F433607

General Info

Members Datasets Scaffolds Average Seq Length
396 234 792 254

Family's Representative Sequence

Representative Sequence 3300047318|Ga0495636_0022666|Ga0495636_0022666_1591_2337
Length 248
Sequence MDSSLRVYWRQGCSSCVKVKEYLTGIGVDFESIDVGVRPQAMAELAEMGVRTVPVVARGKEYVFAQALEDVSKFIGFEYRISRLPPEVLVQKWLKVLAAAQRHALQIPRERLGERATPGRDRSIRDLAYHVYQVPESFLECVENGAEDLTAIYNASPPPNAQIAPYGKAIHARLEAWWSRLPDKSCKQTVKTYYGERPLHELLERCAWHSAQHARQIVSVLEGFGIAAQPLLTDADYAGLPMPKGLWA

Samples

Sample ID Description Type Environment
1 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
63 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
119 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
120 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
121 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
122 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
123 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
124 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
125 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
126 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
127 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
128 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
129 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
130 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
131 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
132 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
133 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
134 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
135 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
136 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
137 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
139 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
140 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
143 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
144 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
145 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
146 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
147 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
148 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
149 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
150 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
151 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
152 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
153 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
154 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
155 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
156 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
157 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
158 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
159 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
160 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
161 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
162 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
163 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
164 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
165 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
166 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
167 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
168 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
169 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
170 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
171 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
172 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
173 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
174 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
175 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
176 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
177 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
178 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
179 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
180 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
181 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
182 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
183 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
184 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
185 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
186 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
187 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
188 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
189 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
190 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
191 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
194 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
207 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
208 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
209 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
210 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
211 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
212 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
213 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
214 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
215 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
216 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
217 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
218 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
221 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
222 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
223 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
224 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
227 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
228 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
229 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
230 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
231 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
232 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
233 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
234 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.25
Rhizosphere 99.75
Stem 0
Stem Tuber 0
Unclassified 11.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495636_0022666 3300047318 Bacteria 2540
2 Ga0070690_100000860 3300005330 Bacteria 15413
3 Ga0070690_100440084 3300005330 Bacteria 965
4 Ga0068869_100000089 3300005334 Bacteria 41752
5 Ga0070680_100000992 3300005336 Bacteria 20153
6 Ga0068868_100007574 3300005338 Bacteria 7734
7 Ga0070689_100000185 3300005340 Bacteria 37751
8 Ga0070689_100082455 3300005340 Unclassified 2526
9 Ga0070691_10001436 3300005341 Bacteria 10189
10 Ga0070691_10207758 3300005341 Unclassified 1032
11 Ga0070687_100000160 3300005343 Bacteria 23224
12 Ga0070687_100054387 3300005343 Bacteria 2086
13 Ga0070692_10002405 3300005345 Bacteria 7251
14 Ga0070692_10011938 3300005345 Bacteria 4005
15 Ga0070692_10063244 3300005345 Bacteria 1955
16 Ga0070668_100242427 3300005347 Bacteria 1494
17 Ga0070669_100173487 3300005353 Unclassified 1682
18 Ga0070673_100056516 3300005364 Bacteria 3097
19 Ga0070688_100109768 3300005365 Unclassified 1833
20 Ga0070667_100337983 3300005367 Bacteria 1361
21 Ga0070709_10538601 3300005434 Unclassified 892
22 Ga0070701_10000744 3300005438 Bacteria 11554
23 Ga0070705_100003688 3300005440 Bacteria 7497
24 Ga0070700_100001045 3300005441 Bacteria 13706
25 Ga0070700_100012040 3300005441 Bacteria 4808
26 Ga0070694_100000089 3300005444 Bacteria 43372
27 Ga0070694_100001912 3300005444 Bacteria 12332
28 Ga0070694_100132841 3300005444 Bacteria 1800
29 Ga0070694_100284406 3300005444 Unclassified 1262
30 Ga0070708_100260789 3300005445 Bacteria 1629
31 Ga0070708_100408964 3300005445 Bacteria 1280
32 Ga0070678_100564507 3300005456 Bacteria 1012
33 Ga0070681_10005559 3300005458 Bacteria 12177
34 Ga0070681_10110748 3300005458 Bacteria 2685
35 Ga0068867_100001296 3300005459 Bacteria 17265
36 Ga0068867_100385730 3300005459 Bacteria 1178
37 Ga0070707_100343532 3300005468 Bacteria 1450
38 Ga0070707_100445794 3300005468 Bacteria 1255
39 Ga0070698_100129862 3300005471 Bacteria 2476
40 Ga0070699_100055177 3300005518 Bacteria 3440
41 Ga0070699_100527702 3300005518 Bacteria 1074
42 Ga0070679_100002498 3300005530 Bacteria 16660
43 Ga0070679_100159538 3300005530 Bacteria 2230
44 Ga0070697_100067867 3300005536 Bacteria 2918
45 Ga0070697_100177513 3300005536 Bacteria 1804
46 Ga0068853_100024767 3300005539 Bacteria 5035
47 Ga0070686_100001902 3300005544 Bacteria 11616
48 Ga0070686_100123952 3300005544 Bacteria 1778
49 Ga0070695_100007392 3300005545 Bacteria 6516
50 Ga0070695_100010068 3300005545 Bacteria 5640
51 Ga0070695_100412146 3300005545 Unclassified 1027
52 Ga0070696_100000077 3300005546 Bacteria 48139
53 Ga0070696_100003096 3300005546 Bacteria 11066
54 Ga0070696_100040538 3300005546 Bacteria 3215
55 Ga0070696_100149845 3300005546 Bacteria 1711
56 Ga0070693_100000125 3300005547 Bacteria 34456
57 Ga0070704_100000051 3300005549 Bacteria 37969
58 Ga0070704_100000480 3300005549 Bacteria 18895
59 Ga0070704_100008297 3300005549 Bacteria 6220
60 Ga0070704_100059222 3300005549 Bacteria 2731
61 Ga0070704_100154945 3300005549 Bacteria 1806
62 Ga0068855_100000741 3300005563 Bacteria 40118
63 Ga0068854_100033159 3300005578 Bacteria 3599
64 Ga0070702_100000279 3300005615 Bacteria 17421
65 Ga0070702_100558726 3300005615 Unclassified 851
66 Ga0068852_100058867 3300005616 Bacteria 3330
67 Ga0068859_100007511 3300005617 Bacteria 11063
68 Ga0068859_100015490 3300005617 Bacteria 7662
69 Ga0068864_100101567 3300005618 Bacteria 2551
70 Ga0068866_10001003 3300005718 Bacteria 12396
71 Ga0068866_10186329 3300005718 Unclassified 1230
72 Ga0068861_100002682 3300005719 Bacteria 11658
73 Ga0068861_100021552 3300005719 Bacteria 4632
74 Ga0068870_10268567 3300005840 Bacteria 1064
75 Ga0068863_100755130 3300005841 Unclassified 969
76 Ga0068858_100063743 3300005842 Bacteria 3410
77 Ga0068860_100000810 3300005843 Bacteria 34973
78 Ga0068862_100000622 3300005844 Bacteria 36814
79 Ga0068862_100005219 3300005844 Bacteria 10912
80 Ga0068862_100139158 3300005844 Bacteria 2154
81 Ga0081539_10000805 3300005985 Bacteria 61020
82 Ga0070715_10083645 3300006163 Bacteria 1454
83 Ga0097621_100001434 3300006237 Bacteria 16354
84 Ga0068871_100000440 3300006358 Bacteria 28666
85 Ga0075428_100003445 3300006844 Bacteria 17311
86 Ga0075428_100057307 3300006844 Bacteria 4265
87 Ga0075428_100121756 3300006844 Bacteria 2841
88 Ga0075430_100002837 3300006846 Bacteria 14495
89 Ga0075430_100003773 3300006846 Bacteria 12731
90 Ga0075430_100121687 3300006846 Bacteria 2176
91 Ga0075430_100142921 3300006846 Bacteria 1993
92 Ga0075431_100045189 3300006847 Bacteria 4541
93 Ga0075431_100048708 3300006847 Bacteria 4370
94 Ga0075431_100269656 3300006847 Unclassified 1725
95 Ga0075431_100714048 3300006847 Bacteria 979
96 Ga0075433_10005345 3300006852 Bacteria 10080
97 Ga0075433_10112899 3300006852 Bacteria 2411
98 Ga0075434_100002423 3300006871 Bacteria 16386
99 Ga0075434_100010683 3300006871 Bacteria 8620
100 Ga0075429_100000003 3300006880 Bacteria 130377
101 Ga0075429_100000096 3300006880 Bacteria 47975
102 Ga0075429_100056132 3300006880 Bacteria 3427
103 Ga0068865_100000149 3300006881 Bacteria 37769
104 Ga0068865_100028039 3300006881 Bacteria 3726
105 Ga0075436_100000043 3300006914 Bacteria 77110
106 Ga0075436_100000816 3300006914 Bacteria 20743
107 Ga0075436_100004534 3300006914 Bacteria 9520
108 Ga0075436_100025161 3300006914 Bacteria 4093
109 Ga0075436_100034512 3300006914 Bacteria 3489
110 Ga0075436_100058957 3300006914 Bacteria 2652
111 Ga0097620_100007512 3300006931 Bacteria 11063
112 Ga0097620_100015490 3300006931 Bacteria 7662
113 Ga0075435_100000068 3300007076 Bacteria 53336
114 Ga0075435_100000774 3300007076 Bacteria 19816
115 Ga0075435_100010857 3300007076 Bacteria 6670
116 Ga0075435_100045058 3300007076 Bacteria 3534
117 Ga0075435_100074708 3300007076 Unclassified 2774
118 Ga0099794_10073008 3300007265 Bacteria 1683
119 Ga0105250_10021177 3300009092 Bacteria 2624
120 Ga0111539_10023985 3300009094 Bacteria 7494
121 Ga0111539_10024737 3300009094 Bacteria 7365
122 Ga0111539_10077883 3300009094 Bacteria 3901
123 Ga0111539_10137085 3300009094 Unclassified 2866
124 Ga0105245_10001124 3300009098 Bacteria 24188
125 Ga0105245_10749392 3300009098 Unclassified 1012
126 Ga0114129_10001405 3300009147 Bacteria 32472
127 Ga0114129_10023255 3300009147 Bacteria 8790
128 Ga0105243_10000577 3300009148 Bacteria 36910
129 Ga0105243_10205669 3300009148 Unclassified 1730
130 Ga0105241_10008104 3300009174 Bacteria 7732
131 Ga0105242_10001480 3300009176 Bacteria 18493
132 Ga0105242_10275316 3300009176 Bacteria 1526
133 Ga0105249_10017288 3300009553 Bacteria 6402
134 Ga0105249_10021434 3300009553 Bacteria 5785
135 Ga0105239_10051205 3300010375 Bacteria 4527
136 Ga0157378_10000498 3300013297 Bacteria 37271
137 Ga0157378_10971539 3300013297 Bacteria 883
138 Ga0163162_10197928 3300013306 Bacteria 2138
139 Ga0157375_11151166 3300013308 Unclassified 909
140 Ga0157380_10046125 3300014326 Bacteria 3422
141 Ga0157380_10185303 3300014326 Bacteria 1833
142 Ga0157376_10002186 3300014969 Bacteria 13177
143 Ga0207653_10042380 3300025885 Bacteria 1497
144 Ga0207682_10151853 3300025893 Bacteria 1045
145 Ga0207642_10000463 3300025899 Bacteria 12412
146 Ga0207642_10051190 3300025899 Bacteria 1867
147 Ga0207685_10120131 3300025905 Bacteria 1152
148 Ga0207645_10045857 3300025907 Bacteria 2792
149 Ga0207654_10007411 3300025911 Bacteria 5526
150 Ga0207707_10013285 3300025912 Bacteria 7176
151 Ga0207707_10085380 3300025912 Bacteria 2758
152 Ga0207660_10003278 3300025917 Bacteria 10582
153 Ga0207660_10017474 3300025917 Bacteria 4767
154 Ga0207660_10098968 3300025917 Bacteria 2176
155 Ga0207662_10000099 3300025918 Bacteria 40931
156 Ga0207662_10043027 3300025918 Bacteria 2664
157 Ga0207662_10097175 3300025918 Bacteria 1820
158 Ga0207646_10536644 3300025922 Bacteria 1052
159 Ga0207646_10682143 3300025922 Bacteria 919
160 Ga0207659_10183364 3300025926 Bacteria 1660
161 Ga0207687_10003548 3300025927 Bacteria 10494
162 Ga0207664_10103906 3300025929 Bacteria 2352
163 Ga0207706_10398025 3300025933 Bacteria 1194
164 Ga0207686_10000295 3300025934 Bacteria 36702
165 Ga0207709_10001189 3300025935 Bacteria 18792
166 Ga0207709_10063932 3300025935 Bacteria 2308
167 Ga0207670_10010662 3300025936 Bacteria 5303
168 Ga0207669_10129685 3300025937 Bacteria 1730
169 Ga0207704_10000643 3300025938 Bacteria 15451
170 Ga0207704_10050518 3300025938 Bacteria 2509
171 Ga0207691_10160007 3300025940 Unclassified 1976
172 Ga0207689_10000432 3300025942 Bacteria 39235
173 Ga0207689_10050122 3300025942 Bacteria 3443
174 Ga0207667_10002062 3300025949 Bacteria 25186
175 Ga0207651_10045273 3300025960 Bacteria 2950
176 Ga0207651_10276786 3300025960 Bacteria 1385
177 Ga0207712_10002597 3300025961 Bacteria 11596
178 Ga0207640_10023009 3300025981 Bacteria 3740
179 Ga0207677_10000957 3300026023 Bacteria 16029
180 Ga0207677_10180317 3300026023 Bacteria 1661
181 Ga0207708_10000412 3300026075 Bacteria 33576
182 Ga0207708_10007535 3300026075 Bacteria 8049
183 Ga0207702_10029400 3300026078 Bacteria 4572
184 Ga0207702_10131830 3300026078 Bacteria 2250
185 Ga0207648_10000603 3300026089 Bacteria 40455
186 Ga0207648_10012950 3300026089 Bacteria 7790
187 Ga0207648_10338002 3300026089 Bacteria 1356
188 Ga0207675_100000509 3300026118 Bacteria 37679
189 Ga0207675_100110938 3300026118 Bacteria 2588
190 Ga0207683_10124211 3300026121 Bacteria 2319
191 Ga0209969_1007639 3300027360 Unclassified 1528
192 Ga0209968_1002814 3300027526 Bacteria 2610
193 Ga0209970_1006991 3300027614 Unclassified 1851
194 Ga0209966_1008941 3300027695 Unclassified 1784
195 Ga0207428_10001841 3300027907 Bacteria 21679
196 Ga0207428_10155261 3300027907 Bacteria 1741
197 Ga0268265_10002203 3300028380 Bacteria 15024
198 Ga0268265_10133029 3300028380 Bacteria 2070
199 Ga0268264_10003270 3300028381 Bacteria 14013
200 Ga0307408_100050978 3300031548 Bacteria 2979
201 Ga0307412_10411121 3300031911 Unclassified 1104
202 Ga0307412_10461651 3300031911 Bacteria 1049
203 Ga0307416_100228298 3300032002 Bacteria 1792
204 Ga0307416_100649219 3300032002 Bacteria 1140
205 Ga0307411_10254469 3300032005 Bacteria 1383
206 Ga0373930_0005803 3300034816 Bacteria 2065
207 Ga0373958_0045258 3300034819 Bacteria 913
208 Ga0373959_0049439 3300034820 Unclassified 904
209 Ga0373928_0012114 3300035084 Bacteria 1716
210 Ga0373929_0036574 3300035085 Bacteria 1073
211 Ga0373940_0001634 3300035088 Bacteria 4122
212 Ga0373944_0012505 3300035089 Bacteria 2340
213 Ga0373949_0006588 3300035090 Bacteria 2553
214 Ga0373951_0016354 3300035091 Unclassified 1673
215 Ga0373932_0002213 3300035112 Bacteria 5003
216 Ga0373941_0006620 3300035115 Bacteria 2799
217 Ga0373945_0004380 3300035116 Bacteria 4483
218 Ga0373954_0000051 3300035118 Bacteria 41728
219 Ga0373943_0032543 3300035170 Bacteria 2479
220 Ga0373946_0008822 3300035171 Bacteria 3701
221 Ga0373946_0021798 3300035171 Bacteria 2487
222 Ga0373942_0017614 3300035207 Bacteria 1763
223 Ga0373924_0224018 3300035410 Bacteria 831
224 Ga0373931_0000606 3300035691 Bacteria 14835
225 Ga0373931_0002156 3300035691 Bacteria 8667
226 Ga0373931_0063315 3300035691 Bacteria 1999
227 Ga0373931_0137750 3300035691 Unclassified 1411
228 Ga0373935_0659068 3300035692 Bacteria 768
229 Ga0373927_0009081 3300035695 Bacteria 6671
230 Ga0373927_0106649 3300035695 Bacteria 1824
231 Ga0373933_0012201 3300035724 Bacteria 4747
232 Ga0373933_0030157 3300035724 Bacteria 3140
233 Ga0373947_0024203 3300035725 Bacteria 3536
234 Ga0373947_0094958 3300035725 Bacteria 1865
235 Ga0373937_0000342 3300036401 Bacteria 44059
236 Ga0373937_0056374 3300036401 Bacteria 3609
237 Ga0242420_024609 3300038996 Unclassified 1091
238 Ga0439441_002439 3300042001 Bacteria 2621
239 Ga0439441_011635 3300042001 Bacteria 1495
240 Ga0439434_0086178 3300042435 Unclassified 1001
241 Ga0439435_0000668 3300042436 Bacteria 5670
242 Ga0439435_0001348 3300042436 Bacteria 4489
243 Ga0439444_0025139 3300042437 Bacteria 1081
244 Ga0439460_0000216 3300042461 Bacteria 11473
245 Ga0450893_0029882 3300042532 Bacteria 968
246 Ga0451577_0118971 3300042876 Bacteria 2366
247 Ga0451577_0656266 3300042876 Unclassified 951
248 Ga0453683_0536095 3300044673 Bacteria 761
249 Ga0466964_0081346 3300044706 Bacteria 1391
250 Ga0453684_0860594 3300044712 Unclassified 974
251 Ga0466957_0134253 3300044842 Bacteria 1589
252 Ga0451576_0000927 3300045051 Bacteria 55291
253 Ga0451576_0021100 3300045051 Bacteria 7081
254 Ga0451576_0037035 3300045051 Bacteria 5169
255 Ga0451576_0074076 3300045051 Bacteria 3543
256 Ga0466967_0000937 3300045976 Bacteria 15706
257 Ga0495592_0027321 3300046454 Bacteria 4327
258 Ga0495629_0092421 3300046459 Unclassified 2112
259 Ga0495653_0030445 3300046463 Bacteria 4300
260 Ga0495580_0041692 3300046472 Bacteria 3272
261 Ga0495582_0038283 3300046473 Bacteria 2639
262 Ga0495662_0019911 3300046476 Bacteria 3246
263 Ga0495594_0124994 3300046499 Bacteria 1455
264 Ga0495608_0006417 3300046511 Bacteria 8353
265 Ga0495618_0011787 3300046514 Bacteria 5306
266 Ga0495628_0004697 3300046516 Bacteria 12045
267 Ga0495630_0008819 3300046517 Bacteria 7239
268 Ga0495644_0137693 3300046523 Bacteria 932
269 Ga0495666_0016089 3300046526 Bacteria 3724
270 Ga0495666_0087885 3300046526 Unclassified 1468
271 Ga0495665_0064082 3300046531 Bacteria 1940
272 Ga0495640_0000332 3300046533 Bacteria 32858
273 Ga0495640_0027944 3300046533 Bacteria 4064
274 Ga0495586_0008677 3300046535 Bacteria 5411
275 Ga0495586_0086422 3300046535 Bacteria 1728
276 Ga0495586_0116977 3300046535 Bacteria 1487
277 Ga0495587_0037826 3300046536 Bacteria 2895
278 Ga0495598_0006785 3300046537 Bacteria 2598
279 Ga0495645_0069099 3300046543 Bacteria 2550
280 Ga0495656_0099171 3300046615 Bacteria 1344
281 Ga0495635_0019518 3300046663 Bacteria 4724
282 Ga0495659_0042888 3300046664 Unclassified 1621
283 Ga0495588_0002847 3300046674 Bacteria 7443
284 Ga0495599_0014670 3300046678 Bacteria 4852
285 Ga0495599_0241679 3300046678 Bacteria 1101
286 Ga0495647_0001995 3300046681 Bacteria 6370
287 Ga0495658_0009683 3300046683 Bacteria 4805
288 Ga0495669_0080294 3300046684 Bacteria 1496
289 Ga0495613_0003316 3300046689 Bacteria 12057
290 Ga0495624_0026589 3300046690 Bacteria 3791
291 Ga0495600_0035410 3300046809 Bacteria 3242
292 Ga0495600_0315124 3300046809 Bacteria 985
293 Ga0495604_0019055 3300047317 Bacteria 5496
294 Ga0495636_0137679 3300047318 Bacteria 1089
295 Ga0495674_0272312 3300047319 Unclassified 1389
296 Ga0495674_0414531 3300047319 Bacteria 1086
297 Ga0495676_0119737 3300047321 Bacteria 1917
298 Ga0495680_0002093 3300047322 Bacteria 20735
299 Ga0495680_0243004 3300047322 Unclassified 1278
300 Ga0495677_0057753 3300047445 Bacteria 1435
301 Ga0495593_0044966 3300047673 Bacteria 2359
302 Ga0496106_0099281 3300048909 Bacteria 2257
303 Ga0501299_039573 3300049522 Unclassified 941
304 Ga0501031_0008501 3300049568 Bacteria 6681
305 Ga0501033_0002807 3300049570 Bacteria 14574
306 Ga0501033_0345567 3300049570 Bacteria 1043
307 Ga0501036_0006830 3300049572 Bacteria 9271
308 Ga0501036_0350769 3300049572 Bacteria 1232
309 Ga0501037_0293622 3300049573 Bacteria 1130
310 Ga0501038_0004659 3300049574 Bacteria 12770
311 Ga0501039_0003726 3300049575 Bacteria 11447
312 Ga0501039_0153450 3300049575 Bacteria 1809
313 Ga0501040_0004351 3300049576 Bacteria 9208
314 Ga0501040_0005522 3300049576 Bacteria 8189
315 Ga0501040_0066782 3300049576 Bacteria 2478
316 Ga0501041_0003195 3300049577 Bacteria 9427
317 Ga0501041_0009565 3300049577 Bacteria 5715
318 Ga0501041_0010109 3300049577 Bacteria 5560
319 Ga0501042_0042579 3300049578 Bacteria 3233
320 Ga0501042_0046337 3300049578 Bacteria 3099
321 Ga0501042_0095060 3300049578 Unclassified 2140
322 Ga0501042_0136041 3300049578 Bacteria 1772
323 Ga0501042_0181856 3300049578 Bacteria 1517
324 Ga0501046_0098565 3300049580 Unclassified 2244
325 Ga0501046_0101125 3300049580 Bacteria 2212
326 Ga0501047_0155307 3300049581 Bacteria 2162
327 Ga0501048_0005623 3300049582 Bacteria 9534
328 Ga0501068_0035287 3300049584 Bacteria 2984
329 Ga0501070_0495152 3300049586 Bacteria 982
330 Ga0501071_0072844 3300049587 Bacteria 2505
331 Ga0501072_0007323 3300049588 Bacteria 8371
332 Ga0501072_0011067 3300049588 Bacteria 6884
333 Ga0501072_0055717 3300049588 Bacteria 3115
334 Ga0501072_0314412 3300049588 Bacteria 1245
335 Ga0501072_0482081 3300049588 Bacteria 981
336 Ga0501074_0046576 3300049590 Bacteria 3135
337 Ga0501075_0004980 3300049591 Bacteria 9060
338 Ga0501075_0017981 3300049591 Bacteria 5109
339 Ga0501076_0000846 3300049592 Bacteria 19822
340 Ga0501076_0003466 3300049592 Bacteria 11075
341 Ga0501077_0003393 3300049593 Bacteria 9575
342 Ga0501079_0000522 3300049741 Bacteria 25035
343 Ga0501079_0012156 3300049741 Bacteria 6572
344 Ga0501079_0115551 3300049741 Bacteria 2086
345 Ga0501079_0125953 3300049741 Unclassified 1993
346 Ga0501080_0006038 3300049742 Bacteria 10854
347 Ga0501081_0000442 3300049743 Bacteria 22931
348 Ga0501083_0251282 3300049744 Unclassified 1151
349 Ga0501035_0383568 3300049822 Bacteria 1172
350 Ga0501044_0036237 3300049823 Bacteria 5162
351 Ga0501045_0001973 3300049824 Bacteria 13866
352 Ga0501045_0013527 3300049824 Bacteria 5764
353 Ga0501045_0062240 3300049824 Bacteria 2738
354 Ga0501045_0217588 3300049824 Bacteria 1422
355 nmdc:mga05p37_211214_c1 3300050507 Unclassified 2346
356 nmdc:mga05p37_5371_c1 3300050507 Bacteria 15065
357 nmdc:mga05p37_77_c1 3300050507 Bacteria 86224
358 nmdc:mga09592_140_c1 3300050508 Bacteria 48059
359 nmdc:mga09592_269271_c1 3300050508 Bacteria 1477
360 nmdc:mga09592_617_c1 3300050508 Bacteria 27114
361 nmdc:mga0qj67_12080_c1 3300050509 Bacteria 6495
362 nmdc:mga0qj67_161000_c1 3300050509 Bacteria 1822
363 nmdc:mga0qj67_219961_c1 3300050509 Bacteria 1542
364 nmdc:mga06r32_117566_c1 3300050510 Unclassified 2620
365 nmdc:mga06r32_14314_c1 3300050510 Bacteria 7196
366 nmdc:mga06r32_148286_c1 3300050510 Unclassified 2324
367 nmdc:mga06r32_2761_c1 3300050510 Bacteria 15709
368 nmdc:mga06r32_34883_c1 3300050510 Bacteria 4746
369 nmdc:mga08y16_19844_c1 3300050511 Bacteria 7088
370 nmdc:mga08y16_21688_c1 3300050511 Bacteria 6780
371 nmdc:mga08y16_278664_c1 3300050511 Bacteria 1725
372 nmdc:mga08y16_525687_c1 3300050511 Unclassified 1199
373 nmdc:mga08y16_93025_c1 3300050511 Bacteria 3142
374 nmdc:mga0n895_11176_c1 3300050512 Bacteria 7993
375 nmdc:mga0n895_52759_c1 3300050512 Bacteria 3993
376 nmdc:mga0rr50_2666_c1 3300050513 Bacteria 10107
377 nmdc:mga0rr50_6838_c1 3300050513 Bacteria 6989
378 nmdc:mga08x19_1343_c1 3300050514 Bacteria 15263
379 nmdc:mga08x19_150016_c1 3300050514 Bacteria 1578
380 nmdc:mga08x19_165249_c1 3300050514 Unclassified 1505
381 nmdc:mga08x19_187048_c1 3300050514 Bacteria 1416
382 nmdc:mga08x19_19344_c1 3300050514 Bacteria 4177
383 nmdc:mga08x19_2046_c1 3300050514 Bacteria 12365
384 nmdc:mga0a205_156570_c1 3300050515 Bacteria 2176
385 nmdc:mga0a205_15741_c1 3300050515 Bacteria 7070
386 nmdc:mga0a205_64318_c1 3300050515 Bacteria 3543
387 Ga0495601_0070727 3300053077 Bacteria 2228
388 Ga0495619_0015741 3300053085 Bacteria 4788
389 Ga0501084_0003541 3300054114 Bacteria 12676
390 Ga0501082_0011350 3300060353 Bacteria 7660
391 Ga0501082_0043238 3300060353 Bacteria 3884
392 Ga0501082_0199733 3300060353 Bacteria 1740
393 Ga0501082_0551683 3300060353 Unclassified 1008
394 Ga0501082_0646399 3300060353 Bacteria 926
395 Ga0530510_0002376 3300061734 Bacteria 12937
396 Ga0530510_0004308 3300061734 Bacteria 9845
397 Ga0495636_0022666
398 Ga0070690_100000860
399 Ga0070690_100440084
400 Ga0068869_100000089
401 Ga0070680_100000992
402 Ga0068868_100007574
403 Ga0070689_100000185
404 Ga0070689_100082455
405 Ga0070691_10001436
406 Ga0070691_10207758
407 Ga0070687_100000160
408 Ga0070687_100054387
409 Ga0070692_10002405
410 Ga0070692_10011938
411 Ga0070692_10063244
412 Ga0070668_100242427
413 Ga0070669_100173487
414 Ga0070673_100056516
415 Ga0070688_100109768
416 Ga0070667_100337983
417 Ga0070709_10538601
418 Ga0070701_10000744
419 Ga0070705_100003688
420 Ga0070700_100001045
421 Ga0070700_100012040
422 Ga0070694_100000089
423 Ga0070694_100001912
424 Ga0070694_100132841
425 Ga0070694_100284406
426 Ga0070708_100260789
427 Ga0070708_100408964
428 Ga0070678_100564507
429 Ga0070681_10005559
430 Ga0070681_10110748
431 Ga0068867_100001296
432 Ga0068867_100385730
433 Ga0070707_100343532
434 Ga0070707_100445794
435 Ga0070698_100129862
436 Ga0070699_100055177
437 Ga0070699_100527702
438 Ga0070679_100002498
439 Ga0070679_100159538
440 Ga0070697_100067867
441 Ga0070697_100177513
442 Ga0068853_100024767
443 Ga0070686_100001902
444 Ga0070686_100123952
445 Ga0070695_100007392
446 Ga0070695_100010068
447 Ga0070695_100412146
448 Ga0070696_100000077
449 Ga0070696_100003096
450 Ga0070696_100040538
451 Ga0070696_100149845
452 Ga0070693_100000125
453 Ga0070704_100000051
454 Ga0070704_100000480
455 Ga0070704_100008297
456 Ga0070704_100059222
457 Ga0070704_100154945
458 Ga0068855_100000741
459 Ga0068854_100033159
460 Ga0070702_100000279
461 Ga0070702_100558726
462 Ga0068852_100058867
463 Ga0068859_100007511
464 Ga0068859_100015490
465 Ga0068864_100101567
466 Ga0068866_10001003
467 Ga0068866_10186329
468 Ga0068861_100002682
469 Ga0068861_100021552
470 Ga0068870_10268567
471 Ga0068863_100755130
472 Ga0068858_100063743
473 Ga0068860_100000810
474 Ga0068862_100000622
475 Ga0068862_100005219
476 Ga0068862_100139158
477 Ga0081539_10000805
478 Ga0070715_10083645
479 Ga0097621_100001434
480 Ga0068871_100000440
481 Ga0075428_100003445
482 Ga0075428_100057307
483 Ga0075428_100121756
484 Ga0075430_100002837
485 Ga0075430_100003773
486 Ga0075430_100121687
487 Ga0075430_100142921
488 Ga0075431_100045189
489 Ga0075431_100048708
490 Ga0075431_100269656
491 Ga0075431_100714048
492 Ga0075433_10005345
493 Ga0075433_10112899
494 Ga0075434_100002423
495 Ga0075434_100010683
496 Ga0075429_100000003
497 Ga0075429_100000096
498 Ga0075429_100056132
499 Ga0068865_100000149
500 Ga0068865_100028039
501 Ga0075436_100000043
502 Ga0075436_100000816
503 Ga0075436_100004534
504 Ga0075436_100025161
505 Ga0075436_100034512
506 Ga0075436_100058957
507 Ga0097620_100007512
508 Ga0097620_100015490
509 Ga0075435_100000068
510 Ga0075435_100000774
511 Ga0075435_100010857
512 Ga0075435_100045058
513 Ga0075435_100074708
514 Ga0099794_10073008
515 Ga0105250_10021177
516 Ga0111539_10023985
517 Ga0111539_10024737
518 Ga0111539_10077883
519 Ga0111539_10137085
520 Ga0105245_10001124
521 Ga0105245_10749392
522 Ga0114129_10001405
523 Ga0114129_10023255
524 Ga0105243_10000577
525 Ga0105243_10205669
526 Ga0105241_10008104
527 Ga0105242_10001480
528 Ga0105242_10275316
529 Ga0105249_10017288
530 Ga0105249_10021434
531 Ga0105239_10051205
532 Ga0157378_10000498
533 Ga0157378_10971539
534 Ga0163162_10197928
535 Ga0157375_11151166
536 Ga0157380_10046125
537 Ga0157380_10185303
538 Ga0157376_10002186
539 Ga0207653_10042380
540 Ga0207682_10151853
541 Ga0207642_10000463
542 Ga0207642_10051190
543 Ga0207685_10120131
544 Ga0207645_10045857
545 Ga0207654_10007411
546 Ga0207707_10013285
547 Ga0207707_10085380
548 Ga0207660_10003278
549 Ga0207660_10017474
550 Ga0207660_10098968
551 Ga0207662_10000099
552 Ga0207662_10043027
553 Ga0207662_10097175
554 Ga0207646_10536644
555 Ga0207646_10682143
556 Ga0207659_10183364
557 Ga0207687_10003548
558 Ga0207664_10103906
559 Ga0207706_10398025
560 Ga0207686_10000295
561 Ga0207709_10001189
562 Ga0207709_10063932
563 Ga0207670_10010662
564 Ga0207669_10129685
565 Ga0207704_10000643
566 Ga0207704_10050518
567 Ga0207691_10160007
568 Ga0207689_10000432
569 Ga0207689_10050122
570 Ga0207667_10002062
571 Ga0207651_10045273
572 Ga0207651_10276786
573 Ga0207712_10002597
574 Ga0207640_10023009
575 Ga0207677_10000957
576 Ga0207677_10180317
577 Ga0207708_10000412
578 Ga0207708_10007535
579 Ga0207702_10029400
580 Ga0207702_10131830
581 Ga0207648_10000603
582 Ga0207648_10012950
583 Ga0207648_10338002
584 Ga0207675_100000509
585 Ga0207675_100110938
586 Ga0207683_10124211
587 Ga0209969_1007639
588 Ga0209968_1002814
589 Ga0209970_1006991
590 Ga0209966_1008941
591 Ga0207428_10001841
592 Ga0207428_10155261
593 Ga0268265_10002203
594 Ga0268265_10133029
595 Ga0268264_10003270
596 Ga0307408_100050978
597 Ga0307412_10411121
598 Ga0307412_10461651
599 Ga0307416_100228298
600 Ga0307416_100649219
601 Ga0307411_10254469
602 Ga0373930_0005803
603 Ga0373958_0045258
604 Ga0373959_0049439
605 Ga0373928_0012114
606 Ga0373929_0036574
607 Ga0373940_0001634
608 Ga0373944_0012505
609 Ga0373949_0006588
610 Ga0373951_0016354
611 Ga0373932_0002213
612 Ga0373941_0006620
613 Ga0373945_0004380
614 Ga0373954_0000051
615 Ga0373943_0032543
616 Ga0373946_0008822
617 Ga0373946_0021798
618 Ga0373942_0017614
619 Ga0373924_0224018
620 Ga0373931_0000606
621 Ga0373931_0002156
622 Ga0373931_0063315
623 Ga0373931_0137750
624 Ga0373935_0659068
625 Ga0373927_0009081
626 Ga0373927_0106649
627 Ga0373933_0012201
628 Ga0373933_0030157
629 Ga0373947_0024203
630 Ga0373947_0094958
631 Ga0373937_0000342
632 Ga0373937_0056374
633 Ga0242420_024609
634 Ga0439441_002439
635 Ga0439441_011635
636 Ga0439434_0086178
637 Ga0439435_0000668
638 Ga0439435_0001348
639 Ga0439444_0025139
640 Ga0439460_0000216
641 Ga0450893_0029882
642 Ga0451577_0118971
643 Ga0451577_0656266
644 Ga0453683_0536095
645 Ga0466964_0081346
646 Ga0453684_0860594
647 Ga0466957_0134253
648 Ga0451576_0000927
649 Ga0451576_0021100
650 Ga0451576_0037035
651 Ga0451576_0074076
652 Ga0466967_0000937
653 Ga0495592_0027321
654 Ga0495629_0092421
655 Ga0495653_0030445
656 Ga0495580_0041692
657 Ga0495582_0038283
658 Ga0495662_0019911
659 Ga0495594_0124994
660 Ga0495608_0006417
661 Ga0495618_0011787
662 Ga0495628_0004697
663 Ga0495630_0008819
664 Ga0495644_0137693
665 Ga0495666_0016089
666 Ga0495666_0087885
667 Ga0495665_0064082
668 Ga0495640_0000332
669 Ga0495640_0027944
670 Ga0495586_0008677
671 Ga0495586_0086422
672 Ga0495586_0116977
673 Ga0495587_0037826
674 Ga0495598_0006785
675 Ga0495645_0069099
676 Ga0495656_0099171
677 Ga0495635_0019518
678 Ga0495659_0042888
679 Ga0495588_0002847
680 Ga0495599_0014670
681 Ga0495599_0241679
682 Ga0495647_0001995
683 Ga0495658_0009683
684 Ga0495669_0080294
685 Ga0495613_0003316
686 Ga0495624_0026589
687 Ga0495600_0035410
688 Ga0495600_0315124
689 Ga0495604_0019055
690 Ga0495636_0137679
691 Ga0495674_0272312
692 Ga0495674_0414531
693 Ga0495676_0119737
694 Ga0495680_0002093
695 Ga0495680_0243004
696 Ga0495677_0057753
697 Ga0495593_0044966
698 Ga0496106_0099281
699 Ga0501299_039573
700 Ga0501031_0008501
701 Ga0501033_0002807
702 Ga0501033_0345567
703 Ga0501036_0006830
704 Ga0501036_0350769
705 Ga0501037_0293622
706 Ga0501038_0004659
707 Ga0501039_0003726
708 Ga0501039_0153450
709 Ga0501040_0004351
710 Ga0501040_0005522
711 Ga0501040_0066782
712 Ga0501041_0003195
713 Ga0501041_0009565
714 Ga0501041_0010109
715 Ga0501042_0042579
716 Ga0501042_0046337
717 Ga0501042_0095060
718 Ga0501042_0136041
719 Ga0501042_0181856
720 Ga0501046_0098565
721 Ga0501046_0101125
722 Ga0501047_0155307
723 Ga0501048_0005623
724 Ga0501068_0035287
725 Ga0501070_0495152
726 Ga0501071_0072844
727 Ga0501072_0007323
728 Ga0501072_0011067
729 Ga0501072_0055717
730 Ga0501072_0314412
731 Ga0501072_0482081
732 Ga0501074_0046576
733 Ga0501075_0004980
734 Ga0501075_0017981
735 Ga0501076_0000846
736 Ga0501076_0003466
737 Ga0501077_0003393
738 Ga0501079_0000522
739 Ga0501079_0012156
740 Ga0501079_0115551
741 Ga0501079_0125953
742 Ga0501080_0006038
743 Ga0501081_0000442
744 Ga0501083_0251282
745 Ga0501035_0383568
746 Ga0501044_0036237
747 Ga0501045_0001973
748 Ga0501045_0013527
749 Ga0501045_0062240
750 Ga0501045_0217588
751 nmdc:mga05p37_211214_c1
752 nmdc:mga05p37_5371_c1
753 nmdc:mga05p37_77_c1
754 nmdc:mga09592_140_c1
755 nmdc:mga09592_269271_c1
756 nmdc:mga09592_617_c1
757 nmdc:mga0qj67_12080_c1
758 nmdc:mga0qj67_161000_c1
759 nmdc:mga0qj67_219961_c1
760 nmdc:mga06r32_117566_c1
761 nmdc:mga06r32_14314_c1
762 nmdc:mga06r32_148286_c1
763 nmdc:mga06r32_2761_c1
764 nmdc:mga06r32_34883_c1
765 nmdc:mga08y16_19844_c1
766 nmdc:mga08y16_21688_c1
767 nmdc:mga08y16_278664_c1
768 nmdc:mga08y16_525687_c1
769 nmdc:mga08y16_93025_c1
770 nmdc:mga0n895_11176_c1
771 nmdc:mga0n895_52759_c1
772 nmdc:mga0rr50_2666_c1
773 nmdc:mga0rr50_6838_c1
774 nmdc:mga08x19_1343_c1
775 nmdc:mga08x19_150016_c1
776 nmdc:mga08x19_165249_c1
777 nmdc:mga08x19_187048_c1
778 nmdc:mga08x19_19344_c1
779 nmdc:mga08x19_2046_c1
780 nmdc:mga0a205_156570_c1
781 nmdc:mga0a205_15741_c1
782 nmdc:mga0a205_64318_c1
783 Ga0495601_0070727
784 Ga0495619_0015741
785 Ga0501084_0003541
786 Ga0501082_0011350
787 Ga0501082_0043238
788 Ga0501082_0199733
789 Ga0501082_0551683
790 Ga0501082_0646399
791 Ga0530510_0002376
792 Ga0530510_0004308

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00462

Glutaredoxin

Glutaredoxin

5

63

0.94

PF12867

DinB_2

DinB superfamily

89

217

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3zit-assembly1.cif.gz_A crystal structure of the thioredoxin-like protein bc3987 mutant t8a 0.9187 14 84
1h75-assembly1.cif.gz_A structural basis for the thioredoxin-like activity profile of the glutaredoxin-like protein nrdh-redoxin from escherichia coli. 0.9182 14 73
3zij-assembly2.cif.gz_B crystal structure of the thioredoxin-like protein bc3987 0.9167 14 82
7c13-assembly1.cif.gz_C-2 beta1 domain-swapped structure of monothiol cgrx1(c16s) 0.8984 14 82
3zit-assembly1.cif.gz_B crystal structure of the thioredoxin-like protein bc3987 mutant t8a 0.898 12 87
ID Description Score Start End Superfamily
1h75A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9184 14 73 3.40.30.10
3zijB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9167 14 82 3.40.30.10
3ic4A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8838 11 84 3.40.30.10
af_H2FLI1_195_263_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8764 13 71 3.40.30.10
3zijB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8589 14 82 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A536SGT0-F1-model_v4 DinB family protein 0.9755 70 261
AF-A0A536SGT0-F1-model_v4 DinB family protein 0.9705 70 261
AF-A0A537CXN5-F1-model_v4 DinB family protein 0.9644 144 261
AF-A0A537D6U3-F1-model_v4 NrdH-redoxin 0.9579 9 261 GO:0009055
GO:0045454
AF-A0A1F9DKF5-F1-model_v4 Glutaredoxin domain-containing protein 0.9577 27 261

Map