unclassified 1475
103 Ga0075433_10532949 3300006852 Unclassified 1033
104 Ga0075434_100153388 3300006871 Unclassified 2324
105 Ga0075434_100555973 3300006871 Unclassified 1167
106 Ga0075429_100340331 3300006880 Unclassified 1313
107 Ga0068865_100292176 3300006881 Bacteria 1301
108 Ga0075436_100018938 3300006914 Bacteria 4714
109 Ga0097620_100000758 3300006931 Bacteria 32556
110 Ga0075435_100008127 3300007076 Bacteria 7515
111 Ga0105240_10054035 3300009093 Bacteria 5036
112 Ga0111539_10008126 3300009094 Bacteria 13367
113 Ga0111539_10016129 3300009094 Bacteria 9271
114 Ga0111539_10132528 3300009094 Bacteria 2918
115 Ga0111539_10403645 3300009094 Bacteria 1592
116 Ga0105245_10117296 3300009098 Bacteria 2483
117 Ga0105245_10488757 3300009098 Bacteria 1245
118 Ga0105245_10973415 3300009098 Bacteria 892
119 Ga0105247_10064661 3300009101 Unclassified 2274
120 Ga0114129_10020885 3300009147 Bacteria 9303
121 Ga0114129_10088856 3300009147 Bacteria 4284
122 Ga0114129_10322653 3300009147 Bacteria 2053
123 Ga0105241_10376712 3300009174 Bacteria 1239
124 Ga0105248_10245551 3300009177 Unclassified 2015
125 Ga0105238_10150619 3300009551 Bacteria 2301
126 Ga0105238_10390780 3300009551 Bacteria 1383
127 Ga0105249_10002183 3300009553 Bacteria 16943
128 Ga0105249_10211435 3300009553 Bacteria 1904
129 Ga0105249_10239029 3300009553 Unclassified 1795
130 Ga0105249_10545734 3300009553 Bacteria 1209
131 Ga0105239_10191751 3300010375 Bacteria 2288
132 Ga0105239_10391850 3300010375 Bacteria 1571
133 Ga0105239_10517618 3300010375 Bacteria 1357
134 Ga0157371_10291542 3300013102 Bacteria 1180
135 Ga0157370_10016281 3300013104 Bacteria 7534
136 Ga0157369_10184644 3300013105 Bacteria 2193
137 Ga0157369_10542591 3300013105 Bacteria 1202
138 Ga0157374_10429199 3300013296 Unclassified 1321
139 Ga0163162_10410480 3300013306 Bacteria 1487
140 Ga0157375_10149658 3300013308 Bacteria 2469
141 Ga0157375_10807788 3300013308 Unclassified 1086
142 Ga0157379_10128465 3300014968 Bacteria 2281
143 Ga0157379_10172011 3300014968 Bacteria 1955
144 Ga0157376_10133076 3300014969 Bacteria 2222
145 Ga0163161_10023494 3300017792 Bacteria 4349
146 Ga0206356_11442817 3300020070 Bacteria 941
147 Ga0213876_10005904 3300021384 Bacteria 6693
148 Ga0224712_10112714 3300022467 Bacteria 1169
149 Ga0224712_10120107 3300022467 Bacteria 1137
150 Ga0207426_1007004 3300025302 Bacteria 4785
151 Ga0207653_10004101 3300025885 Bacteria 4585
152 Ga0207647_10074560 3300025904 Bacteria 2043
153 Ga0207705_10022609 3300025909 Bacteria 4485
154 Ga0207705_10434885 3300025909 Bacteria 1017
155 Ga0207684_10123777 3300025910 Bacteria 2218
156 Ga0207707_10003608 3300025912 Bacteria 13718
157 Ga0207707_10052945 3300025912 Bacteria 3533
158 Ga0207707_10065270 3300025912 Bacteria 3171
159 Ga0207695_10040468 3300025913 Bacteria 4996
160 Ga0207695_10599595 3300025913 Bacteria 983
161 Ga0207693_10271292 3300025915 Unclassified 1329
162 Ga0207657_10035640 3300025919 Bacteria 4460
163 Ga0207657_10147416 3300025919 Bacteria 1919
164 Ga0207652_10202800 3300025921 Bacteria 1785
165 Ga0207646_10037609 3300025922 Bacteria 4363
166 Ga0207681_10171491 3300025923 Bacteria 1645
167 Ga0207694_10274624 3300025924 Bacteria 1383
168 Ga0207659_10020179 3300025926 Bacteria 4401
169 Ga0207687_10753656 3300025927 Bacteria 829
170 Ga0207700_10058572 3300025928 Bacteria 2910
171 Ga0207700_10207893 3300025928 Bacteria 1653
172 Ga0207644_10199243 3300025931 Bacteria 1579
173 Ga0207690_10140708 3300025932 Bacteria 1778
174 Ga0207690_10230166 3300025932 Bacteria 1422
175 Ga0207690_10436693 3300025932 Bacteria 1050
176 Ga0207709_10054041 3300025935 Bacteria 2474
177 Ga0207670_10027870 3300025936 Bacteria 3578
178 Ga0207704_10580895 3300025938 Bacteria 915
179 Ga0207665_10312039 3300025939 Bacteria 1178
180 Ga0207691_10089951 3300025940 Bacteria 2752
181 Ga0207661_10188126 3300025944 Bacteria 1808
182 Ga0207651_10503216 3300025960 Bacteria 1048
183 Ga0207651_10555182 3300025960 Bacteria 999
184 Ga0207712_10014626 3300025961 Bacteria 5053
185 Ga0207668_10066689 3300025972 Bacteria 2552
186 Ga0207668_10667853 3300025972 Bacteria 911
187 Ga0207677_10144825 3300026023 Bacteria 1824
188 Ga0207677_10215694 3300026023 Bacteria 1536
189 Ga0207678_10007695 3300026067 Bacteria 9517
190 Ga0207678_10715072 3300026067 Bacteria 882
191 Ga0207702_10014235 3300026078 Bacteria 6605
192 Ga0207702_10040096 3300026078 Bacteria 3925
193 Ga0207641_10169600 3300026088 Unclassified 1991
194 Ga0207641_10519328 3300026088 Bacteria 1158
195 Ga0207648_10293888 3300026089 Bacteria 1455
196 Ga0207674_10002061 3300026116 Bacteria 25517
197 Ga0207674_10135407 3300026116 Bacteria 2425
198 Ga0207674_10162708 3300026116 Bacteria 2186
199 Ga0207675_100140681 3300026118 Bacteria 2292
200 Ga0207698_11102001 3300026142 Unclassified 807
201 Ga0207428_10019144 3300027907 Bacteria 5837
202 Ga0268266_10070832 3300028379 Bacteria 3021
203 Ga0268266_10076592 3300028379 Bacteria 2907
204 Ga0268266_10815017 3300028379 Bacteria 902
205 Ga0268265_10005384 3300028380 Bacteria 8762
206 Ga0268264_11086086 3300028381 Unclassified 808
207 Ga0265334_10013613 3300028573 Bacteria 3404
208 Ga0265340_10004593 3300031247 Bacteria 7686
209 Ga0265340_10025575 3300031247 Bacteria 2988
210 Ga0265339_10019199 3300031249 Bacteria 4015
211 Ga0265316_10012445 3300031344 Bacteria 7629
212 Ga0307513_10213901 3300031456 Bacteria 1756
213 Ga0265313_10001114 3300031595 Bacteria 25692
214 Ga0316575_10032049 3300031665 Bacteria 2058
215 Ga0316579_10033121 3300031691 Bacteria 2371
216 Ga0265342_10011655 3300031712 Bacteria 5998
217 Ga0316578_10099721 3300031728 Bacteria 1740
218 Ga0307516_10040673 3300031730 Bacteria 4626
219 Ga0316577_10293096 3300031733 Bacteria 921
220 Ga0307409_100308859 3300031995 Bacteria 1475
221 Ga0307416_100437869 3300032002 Bacteria 1356
222 Ga0316583_10041451 3300032133 Bacteria 1629
223 Ga0316585_10017568 3300032137 Bacteria 2163
224 Ga0316592_1033264 3300033524 Bacteria 1127
225 Ga0316587_1027381 3300033529 Bacteria 997
226 Ga0373958_0008480 3300034819 Bacteria 1666
227 Ga0373958_0034509 3300034819 Bacteria 1008
228 Ga0373938_0008972 3300034957 Bacteria 1799
229 Ga0373929_0048364 3300035085 Unclassified 966
230 Ga0373940_0129880 3300035088 Unclassified 788
231 Ga0373949_0074209 3300035090 Unclassified 896
232 Ga0373952_0012631 3300035092 Unclassified 1664
233 Ga0373932_0005865 3300035112 Unclassified 2893
234 Ga0373932_0092735 3300035112 Unclassified 971
235 Ga0373941_0089431 3300035115 Bacteria 1054
236 Ga0373956_0184799 3300035119 Unclassified 986
237 Ga0373946_0189352 3300035171 Bacteria 980
238 Ga0373942_0008661 3300035207 Bacteria 2374
239 Ga0373931_0001143 3300035691 Bacteria 11279
240 Ga0373931_0005929 3300035691 Bacteria 5680
241 Ga0373931_0063333 3300035691 Bacteria 1998
242 Ga0373931_0305513 3300035691 Bacteria 984
243 Ga0373927_0102385 3300035695 Bacteria 1863
244 Ga0373927_0196153 3300035695 Bacteria 1325
245 Ga0373937_0097430 3300036401 Bacteria 2728
246 Ga0316582_0247059 3300036647 Bacteria 1222
247 Ga0316584_0180554 3300036712 Bacteria 1562
248 Ga0373925_0073932 3300037068 Bacteria 2581
249 Ga0373925_0219617 3300037068 Unclassified 1517
250 Ga0373925_0276800 3300037068 Bacteria 1351
251 Ga0395899_0001760 3300037312 Bacteria 17991
252 Ga0395899_0006200 3300037312 Bacteria 9261
253 Ga0395899_0038516 3300037312 Bacteria 3581
254 Ga0395900_0003157 3300037418 Bacteria 17863
255 Ga0395900_0004742 3300037418 Bacteria 14338
256 Ga0395900_0013753 3300037418 Bacteria 8261
257 Ga0395900_0044035 3300037418 Bacteria 4600
258 Ga0395898_0002978 3300037466 Bacteria 19251
259 Ga0395905_0275103 3300037471 Bacteria 1570
260 Ga0395901_0002132 3300038443 Bacteria 20275
261 Ga0395901_0002329 3300038443 Bacteria 19348
262 Ga0395901_0067779 3300038443 Bacteria 3717
263 Ga0400487_54173 3300039110 Bacteria 2462
264 Ga0436365_1034188 3300039437 Bacteria 34077
265 Ga0436360_0009934 3300039438 Bacteria 1008
266 Ga0436361_0862854 3300039447 Bacteria 1628
267 Ga0466963_0018767 3300044694 Bacteria 4329
268 Ga0466957_0198015 3300044842 Bacteria 1318
269 Ga0466967_0107966 3300045976 Bacteria 2553
270 Ga0495603_0084366 3300046455 Bacteria 1860
271 Ga0495590_0111988 3300046457 Unclassified 974
272 Ga0495584_0062267 3300046491 Bacteria 1875
273 Ga0495647_0224666 3300046681 Unclassified 830
274 Ga0496101_0213396 3300048904 Unclassified 1496
275 Ga0496102_0003057 3300048905 Bacteria 14173
276 Ga0496102_0852107 3300048905 Unclassified 833
277 Ga0496104_0002697 3300048907 Bacteria 15284
278 Ga0496105_0017645 3300048908 Bacteria 5726
279 Ga0496105_0205548 3300048908 Unclassified 1606
280 Ga0496106_0002107 3300048909 Bacteria 14884
281 Ga0496106_0116363 3300048909 Unclassified 2085
282 Ga0496106_0318487 3300048909 Bacteria 1248
283 Ga0496107_0005009 3300048910 Bacteria 9022
284 Ga0496107_0529597 3300048910 Unclassified 873
285 Ga0496108_0074647 3300048911 Bacteria 2864
286 Ga0496108_0150021 3300048911 Unclassified 2011
287 Ga0496108_0189080 3300048911 Bacteria 1784
288 Ga0496108_0297584 3300048911 Bacteria 1405
289 Ga0496109_0009026 3300048912 Bacteria 8493
290 Ga0496110_0000798 3300048913 Bacteria 22017
291 Ga0496110_0031990 3300048913 Bacteria 4541
292 Ga0496110_0217218 3300048913 Unclassified 1739
293 Ga0496110_0920034 3300048913 Bacteria 781
294 Ga0496111_0014600 3300048914 Bacteria 5371
295 Ga0496111_0107066 3300048914 Bacteria 2058
296 Ga0496112_0031836 3300048915 Bacteria 5118
297 Ga0496112_0112581 3300048915 Bacteria 2692
298 Ga0496112_0322203 3300048915 Unclassified 1490
299 Ga0496113_0006675 3300048916 Bacteria 7342
300 Ga0496113_0039240 3300048916 Bacteria 3485
301 Ga0496115_0017709 3300048918 Bacteria 5453
302 Ga0496115_0071269 3300048918 Bacteria 2819
303 Ga0496126_0047400 3300048929 Bacteria 3934
304 Ga0501034_0001957 3300049571 Bacteria 26076
305 Ga0501034_0002934 3300049571 Bacteria 19768
306 Ga0501034_0042247 3300049571 Bacteria 4615
307 Ga0501034_0223346 3300049571 Bacteria 1835
308 Ga0501034_0488517 3300049571 Unclassified 1146
309 Ga0501036_0210695 3300049572 Bacteria 1633
310 Ga0501036_0282725 3300049572 Bacteria 1388
311 Ga0501039_0322238 3300049575 Bacteria 1215
312 Ga0501039_0525037 3300049575 Bacteria 929
313 Ga0501040_0038801 3300049576 Bacteria 3238
314 Ga0501042_0159625 3300049578 Bacteria 1627
315 Ga0501042_0378981 3300049578 Unclassified 1024
316 Ga0501043_0160014 3300049579 Bacteria 1760
317 Ga0501046_0141430 3300049580 Bacteria 1821
318 Ga0501046_0156106 3300049580 Bacteria 1719
319 Ga0501046_0498033 3300049580 Bacteria 873
320 Ga0501047_0121637 3300049581 Unclassified 2492
321 Ga0501047_0448654 3300049581 Unclassified 1119
322 Ga0501070_0091956 3300049586 Bacteria 2511
323 Ga0501070_0131656 3300049586 Bacteria 2066
324 Ga0501073_0200056 3300049589 Bacteria 1382
325 Ga0501073_0200723 3300049589 Bacteria 1379
326 Ga0501075_0048895 3300049591 Bacteria 3178
327 Ga0501075_0383422 3300049591 Bacteria 1071
328 Ga0501076_0302262 3300049592 Unclassified 1312
329 Ga0501076_0364928 3300049592 Bacteria 1186
330 Ga0501077_0026367 3300049593 Bacteria 3688
331 Ga0501077_0084907 3300049593 Unclassified 2007
332 Ga0501077_0123976 3300049593 Bacteria 1638
333 Ga0501079_0036261 3300049741 Bacteria 3799
334 Ga0501079_0457149 3300049741 Bacteria 1003
335 Ga0501080_0174404 3300049742 Unclassified 1982
336 Ga0501081_0054376 3300049743 Bacteria 2766
337 Ga0501083_0017473 3300049744 Bacteria 5001
338 Ga0501044_0053405 3300049823 Bacteria 4158
339 Ga0501044_0053729 3300049823 Bacteria 4143
340 Ga0501044_0210048 3300049823 Bacteria 1901
341 Ga0501045_0129842 3300049824 Unclassified 1873
342 Ga0501045_0208560 3300049824 Bacteria 1455
343 nmdc:mga03683_166516_c1 3300050489 Unclassified 1000
344 nmdc:mga03683_35520_c1 3300050489 Bacteria 2022
345 nmdc:mga03683_65866_c1 3300050489 Bacteria 1539
346 nmdc:mga03n38_27109_c1 3300050490 Bacteria 2373
347 nmdc:mga03n38_348616_c1 3300050490 Bacteria 805
348 nmdc:mga00v17_3154_c1 3300050491 Bacteria 8490
349 nmdc:mga0yw44_12487_c1 3300050492 Bacteria 4431
350 nmdc:mga0yw44_147846_c1 3300050492 Bacteria 1531
351 nmdc:mga0k408_2740_c1 3300050493 Bacteria 9365
352 nmdc:mga06z11_25010_c1 3300050494 Bacteria 2824
353 nmdc:mga06z11_307492_c1 3300050494 Unclassified 944
354 nmdc:mga06z11_7805_c1 3300050494 Bacteria 4424
355 nmdc:mga06z11_8985_c1 3300050494 Bacteria 4195
356 nmdc:mga04h51_112419_c1 3300050495 Bacteria 1006
357 nmdc:mga07m45_68901_c1 3300050496 Bacteria 2011
358 nmdc:mga05p37_441939_c1 3300050507 Bacteria 1508
359 nmdc:mga05p37_630074_c1 3300050507 Unclassified 1205
360 nmdc:mga09592_332631_c1 3300050508 Unclassified 1315
361 nmdc:mga0qj67_14972_c1 3300050509 Bacteria 5867
362 nmdc:mga06r32_4445_c1 3300050510 Bacteria 12549
363 nmdc:mga06r32_8520_c1 3300050510 Bacteria 9244
364 nmdc:mga08y16_251989_c1 3300050511 Bacteria 1824
365 nmdc:mga08y16_32911_c1 3300050511 Bacteria 5449
366 nmdc:mga08y16_353352_c1 3300050511 Unclassified 1509
367 nmdc:mga08y16_457101_c1 3300050511 Bacteria 1302
368 nmdc:mga0n895_17124_c1 3300050512 Bacteria 6676
369 nmdc:mga0n895_376469_c1 3300050512 Unclassified 1437
370 nmdc:mga0rr50_167247_c1 3300050513 Unclassified 1789
371 nmdc:mga08x19_40148_c1 3300050514 Bacteria 2977
372 nmdc:mga0a205_429294_c1 3300050515 Bacteria 1183
373 nmdc:mga0a205_46109_c1 3300050515 Bacteria 4204
374 nmdc:mga0a205_64266_c1 3300050515 Bacteria 3544
375 nmdc:mga0a205_657145_c1 3300050515 Bacteria 899
376 nmdc:mga0a205_70094_c1 3300050515 Bacteria 3384
377 Ga0500644_0018998 3300053088 Bacteria 2022
378 Ga0500646_0044480 3300053090 Unclassified 1261
379 Ga0500583_0083886 3300053092 Bacteria 1543
380 Ga0500583_0166033 3300053092 Unclassified 1099
381 Ga0500641_0056849 3300053096 Unclassified 1622
382 Ga0500556_0036726 3300053104 Bacteria 1701
383 Ga0500652_048659 3300053131 Unclassified 1726
384 Ga0500552_000583 3300053733 Bacteria 3415
385 Ga0501084_0180083 3300054114 Bacteria 1784
386 Ga0587111_0030144 3300060346 Bacteria 1103
387 Ga0501082_0049510 3300060353 Bacteria 3624
388 Ga0501082_0178143 3300060353 Bacteria 1849
389 Ga0501082_0312570 3300060353 Bacteria 1368
390 Ga0530510_0080123 3300061734 Bacteria 2376
391 Ga0530510_0088425 3300061734 Bacteria 2258
392 2512034777 2511231221 Bacteria 6846400
393 2897808726 2897803580 Bacteria 7000062
394 2917555058 2917554339 Bacteria 4987857
395 8054003779 8054002106 Bacteria 7987183
396 8054565700 8054563764 Bacteria 5592885
397 Ga0501073_0000896
398 MBSR1b_contig_11937103
399 Ga0065715_10131104
400 Ga0070658_10004070
401 Ga0070690_100143387
402 Ga0068869_100081190
403 Ga0070680_100002429
404 Ga0070680_100004020
405 Ga0070680_100354019
406 Ga0070680_100651615
407 Ga0068868_100195670
408 Ga0070689_100009702
409 Ga0070689_100329077
410 Ga0070689_100501579
411 Ga0070691_10001921
412 Ga0070691_10008144
413 Ga0070691_10009985
414 Ga0070661_100031738
415 Ga0070661_100146443
416 Ga0070692_10086459
417 Ga0070669_100226202
418 Ga0070669_100290909
419 Ga0070673_100164922
420 Ga0070659_100080499
421 Ga0070703_10006756
422 Ga0070713_100019108
423 Ga0070705_100001191
424 Ga0070705_100239291
425 Ga0070705_100357086
426 Ga0070700_100003138
427 Ga0070694_100003405
428 Ga0070708_100162751
429 Ga0070708_100335977
430 Ga0070663_100692623
431 Ga0070681_10001080
432 Ga0070681_10014577
433 Ga0070681_10038983
434 Ga0070707_100328255
435 Ga0070698_100002001
436 Ga0070699_100000576
437 Ga0070679_100012577
438 Ga0070684_100031254
439 Ga0070697_100029756
440 Ga0070697_100315280
441 Ga0070697_100348133
442 Ga0068853_100115526
443 Ga0070695_100004237
444 Ga0070695_100008859
445 Ga0070696_100000306
446 Ga0070696_100242106
447 Ga0070693_100051494
448 Ga0070665_100003491
449 Ga0070665_100064747
450 Ga0070665_100140375
451 Ga0068855_100011830
452 Ga0070664_100025936
453 Ga0068857_100002806
454 Ga0068857_100093339
455 Ga0068856_100047586
456 Ga0068852_100276049
457 Ga0068859_100000758
458 Ga0068861_100045098
459 Ga0068863_100513623
460 Ga0068863_100789698
461 Ga0068860_100005957
462 Ga0068860_100310317
463 Ga0068860_100347047
464 Ga0068862_100003289
465 Ga0068862_100103542
466 Ga0081455_10000559
467 Ga0081455_10003778
468 Ga0081538_10033689
469 Ga0081540_1000034
470 Ga0081540_1009289
471 Ga0081540_1036545
472 Ga0081540_1062561
473 Ga0081539_10001625
474 Ga0081539_10007126
475 Ga0075365_10017418
476 Ga0075365_10019493
477 Ga0075365_10077886
478 Ga0075365_10104197
479 Ga0075365_10273128
480 Ga0075368_10012691
481 Ga0075364_10014752
482 Ga0075364_10033938
483 Ga0075362_10035907
484 Ga0075362_10046256
485 Ga0075362_10049643
486 Ga0075367_10030065
487 Ga0075367_10058757
488 Ga0075367_10128229
489 Ga0075366_10004023
490 Ga0075428_100003163
491 Ga0075428_100025496
492 Ga0075430_100017713
493 Ga0075430_100239351
494 Ga0075431_100003540
495 Ga0075431_100008143
496 Ga0075433_10034716
497 Ga0075433_10270057
498 Ga0075433_10280989
499 Ga0075433_10532949
500 Ga0075434_100153388
501 Ga0075434_100555973
502 Ga0075429_100340331
503 Ga0068865_100292176
504 Ga0075436_100018938
505 Ga0097620_100000758
506 Ga0075435_100008127
507 Ga0105240_10054035
508 Ga0111539_10008126
509 Ga0111539_10016129
510 Ga0111539_10132528
511 Ga0111539_10403645
512 Ga0105245_10117296
513 Ga0105245_10488757
514 Ga0105245_10973415
515 Ga0105247_10064661
516 Ga0114129_10020885
517 Ga0114129_10088856
518 Ga0114129_10322653
519 Ga0105241_10376712
520 Ga0105248_10245551
521 Ga0105238_10150619
522 Ga0105238_10390780
523 Ga0105249_10002183
524 Ga0105249_10211435
525 Ga0105249_10239029
526 Ga0105249_10545734
527 Ga0105239_10191751
528 Ga0105239_10391850
529 Ga0105239_10517618
530 Ga0157371_10291542
531 Ga0157370_10016281
532 Ga0157369_10184644
533 Ga0157369_10542591
534 Ga0157374_10429199
535 Ga0163162_10410480
536 Ga0157375_10149658
537 Ga0157375_10807788
538 Ga0157379_10128465
539 Ga0157379_10172011
540 Ga0157376_10133076
541 Ga0163161_10023494
542 Ga0206356_11442817
543 Ga0213876_10005904
544 Ga0224712_10112714
545 Ga0224712_10120107
546 Ga0207426_1007004
547 Ga0207653_10004101
548 Ga0207647_10074560
549 Ga0207705_10022609
550 Ga0207705_10434885
551 Ga0207684_10123777
552 Ga0207707_10003608
553 Ga0207707_10052945
554 Ga0207707_10065270
555 Ga0207695_10040468
556 Ga0207695_10599595
557 Ga0207693_10271292
558 Ga0207657_10035640
559 Ga0207657_10147416
560 Ga0207652_10202800
561 Ga0207646_10037609
562 Ga0207681_10171491
563 Ga0207694_10274624
564 Ga0207659_10020179
565 Ga0207687_10753656
566 Ga0207700_10058572
567 Ga0207700_10207893
568 Ga0207644_10199243
569 Ga0207690_10140708
570 Ga0207690_10230166
571 Ga0207690_10436693
572 Ga0207709_10054041
573 Ga0207670_10027870
574 Ga0207704_10580895
575 Ga0207665_10312039
576 Ga0207691_10089951
577 Ga0207661_10188126
578 Ga0207651_10503216
579 Ga0207651_10555182
580 Ga0207712_10014626
581 Ga0207668_10066689
582 Ga0207668_10667853
583 Ga0207677_10144825
584 Ga0207677_10215694
585 Ga0207678_10007695
586 Ga0207678_10715072
587 Ga0207702_10014235
588 Ga0207702_10040096
589 Ga0207641_10169600
590 Ga0207641_10519328
591 Ga0207648_10293888
592 Ga0207674_10002061
593 Ga0207674_10135407
594 Ga0207674_10162708
595 Ga0207675_100140681
596 Ga0207698_11102001
597 Ga0207428_10019144
598 Ga0268266_10070832
599 Ga0268266_10076592
600 Ga0268266_10815017
601 Ga0268265_10005384
602 Ga0268264_11086086
603 Ga0265334_10013613
604 Ga0265340_10004593
605 Ga0265340_10025575
606 Ga0265339_10019199
607 Ga0265316_10012445
608 Ga0307513_10213901
609 Ga0265313_10001114
610 Ga0316575_10032049
611 Ga0316579_10033121
612 Ga0265342_10011655
613 Ga0316578_10099721
614 Ga0307516_10040673
615 Ga0316577_10293096
616 Ga0307409_100308859
617 Ga0307416_100437869
618 Ga0316583_10041451
619 Ga0316585_10017568
620 Ga0316592_1033264
621 Ga0316587_1027381
622 Ga0373958_0008480
623 Ga0373958_0034509
624 Ga0373938_0008972
625 Ga0373929_0048364
626 Ga0373940_0129880
627 Ga0373949_0074209
628 Ga0373952_0012631
629 Ga0373932_0005865
630 Ga0373932_0092735
631 Ga0373941_0089431
632 Ga0373956_0184799
633 Ga0373946_0189352
634 Ga0373942_0008661
635 Ga0373931_0001143
636 Ga0373931_0005929
637 Ga0373931_0063333
638 Ga0373931_0305513
639 Ga0373927_0102385
640 Ga0373927_0196153
641 Ga0373937_0097430
642 Ga0316582_0247059
643 Ga0316584_0180554
644 Ga0373925_0073932
645 Ga0373925_0219617
646 Ga0373925_0276800
647 Ga0395899_0001760
648 Ga0395899_0006200
649 Ga0395899_0038516
650 Ga0395900_0003157
651 Ga0395900_0004742
652 Ga0395900_0013753
653 Ga0395900_0044035
654 Ga0395898_0002978
655 Ga0395905_0275103
656 Ga0395901_0002132
657 Ga0395901_0002329
658 Ga0395901_0067779
659 Ga0400487_54173
660 Ga0436365_1034188
661 Ga0436360_0009934
662 Ga0436361_0862854
663 Ga0466963_0018767
664 Ga0466957_0198015
665 Ga0466967_0107966
666 Ga0495603_0084366
667 Ga0495590_0111988
668 Ga0495584_0062267
669 Ga0495647_0224666
670 Ga0496101_0213396
671 Ga0496102_0003057
672 Ga0496102_0852107
673 Ga0496104_0002697
674 Ga0496105_0017645
675 Ga0496105_0205548
676 Ga0496106_0002107
677 Ga0496106_0116363
678 Ga0496106_0318487
679 Ga0496107_0005009
680 Ga0496107_0529597
681 Ga0496108_0074647
682 Ga0496108_0150021
683 Ga0496108_0189080
684 Ga0496108_0297584
685 Ga0496109_0009026
686 Ga0496110_0000798
687 Ga0496110_0031990
688 Ga0496110_0217218
689 Ga0496110_0920034
690 Ga0496111_0014600
691 Ga0496111_0107066
692 Ga0496112_0031836
693 Ga0496112_0112581
694 Ga0496112_0322203
695 Ga0496113_0006675
696 Ga0496113_0039240
697 Ga0496115_0017709
698 Ga0496115_0071269
699 Ga0496126_0047400
700 Ga0501034_0001957
701 Ga0501034_0002934
702 Ga0501034_0042247
703 Ga0501034_0223346
704 Ga0501034_0488517
705 Ga0501036_0210695
706 Ga0501036_0282725
707 Ga0501039_0322238
708 Ga0501039_0525037
709 Ga0501040_0038801
710 Ga0501042_0159625
711 Ga0501042_0378981
712 Ga0501043_0160014
713 Ga0501046_0141430
714 Ga0501046_0156106
715 Ga0501046_0498033
716 Ga0501047_0121637
717 Ga0501047_0448654
718 Ga0501070_0091956
719 Ga0501070_0131656
720 Ga0501073_0200056
721 Ga0501073_0200723
722 Ga0501075_0048895
723 Ga0501075_0383422
724 Ga0501076_0302262
725 Ga0501076_0364928
726 Ga0501077_0026367
727 Ga0501077_0084907
728 Ga0501077_0123976
729 Ga0501079_0036261
730 Ga0501079_0457149
731 Ga0501080_0174404
732 Ga0501081_0054376
733 Ga0501083_0017473
734 Ga0501044_0053405
735 Ga0501044_0053729
736 Ga0501044_0210048
737 Ga0501045_0129842
738 Ga0501045_0208560
739 nmdc:mga03683_166516_c1
740 nmdc:mga03683_35520_c1
741 nmdc:mga03683_65866_c1
742 nmdc:mga03n38_27109_c1
743 nmdc:mga03n38_348616_c1
744 nmdc:mga00v17_3154_c1
745 nmdc:mga0yw44_12487_c1
746 nmdc:mga0yw44_147846_c1
747 nmdc:mga0k408_2740_c1
748 nmdc:mga06z11_25010_c1
749 nmdc:mga06z11_307492_c1
750 nmdc:mga06z11_7805_c1
751 nmdc:mga06z11_8985_c1
752 nmdc:mga04h51_112419_c1
753 nmdc:mga07m45_68901_c1
754 nmdc:mga05p37_441939_c1
755 nmdc:mga05p37_630074_c1
756 nmdc:mga09592_332631_c1
757 nmdc:mga0qj67_14972_c1
758 nmdc:mga06r32_4445_c1
759 nmdc:mga06r32_8520_c1
760 nmdc:mga08y16_251989_c1
761 nmdc:mga08y16_32911_c1
762 nmdc:mga08y16_353352_c1
763 nmdc:mga08y16_457101_c1
764 nmdc:mga0n895_17124_c1
765 nmdc:mga0n895_376469_c1
766 nmdc:mga0rr50_167247_c1
767 nmdc:mga08x19_40148_c1
768 nmdc:mga0a205_429294_c1
769 nmdc:mga0a205_46109_c1
770 nmdc:mga0a205_64266_c1
771 nmdc:mga0a205_657145_c1
772 nmdc:mga0a205_70094_c1
773 Ga0500644_0018998
774 Ga0500646_0044480
775 Ga0500583_0083886
776 Ga0500583_0166033
777 Ga0500641_0056849
778 Ga0500556_0036726
779 Ga0500652_048659
780 Ga0500552_000583
781 Ga0501084_0180083
782 Ga0587111_0030144
783 Ga0501082_0049510
784 Ga0501082_0178143
785 Ga0501082_0312570
786 Ga0530510_0080123
787 Ga0530510_0088425
788 2512034777
789 2897808726
790 2917555058
791 8054003779
792 8054565700

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04280

Tim44

Tim44-like domain

139

285

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cw9-assembly1.cif.gz_A crystal structure of human tim44 c-terminal domain 0.8502 91 239
6nu3-assembly1.cif.gz_d structural insights into unique features of the human mitochondrial ribosome recycling 0.8424 91 240
4ce4-assembly1.cif.gz_i 39s large subunit of the porcine mitochondrial ribosome 0.8374 90 239
7qh6-assembly1.cif.gz_d cryo-em structure of the human mtlsu assembly intermediate upon mrm2 depletion - class 1 0.8256 86 239
7ods-assembly1.cif.gz_d state b of the human mitoribosomal large subunit assembly intermediate 0.8106 81 239
ID Description Score Start End Superfamily
af_Q8GXP7_158_313_3.10.450.240 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8975 92 239 3.10.450.240
af_O02161_236_422_3.10.450.240 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8929 91 239 3.10.450.240
3j7yd00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8566 91 240 3.10.450.240
af_Q1PF33_284_473_3.10.450.240 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8491 88 237 3.10.450.240
af_Q8GXP7_158_313_3.10.450.240 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.849 92 239 3.10.450.240
ID Description Score Start End GO Terms
AF-A0A522WFA1-F1-model_v4 Tim44 domain-containing protein 0.9996 114 240
AF-A0A4R5XK26-F1-model_v4 deleted 0.9905 105 240
AF-D5RNY5-F1-model_v4 Tim44-like domain protein 0.9841 85 239 GO:0005840
GO:1990904
AF-A0A4R5XK26-F1-model_v4 deleted 0.9833 105 240
AF-A0A520HWE3-F1-model_v4 Tim44 domain-containing protein 0.978 112 239

Map