F433588

General Info

Members Datasets Scaffolds Average Seq Length
396 244 792 340

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0144638|Ga0466967_0144638_364_1524
Length 386
Sequence MTWLLPIRDKDLPCATMSVARGGLSGHDPAPDEVDRMTSDDPAPLPTAFSVALDRLRLEGAIFLRAEYRDPWSYVSLSGPETAAILRPGTDRVVLFHLVASGTCWVEVEGEVRHWASAGDVIVLPYGDQHRMGGVGDAASVPLASIMEAPPWARMPVIRHGDSQGELTNVVCGFLHSEDVIFEPSLRVFPPVFVVRPRDEAAAGWVRANVEYALTQADTSPLGPDAVPTRLPELLLVEVLRQHLASAPAVDHGWIAALQDPVLQPALAAIHTDPAERWTVEALARRAVVSRSALDARFRQVLGLSPIRYLTEWRMHLARDLLASTDLGVASVARRVGYDAEEAFSRAFKRHSGAAPSQWRARHHLRTPAAMVGDGMTGSDDDVAAR

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
119 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
120 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
121 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
122 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
123 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
124 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
125 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
126 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
127 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
128 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
129 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
130 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
131 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
132 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
133 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
134 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
135 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
136 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
137 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
138 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
139 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
141 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
142 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
147 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
148 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
149 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
150 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
151 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
152 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
153 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
154 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
155 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
156 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
157 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
158 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
159 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
160 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
164 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
165 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
166 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
167 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
168 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
169 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
170 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
171 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
172 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
173 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
174 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
175 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
176 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
177 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
178 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
179 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
180 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
181 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
182 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
183 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
184 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
185 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
186 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
187 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
188 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
189 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
190 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
191 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
192 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
193 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
194 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
195 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
196 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
197 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
198 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
203 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
211 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
212 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
220 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
221 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
222 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
223 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
224 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
225 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
226 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
227 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
228 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
229 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
230 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
231 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
232 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
234 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
235 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
236 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
237 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
238 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
239 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
240 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
241 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
242 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
243 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
244 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.26
Nodule 0
Rhizoplane 7.32
Rhizosphere 90.4
Stem 0
Stem Tuber 0
Unclassified 10.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0144638 3300045976 Bacteria 2217
2 Ga0070658_10080019 3300005327 Bacteria 2683
3 Ga0070658_10412285 3300005327 Unclassified 1161
4 Ga0070683_100005044 3300005329 Bacteria 10961
5 Ga0070683_100317510 3300005329 Unclassified 1482
6 Ga0070683_100372898 3300005329 Bacteria 1360
7 Ga0070670_100099759 3300005331 Bacteria 2499
8 Ga0068869_100056987 3300005334 Bacteria 2851
9 Ga0070666_10122716 3300005335 Bacteria 1802
10 Ga0070680_100140043 3300005336 Unclassified 2028
11 Ga0070682_100006385 3300005337 Bacteria 6619
12 Ga0068868_100029392 3300005338 Bacteria 4208
13 Ga0070660_100020054 3300005339 Bacteria 4908
14 Ga0070689_100117627 3300005340 Bacteria 2120
15 Ga0070689_100178311 3300005340 Bacteria 1724
16 Ga0070691_10058286 3300005341 Bacteria 1854
17 Ga0070687_100109498 3300005343 Bacteria 1561
18 Ga0070692_10001501 3300005345 Bacteria 8531
19 Ga0070668_100014512 3300005347 Bacteria 5889
20 Ga0070675_100033794 3300005354 Bacteria 4148
21 Ga0070671_100059335 3300005355 Bacteria 3184
22 Ga0070674_100017057 3300005356 Bacteria 4559
23 Ga0070674_100090801 3300005356 Bacteria 2204
24 Ga0070673_100125983 3300005364 Bacteria 2143
25 Ga0070659_100021631 3300005366 Bacteria 4902
26 Ga0070667_100002613 3300005367 Bacteria 15617
27 Ga0070714_100205300 3300005435 Bacteria 1804
28 Ga0070701_10035912 3300005438 Bacteria 2494
29 Ga0070701_10041036 3300005438 Bacteria 2356
30 Ga0070711_100012026 3300005439 Bacteria 5393
31 Ga0070711_100054313 3300005439 Bacteria 2764
32 Ga0070700_100000803 3300005441 Bacteria 15397
33 Ga0070700_100006114 3300005441 Bacteria 6414
34 Ga0070694_100320614 3300005444 Unclassified 1192
35 Ga0070708_100052176 3300005445 Bacteria 3626
36 Ga0070678_100041042 3300005456 Bacteria 3278
37 Ga0070678_100057564 3300005456 Bacteria 2848
38 Ga0070662_100225324 3300005457 Unclassified 1497
39 Ga0070662_100475122 3300005457 Bacteria 1040
40 Ga0068867_100021036 3300005459 Bacteria 4653
41 Ga0068867_100022680 3300005459 Bacteria 4490
42 Ga0070698_100047640 3300005471 Bacteria 4381
43 Ga0070679_100235755 3300005530 Bacteria 1789
44 Ga0070684_100010817 3300005535 Bacteria 7246
45 Ga0070684_100122874 3300005535 Bacteria 2336
46 Ga0070684_100184814 3300005535 Bacteria 1895
47 Ga0070684_100280713 3300005535 Bacteria 1526
48 Ga0070697_100001107 3300005536 Bacteria 20385
49 Ga0070695_100025390 3300005545 Bacteria 3658
50 Ga0070696_100092766 3300005546 Bacteria 2152
51 Ga0070665_100001319 3300005548 Bacteria 29608
52 Ga0070665_100225724 3300005548 Bacteria 1873
53 Ga0070704_100312114 3300005549 Bacteria 1314
54 Ga0070704_100314541 3300005549 Unclassified 1309
55 Ga0068857_100090264 3300005577 Bacteria 2742
56 Ga0068857_100357979 3300005577 Unclassified 1352
57 Ga0068856_100054281 3300005614 Bacteria 3952
58 Ga0070702_100054618 3300005615 Bacteria 2299
59 Ga0068852_100091449 3300005616 Bacteria 2723
60 Ga0068852_100571703 3300005616 Bacteria 1132
61 Ga0068866_10022691 3300005718 Bacteria 2908
62 Ga0068861_100380046 3300005719 Unclassified 1248
63 Ga0068870_10003496 3300005840 Bacteria 6662
64 Ga0068863_100000838 3300005841 Bacteria 30841
65 Ga0068863_100164855 3300005841 Bacteria 2124
66 Ga0068858_100261159 3300005842 Bacteria 1646
67 Ga0068860_100000035 3300005843 Bacteria 238993
68 Ga0070717_10146693 3300006028 Bacteria 2038
69 Ga0070717_10233651 3300006028 Bacteria 1619
70 Ga0075363_100001717 3300006048 Bacteria 8513
71 Ga0075364_10305998 3300006051 Bacteria 1082
72 Ga0070716_100020233 3300006173 Bacteria 3491
73 Ga0070712_100072749 3300006175 Unclassified 2463
74 Ga0097621_100031413 3300006237 Bacteria 4215
75 Ga0068871_100013036 3300006358 Bacteria 6161
76 Ga0068871_100186613 3300006358 Bacteria 1784
77 Ga0075428_100441479 3300006844 Bacteria 1394
78 Ga0068865_100003611 3300006881 Bacteria 9300
79 Ga0068865_100003942 3300006881 Bacteria 8910
80 Ga0068865_100096036 3300006881 Bacteria 2160
81 Ga0105251_10026724 3300009011 Bacteria 2936
82 Ga0111539_10051785 3300009094 Bacteria 4888
83 Ga0105245_10202322 3300009098 Bacteria 1907
84 Ga0105245_10213162 3300009098 Bacteria 1860
85 Ga0105243_10002560 3300009148 Bacteria 15198
86 Ga0105242_10006368 3300009176 Bacteria 9086
87 Ga0105242_10064261 3300009176 Bacteria 3025
88 Ga0105238_10023332 3300009551 Bacteria 6307
89 Ga0105249_10093235 3300009553 Bacteria 2820
90 Ga0105249_10512116 3300009553 Bacteria 1246
91 Ga0105246_10018289 3300011119 Bacteria 4465
92 Ga0105246_10077814 3300011119 Bacteria 2354
93 Ga0157373_10078891 3300013100 Bacteria 2322
94 Ga0157371_10124096 3300013102 Bacteria 1836
95 Ga0157374_10039766 3300013296 Bacteria 4329
96 Ga0157375_10008758 3300013308 Bacteria 8865
97 Ga0163163_10127166 3300014325 Bacteria 2586
98 Ga0163163_10158835 3300014325 Bacteria 2306
99 Ga0157380_10012531 3300014326 Bacteria 6153
100 Ga0157380_10079206 3300014326 Bacteria 2683
101 Ga0157377_10005923 3300014745 Bacteria 5785
102 Ga0157377_10006449 3300014745 Bacteria 5599
103 Ga0157377_10065290 3300014745 Bacteria 2090
104 Ga0157379_10126328 3300014968 Bacteria 2301
105 Ga0157376_10074160 3300014969 Bacteria 2900
106 Ga0163161_10149442 3300017792 Bacteria 1774
107 Ga0163161_10234296 3300017792 Bacteria 1426
108 Ga0163161_10247845 3300017792 Unclassified 1387
109 Ga0206353_10567023 3300020082 Bacteria 2461
110 Ga0207656_10030919 3300025321 Bacteria 2214
111 Ga0207653_10008020 3300025885 Bacteria 3292
112 Ga0207688_10002693 3300025901 Bacteria 9618
113 Ga0207688_10043471 3300025901 Bacteria 2502
114 Ga0207680_10144108 3300025903 Bacteria 1582
115 Ga0207643_10004241 3300025908 Bacteria 7717
116 Ga0207693_10011016 3300025915 Bacteria 7329
117 Ga0207693_10111886 3300025915 Bacteria 2142
118 Ga0207657_10094464 3300025919 Bacteria 2490
119 Ga0207657_10199719 3300025919 Unclassified 1609
120 Ga0207652_10069307 3300025921 Bacteria 3062
121 Ga0207687_10042973 3300025927 Bacteria 3113
122 Ga0207700_10018702 3300025928 Bacteria 4663
123 Ga0207664_10073417 3300025929 Bacteria 2760
124 Ga0207644_10141467 3300025931 Bacteria 1853
125 Ga0207690_10030604 3300025932 Bacteria 3435
126 Ga0207706_10048479 3300025933 Bacteria 3757
127 Ga0207686_10014792 3300025934 Bacteria 4353
128 Ga0207686_10325347 3300025934 Unclassified 1150
129 Ga0207670_10116550 3300025936 Bacteria 1934
130 Ga0207669_10092280 3300025937 Bacteria 1975
131 Ga0207704_10088722 3300025938 Bacteria 2024
132 Ga0207665_10004436 3300025939 Bacteria 9324
133 Ga0207665_10247556 3300025939 Bacteria 1316
134 Ga0207711_10034398 3300025941 Bacteria 4292
135 Ga0207689_10042581 3300025942 Bacteria 3755
136 Ga0207689_10149456 3300025942 Bacteria 1925
137 Ga0207661_10044049 3300025944 Bacteria 3524
138 Ga0207712_10345037 3300025961 Bacteria 1236
139 Ga0207668_10009095 3300025972 Bacteria 5938
140 Ga0207640_10041826 3300025981 Bacteria 2917
141 Ga0207640_10058890 3300025981 Bacteria 2532
142 Ga0207658_10047031 3300025986 Bacteria 3155
143 Ga0207677_10022411 3300026023 Bacteria 3881
144 Ga0207677_10357798 3300026023 Bacteria 1225
145 Ga0207703_10173927 3300026035 Bacteria 1896
146 Ga0207639_10036237 3300026041 Bacteria 3654
147 Ga0207678_10036056 3300026067 Bacteria 4305
148 Ga0207708_10001216 3300026075 Bacteria 19447
149 Ga0207708_10007086 3300026075 Bacteria 8282
150 Ga0207702_10054526 3300026078 Bacteria 3388
151 Ga0207702_10130213 3300026078 Bacteria 2263
152 Ga0207641_10001869 3300026088 Bacteria 20215
153 Ga0207648_10000996 3300026089 Bacteria 31986
154 Ga0207648_10021558 3300026089 Bacteria 5790
155 Ga0207676_10013824 3300026095 Bacteria 5794
156 Ga0207674_10098597 3300026116 Bacteria 2905
157 Ga0207675_100150532 3300026118 Bacteria 2214
158 Ga0207683_10036214 3300026121 Bacteria 4296
159 Ga0207683_10044681 3300026121 Bacteria 3873
160 Ga0207698_10548496 3300026142 Bacteria 1133
161 Ga0268266_10001743 3300028379 Bacteria 24876
162 Ga0268264_10000031 3300028381 Bacteria 409525
163 Ga0316177_1158534 3300030731 Bacteria 1170
164 Ga0314311_1251484 3300030733 Bacteria 1440
165 Ga0307413_10225531 3300031824 Bacteria 1372
166 Ga0307414_10113201 3300032004 Bacteria 2071
167 Ga0373926_0000107 3300035083 Bacteria 16778
168 Ga0373926_0000872 3300035083 Bacteria 8631
169 Ga0373926_0005117 3300035083 Unclassified 4308
170 Ga0373934_0001692 3300035086 Bacteria 8111
171 Ga0373940_0038019 3300035088 Unclassified 1312
172 Ga0373944_0000437 3300035089 Bacteria 9596
173 Ga0373944_0005432 3300035089 Bacteria 3355
174 Ga0373923_0000106 3300035111 Bacteria 14872
175 Ga0373923_0010303 3300035111 Bacteria 3397
176 Ga0373936_0001327 3300035113 Bacteria 8968
177 Ga0373936_0008380 3300035113 Bacteria 3890
178 Ga0373936_0026032 3300035113 Unclassified 2290
179 Ga0373941_0006249 3300035115 Bacteria 2859
180 Ga0373945_0000112 3300035116 Bacteria 19634
181 Ga0373945_0007954 3300035116 Unclassified 3441
182 Ga0373945_0029878 3300035116 Bacteria 1917
183 Ga0373953_0004367 3300035117 Bacteria 4501
184 Ga0373954_0007276 3300035118 Bacteria 4838
185 Ga0373956_0008352 3300035119 Bacteria 4189
186 Ga0373960_0019214 3300035121 Unclassified 1793
187 Ga0373943_0000607 3300035170 Bacteria 15580
188 Ga0373943_0041982 3300035170 Unclassified 2214
189 Ga0373946_0000942 3300035171 Bacteria 9963
190 Ga0373946_0002641 3300035171 Bacteria 6334
191 Ga0373946_0005896 3300035171 Unclassified 4438
192 Ga0373955_0034234 3300035172 Bacteria 2680
193 Ga0373942_0048354 3300035207 Unclassified 1185
194 Ga0373924_0001762 3300035410 Bacteria 7146
195 Ga0373935_0006663 3300035692 Bacteria 6899
196 Ga0373935_0035745 3300035692 Bacteria 3101
197 Ga0373935_0084429 3300035692 Bacteria 2068
198 Ga0373927_0001001 3300035695 Bacteria 21521
199 Ga0373927_0006200 3300035695 Bacteria 8164
200 Ga0373933_0028559 3300035724 Bacteria 3219
201 Ga0373933_0144764 3300035724 Bacteria 1502
202 Ga0373947_0019149 3300035725 Bacteria 3945
203 Ga0373947_0026811 3300035725 Unclassified 3369
204 Ga0373925_0005937 3300037068 Bacteria 9046
205 Ga0373925_0009494 3300037068 Bacteria 7083
206 Ga0373925_0029342 3300037068 Bacteria 4035
207 Ga0373925_0033650 3300037068 Bacteria 3776
208 Ga0395905_0216174 3300037471 Unclassified 1795
209 Ga0436365_0138499 3300039437 Bacteria 6256
210 Ga0436363_0690340 3300039450 Bacteria 1986
211 Ga0466972_0028433 3300044658 Bacteria 2758
212 Ga0466972_0037037 3300044658 Bacteria 2385
213 Ga0466972_0063613 3300044658 Bacteria 1767
214 Ga0466965_0033943 3300044683 Bacteria 2495
215 Ga0466961_0031584 3300044693 Bacteria 3405
216 Ga0466963_0045493 3300044694 Bacteria 2891
217 Ga0466963_0199841 3300044694 Bacteria 1398
218 Ga0466964_0046216 3300044706 Unclassified 1774
219 Ga0466971_0095882 3300044719 Unclassified 1360
220 Ga0466957_0144165 3300044842 Unclassified 1536
221 Ga0466958_0148377 3300045836 Bacteria 1479
222 Ga0466967_0000184 3300045976 Bacteria 25866
223 Ga0466967_0013885 3300045976 Bacteria 6246
224 Ga0466967_0036126 3300045976 Bacteria 4215
225 Ga0466967_0049740 3300045976 Bacteria 3668
226 Ga0466967_0074608 3300045976 Bacteria 3047
227 Ga0466967_0083154 3300045976 Bacteria 2894
228 Ga0466967_0211183 3300045976 Bacteria 1841
229 Ga0466967_0368440 3300045976 Bacteria 1393
230 Ga0466967_0550201 3300045976 Bacteria 1136
231 Ga0495592_0047554 3300046454 Bacteria 3194
232 Ga0495603_0001227 3300046455 Bacteria 14957
233 Ga0495603_0037294 3300046455 Bacteria 2917
234 Ga0495603_0117586 3300046455 Bacteria 1550
235 Ga0495629_0000437 3300046459 Bacteria 34787
236 Ga0495629_0052681 3300046459 Bacteria 2847
237 Ga0495641_0001142 3300046461 Bacteria 22868
238 Ga0495641_0055226 3300046461 Unclassified 1803
239 Ga0495651_0019907 3300046462 Bacteria 5204
240 Ga0495651_0079918 3300046462 Bacteria 2470
241 Ga0495651_0122703 3300046462 Unclassified 1906
242 Ga0495653_0051442 3300046463 Bacteria 3163
243 Ga0495653_0083536 3300046463 Unclassified 2354
244 Ga0495580_0019199 3300046472 Bacteria 5080
245 Ga0495580_0034418 3300046472 Bacteria 3647
246 Ga0495582_0000952 3300046473 Bacteria 16133
247 Ga0495582_0012474 3300046473 Bacteria 4683
248 Ga0495639_0000242 3300046475 Bacteria 27138
249 Ga0495639_0006169 3300046475 Bacteria 5145
250 Ga0495639_0082317 3300046475 Unclassified 1500
251 Ga0495639_0139227 3300046475 Bacteria 1166
252 Ga0495662_0000818 3300046476 Bacteria 15111
253 Ga0495662_0002131 3300046476 Bacteria 9924
254 Ga0495664_0025850 3300046477 Bacteria 3418
255 Ga0495664_0053175 3300046477 Unclassified 2408
256 Ga0495594_0027650 3300046499 Bacteria 3057
257 Ga0495608_0100911 3300046511 Bacteria 1861
258 Ga0495608_0113301 3300046511 Unclassified 1742
259 Ga0495618_0014647 3300046514 Bacteria 4781
260 Ga0495618_0025386 3300046514 Unclassified 3677
261 Ga0495628_0106257 3300046516 Bacteria 2162
262 Ga0495628_0202227 3300046516 Bacteria 1496
263 Ga0495630_0044845 3300046517 Bacteria 3304
264 Ga0495630_0080107 3300046517 Unclassified 2463
265 Ga0495666_0005606 3300046526 Bacteria 6324
266 Ga0495666_0017668 3300046526 Bacteria 3551
267 Ga0495652_0044329 3300046529 Bacteria 3831
268 Ga0495652_0091093 3300046529 Bacteria 2493
269 Ga0495665_0000298 3300046531 Bacteria 24966
270 Ga0495665_0003538 3300046531 Bacteria 8483
271 Ga0495665_0032465 3300046531 Bacteria 2793
272 Ga0495640_0012957 3300046533 Bacteria 6355
273 Ga0495640_0024816 3300046533 Bacteria 4356
274 Ga0495586_0004700 3300046535 Bacteria 7301
275 Ga0495586_0006254 3300046535 Bacteria 6363
276 Ga0495667_0023552 3300046559 Bacteria 4148
277 Ga0495667_0096091 3300046559 Bacteria 1918
278 Ga0495634_0001272 3300046642 Bacteria 23126
279 Ga0495634_0047551 3300046642 Unclassified 2890
280 Ga0495635_0002276 3300046663 Bacteria 13060
281 Ga0495635_0002957 3300046663 Bacteria 11664
282 Ga0495635_0083804 3300046663 Bacteria 2181
283 Ga0495588_0025498 3300046674 Bacteria 2946
284 Ga0495657_0034338 3300046675 Bacteria 3523
285 Ga0495657_0077067 3300046675 Bacteria 2163
286 Ga0495599_0015822 3300046678 Bacteria 4683
287 Ga0495623_0022395 3300046679 Bacteria 4082
288 Ga0495623_0228267 3300046679 Bacteria 1057
289 Ga0495646_0097329 3300046680 Bacteria 1691
290 Ga0495647_0010512 3300046681 Bacteria 3153
291 Ga0495658_0001710 3300046683 Bacteria 11416
292 Ga0495658_0008737 3300046683 Bacteria 5031
293 Ga0495669_0001385 3300046684 Bacteria 10004
294 Ga0495613_0015002 3300046689 Bacteria 5750
295 Ga0495613_0028135 3300046689 Bacteria 4181
296 Ga0495624_0020335 3300046690 Unclassified 4421
297 Ga0495600_0044270 3300046809 Bacteria 2904
298 Ga0495581_0001257 3300047315 Bacteria 13936
299 Ga0495581_0007145 3300047315 Bacteria 6466
300 Ga0495581_0009073 3300047315 Bacteria 5752
301 Ga0495581_0105259 3300047315 Unclassified 1639
302 Ga0495674_0000761 3300047319 Bacteria 30585
303 Ga0495674_0005781 3300047319 Bacteria 11859
304 Ga0495674_0049063 3300047319 Bacteria 3732
305 Ga0495676_0011327 3300047321 Bacteria 8053
306 Ga0495676_0079421 3300047321 Bacteria 2494
307 Ga0495676_0115405 3300047321 Bacteria 1963
308 Ga0495680_0030954 3300047322 Unclassified 4360
309 Ga0495680_0037197 3300047322 Bacteria 3900
310 Ga0495680_0054752 3300047322 Bacteria 3096
311 Ga0495684_0002403 3300047471 Bacteria 14939
312 Ga0495684_0096073 3300047471 Bacteria 2243
313 Ga0495593_0000418 3300047673 Bacteria 23660
314 Ga0495593_0001445 3300047673 Bacteria 13932
315 Ga0495593_0099878 3300047673 Bacteria 1489
316 Ga0495602_0027931 3300048088 Bacteria 5411
317 Ga0495602_0052144 3300048088 Bacteria 3636
318 Ga0495614_0000615 3300048089 Bacteria 14936
319 Ga0496101_0117792 3300048904 Bacteria 2005
320 Ga0496101_0240363 3300048904 Unclassified 1409
321 Ga0496102_0019593 3300048905 Bacteria 5960
322 Ga0496102_0097708 3300048905 Bacteria 2724
323 Ga0496103_0086567 3300048906 Bacteria 1975
324 Ga0496106_0037398 3300048909 Bacteria 3631
325 Ga0496107_0005629 3300048910 Bacteria 8582
326 Ga0496107_0110339 3300048910 Bacteria 2021
327 Ga0496108_0012867 3300048911 Bacteria 6815
328 Ga0496108_0017776 3300048911 Bacteria 5815
329 Ga0496108_0248811 3300048911 Bacteria 1546
330 Ga0496109_0011306 3300048912 Bacteria 7667
331 Ga0496109_0116846 3300048912 Bacteria 2482
332 Ga0496109_0135831 3300048912 Bacteria 2298
333 Ga0496109_0277481 3300048912 Bacteria 1579
334 Ga0496109_0284600 3300048912 Bacteria 1558
335 Ga0496110_0212297 3300048913 Unclassified 1760
336 Ga0496110_0251604 3300048913 Bacteria 1608
337 Ga0496110_0255676 3300048913 Bacteria 1595
338 Ga0496110_0364681 3300048913 Bacteria 1316
339 Ga0496111_0039307 3300048914 Bacteria 3391
340 Ga0496112_0045721 3300048915 Bacteria 4292
341 Ga0496112_0129202 3300048915 Bacteria 2498
342 Ga0496112_0207417 3300048915 Bacteria 1917
343 Ga0496113_0020012 3300048916 Bacteria 4696
344 Ga0496113_0265724 3300048916 Bacteria 1371
345 Ga0496114_0005840 3300048917 Bacteria 9665
346 Ga0496114_0062539 3300048917 Bacteria 3115
347 Ga0496114_0099235 3300048917 Bacteria 2484
348 Ga0496119_0055611 3300048922 Unclassified 2403
349 Ga0496120_0045544 3300048923 Unclassified 2541
350 Ga0501031_0252832 3300049568 Bacteria 1145
351 Ga0501034_0108279 3300049571 Bacteria 2770
352 Ga0501038_0069311 3300049574 Bacteria 2996
353 Ga0501038_0198195 3300049574 Bacteria 1613
354 Ga0501041_0105133 3300049577 Bacteria 1749
355 Ga0501042_0043971 3300049578 Bacteria 3182
356 Ga0501043_0297208 3300049579 Bacteria 1235
357 Ga0501048_0095810 3300049582 Bacteria 2093
358 Ga0501067_0002273 3300049583 Bacteria 10603
359 Ga0501067_0008529 3300049583 Bacteria 5681
360 Ga0501068_0118370 3300049584 Bacteria 1650
361 Ga0501069_0187954 3300049585 Bacteria 1195
362 Ga0501070_0004790 3300049586 Bacteria 11574
363 Ga0501071_0188486 3300049587 Bacteria 1546
364 Ga0501072_0007979 3300049588 Bacteria 8034
365 Ga0501072_0029373 3300049588 Bacteria 4294
366 Ga0501073_0004534 3300049589 Bacteria 10444
367 Ga0501073_0050190 3300049589 Bacteria 2924
368 Ga0501074_0003823 3300049590 Bacteria 10713
369 Ga0501074_0006262 3300049590 Bacteria 8591
370 Ga0501075_0039510 3300049591 Bacteria 3532
371 Ga0501077_0008990 3300049593 Bacteria 6200
372 Ga0501077_0076246 3300049593 Bacteria 2124
373 Ga0501077_0084000 3300049593 Bacteria 2018
374 Ga0501080_0020260 3300049742 Bacteria 6156
375 Ga0501080_0120803 3300049742 Bacteria 2428
376 Ga0501081_0046467 3300049743 Bacteria 2985
377 Ga0501083_0011848 3300049744 Bacteria 6111
378 Ga0501083_0089176 3300049744 Bacteria 2038
379 Ga0501044_0284916 3300049823 Bacteria 1585
380 Ga0501045_0003907 3300049824 Bacteria 10265
381 nmdc:mga03n38_2131_c1 3300050490 Bacteria 6011
382 nmdc:mga0yw44_9749_c1 3300050492 Bacteria 4877
383 nmdc:mga0rr50_104819_c1 3300050513 Bacteria 2228
384 Ga0495601_0055303 3300053077 Bacteria 2512
385 Ga0495612_0004302 3300053078 Bacteria 5909
386 Ga0495619_0068575 3300053085 Bacteria 2369
387 Ga0500566_0000308 3300053094 Bacteria 26271
388 Ga0501084_0000055 3300054114 Bacteria 89873
389 Ga0501084_0006746 3300054114 Bacteria 9440
390 Ga0501084_0115101 3300054114 Bacteria 2261
391 Ga0501082_0026310 3300060353 Bacteria 5013
392 Ga0501082_0160054 3300060353 Bacteria 1956
393 Ga0466962_0016420 3300061719 Bacteria 3571
394 Ga0466962_0077187 3300061719 Bacteria 1592
395 Ga0530510_0004338 3300061734 Bacteria 9817
396 Ga0530510_0124729 3300061734 Bacteria 1892
397 Ga0466967_0144638
398 Ga0070658_10080019
399 Ga0070658_10412285
400 Ga0070683_100005044
401 Ga0070683_100317510
402 Ga0070683_100372898
403 Ga0070670_100099759
404 Ga0068869_100056987
405 Ga0070666_10122716
406 Ga0070680_100140043
407 Ga0070682_100006385
408 Ga0068868_100029392
409 Ga0070660_100020054
410 Ga0070689_100117627
411 Ga0070689_100178311
412 Ga0070691_10058286
413 Ga0070687_100109498
414 Ga0070692_10001501
415 Ga0070668_100014512
416 Ga0070675_100033794
417 Ga0070671_100059335
418 Ga0070674_100017057
419 Ga0070674_100090801
420 Ga0070673_100125983
421 Ga0070659_100021631
422 Ga0070667_100002613
423 Ga0070714_100205300
424 Ga0070701_10035912
425 Ga0070701_10041036
426 Ga0070711_100012026
427 Ga0070711_100054313
428 Ga0070700_100000803
429 Ga0070700_100006114
430 Ga0070694_100320614
431 Ga0070708_100052176
432 Ga0070678_100041042
433 Ga0070678_100057564
434 Ga0070662_100225324
435 Ga0070662_100475122
436 Ga0068867_100021036
437 Ga0068867_100022680
438 Ga0070698_100047640
439 Ga0070679_100235755
440 Ga0070684_100010817
441 Ga0070684_100122874
442 Ga0070684_100184814
443 Ga0070684_100280713
444 Ga0070697_100001107
445 Ga0070695_100025390
446 Ga0070696_100092766
447 Ga0070665_100001319
448 Ga0070665_100225724
449 Ga0070704_100312114
450 Ga0070704_100314541
451 Ga0068857_100090264
452 Ga0068857_100357979
453 Ga0068856_100054281
454 Ga0070702_100054618
455 Ga0068852_100091449
456 Ga0068852_100571703
457 Ga0068866_10022691
458 Ga0068861_100380046
459 Ga0068870_10003496
460 Ga0068863_100000838
461 Ga0068863_100164855
462 Ga0068858_100261159
463 Ga0068860_100000035
464 Ga0070717_10146693
465 Ga0070717_10233651
466 Ga0075363_100001717
467 Ga0075364_10305998
468 Ga0070716_100020233
469 Ga0070712_100072749
470 Ga0097621_100031413
471 Ga0068871_100013036
472 Ga0068871_100186613
473 Ga0075428_100441479
474 Ga0068865_100003611
475 Ga0068865_100003942
476 Ga0068865_100096036
477 Ga0105251_10026724
478 Ga0111539_10051785
479 Ga0105245_10202322
480 Ga0105245_10213162
481 Ga0105243_10002560
482 Ga0105242_10006368
483 Ga0105242_10064261
484 Ga0105238_10023332
485 Ga0105249_10093235
486 Ga0105249_10512116
487 Ga0105246_10018289
488 Ga0105246_10077814
489 Ga0157373_10078891
490 Ga0157371_10124096
491 Ga0157374_10039766
492 Ga0157375_10008758
493 Ga0163163_10127166
494 Ga0163163_10158835
495 Ga0157380_10012531
496 Ga0157380_10079206
497 Ga0157377_10005923
498 Ga0157377_10006449
499 Ga0157377_10065290
500 Ga0157379_10126328
501 Ga0157376_10074160
502 Ga0163161_10149442
503 Ga0163161_10234296
504 Ga0163161_10247845
505 Ga0206353_10567023
506 Ga0207656_10030919
507 Ga0207653_10008020
508 Ga0207688_10002693
509 Ga0207688_10043471
510 Ga0207680_10144108
511 Ga0207643_10004241
512 Ga0207693_10011016
513 Ga0207693_10111886
514 Ga0207657_10094464
515 Ga0207657_10199719
516 Ga0207652_10069307
517 Ga0207687_10042973
518 Ga0207700_10018702
519 Ga0207664_10073417
520 Ga0207644_10141467
521 Ga0207690_10030604
522 Ga0207706_10048479
523 Ga0207686_10014792
524 Ga0207686_10325347
525 Ga0207670_10116550
526 Ga0207669_10092280
527 Ga0207704_10088722
528 Ga0207665_10004436
529 Ga0207665_10247556
530 Ga0207711_10034398
531 Ga0207689_10042581
532 Ga0207689_10149456
533 Ga0207661_10044049
534 Ga0207712_10345037
535 Ga0207668_10009095
536 Ga0207640_10041826
537 Ga0207640_10058890
538 Ga0207658_10047031
539 Ga0207677_10022411
540 Ga0207677_10357798
541 Ga0207703_10173927
542 Ga0207639_10036237
543 Ga0207678_10036056
544 Ga0207708_10001216
545 Ga0207708_10007086
546 Ga0207702_10054526
547 Ga0207702_10130213
548 Ga0207641_10001869
549 Ga0207648_10000996
550 Ga0207648_10021558
551 Ga0207676_10013824
552 Ga0207674_10098597
553 Ga0207675_100150532
554 Ga0207683_10036214
555 Ga0207683_10044681
556 Ga0207698_10548496
557 Ga0268266_10001743
558 Ga0268264_10000031
559 Ga0316177_1158534
560 Ga0314311_1251484
561 Ga0307413_10225531
562 Ga0307414_10113201
563 Ga0373926_0000107
564 Ga0373926_0000872
565 Ga0373926_0005117
566 Ga0373934_0001692
567 Ga0373940_0038019
568 Ga0373944_0000437
569 Ga0373944_0005432
570 Ga0373923_0000106
571 Ga0373923_0010303
572 Ga0373936_0001327
573 Ga0373936_0008380
574 Ga0373936_0026032
575 Ga0373941_0006249
576 Ga0373945_0000112
577 Ga0373945_0007954
578 Ga0373945_0029878
579 Ga0373953_0004367
580 Ga0373954_0007276
581 Ga0373956_0008352
582 Ga0373960_0019214
583 Ga0373943_0000607
584 Ga0373943_0041982
585 Ga0373946_0000942
586 Ga0373946_0002641
587 Ga0373946_0005896
588 Ga0373955_0034234
589 Ga0373942_0048354
590 Ga0373924_0001762
591 Ga0373935_0006663
592 Ga0373935_0035745
593 Ga0373935_0084429
594 Ga0373927_0001001
595 Ga0373927_0006200
596 Ga0373933_0028559
597 Ga0373933_0144764
598 Ga0373947_0019149
599 Ga0373947_0026811
600 Ga0373925_0005937
601 Ga0373925_0009494
602 Ga0373925_0029342
603 Ga0373925_0033650
604 Ga0395905_0216174
605 Ga0436365_0138499
606 Ga0436363_0690340
607 Ga0466972_0028433
608 Ga0466972_0037037
609 Ga0466972_0063613
610 Ga0466965_0033943
611 Ga0466961_0031584
612 Ga0466963_0045493
613 Ga0466963_0199841
614 Ga0466964_0046216
615 Ga0466971_0095882
616 Ga0466957_0144165
617 Ga0466958_0148377
618 Ga0466967_0000184
619 Ga0466967_0013885
620 Ga0466967_0036126
621 Ga0466967_0049740
622 Ga0466967_0074608
623 Ga0466967_0083154
624 Ga0466967_0211183
625 Ga0466967_0368440
626 Ga0466967_0550201
627 Ga0495592_0047554
628 Ga0495603_0001227
629 Ga0495603_0037294
630 Ga0495603_0117586
631 Ga0495629_0000437
632 Ga0495629_0052681
633 Ga0495641_0001142
634 Ga0495641_0055226
635 Ga0495651_0019907
636 Ga0495651_0079918
637 Ga0495651_0122703
638 Ga0495653_0051442
639 Ga0495653_0083536
640 Ga0495580_0019199
641 Ga0495580_0034418
642 Ga0495582_0000952
643 Ga0495582_0012474
644 Ga0495639_0000242
645 Ga0495639_0006169
646 Ga0495639_0082317
647 Ga0495639_0139227
648 Ga0495662_0000818
649 Ga0495662_0002131
650 Ga0495664_0025850
651 Ga0495664_0053175
652 Ga0495594_0027650
653 Ga0495608_0100911
654 Ga0495608_0113301
655 Ga0495618_0014647
656 Ga0495618_0025386
657 Ga0495628_0106257
658 Ga0495628_0202227
659 Ga0495630_0044845
660 Ga0495630_0080107
661 Ga0495666_0005606
662 Ga0495666_0017668
663 Ga0495652_0044329
664 Ga0495652_0091093
665 Ga0495665_0000298
666 Ga0495665_0003538
667 Ga0495665_0032465
668 Ga0495640_0012957
669 Ga0495640_0024816
670 Ga0495586_0004700
671 Ga0495586_0006254
672 Ga0495667_0023552
673 Ga0495667_0096091
674 Ga0495634_0001272
675 Ga0495634_0047551
676 Ga0495635_0002276
677 Ga0495635_0002957
678 Ga0495635_0083804
679 Ga0495588_0025498
680 Ga0495657_0034338
681 Ga0495657_0077067
682 Ga0495599_0015822
683 Ga0495623_0022395
684 Ga0495623_0228267
685 Ga0495646_0097329
686 Ga0495647_0010512
687 Ga0495658_0001710
688 Ga0495658_0008737
689 Ga0495669_0001385
690 Ga0495613_0015002
691 Ga0495613_0028135
692 Ga0495624_0020335
693 Ga0495600_0044270
694 Ga0495581_0001257
695 Ga0495581_0007145
696 Ga0495581_0009073
697 Ga0495581_0105259
698 Ga0495674_0000761
699 Ga0495674_0005781
700 Ga0495674_0049063
701 Ga0495676_0011327
702 Ga0495676_0079421
703 Ga0495676_0115405
704 Ga0495680_0030954
705 Ga0495680_0037197
706 Ga0495680_0054752
707 Ga0495684_0002403
708 Ga0495684_0096073
709 Ga0495593_0000418
710 Ga0495593_0001445
711 Ga0495593_0099878
712 Ga0495602_0027931
713 Ga0495602_0052144
714 Ga0495614_0000615
715 Ga0496101_0117792
716 Ga0496101_0240363
717 Ga0496102_0019593
718 Ga0496102_0097708
719 Ga0496103_0086567
720 Ga0496106_0037398
721 Ga0496107_0005629
722 Ga0496107_0110339
723 Ga0496108_0012867
724 Ga0496108_0017776
725 Ga0496108_0248811
726 Ga0496109_0011306
727 Ga0496109_0116846
728 Ga0496109_0135831
729 Ga0496109_0277481
730 Ga0496109_0284600
731 Ga0496110_0212297
732 Ga0496110_0251604
733 Ga0496110_0255676
734 Ga0496110_0364681
735 Ga0496111_0039307
736 Ga0496112_0045721
737 Ga0496112_0129202
738 Ga0496112_0207417
739 Ga0496113_0020012
740 Ga0496113_0265724
741 Ga0496114_0005840
742 Ga0496114_0062539
743 Ga0496114_0099235
744 Ga0496119_0055611
745 Ga0496120_0045544
746 Ga0501031_0252832
747 Ga0501034_0108279
748 Ga0501038_0069311
749 Ga0501038_0198195
750 Ga0501041_0105133
751 Ga0501042_0043971
752 Ga0501043_0297208
753 Ga0501048_0095810
754 Ga0501067_0002273
755 Ga0501067_0008529
756 Ga0501068_0118370
757 Ga0501069_0187954
758 Ga0501070_0004790
759 Ga0501071_0188486
760 Ga0501072_0007979
761 Ga0501072_0029373
762 Ga0501073_0004534
763 Ga0501073_0050190
764 Ga0501074_0003823
765 Ga0501074_0006262
766 Ga0501075_0039510
767 Ga0501077_0008990
768 Ga0501077_0076246
769 Ga0501077_0084000
770 Ga0501080_0020260
771 Ga0501080_0120803
772 Ga0501081_0046467
773 Ga0501083_0011848
774 Ga0501083_0089176
775 Ga0501044_0284916
776 Ga0501045_0003907
777 nmdc:mga03n38_2131_c1
778 nmdc:mga0yw44_9749_c1
779 nmdc:mga0rr50_104819_c1
780 Ga0495601_0055303
781 Ga0495612_0004302
782 Ga0495619_0068575
783 Ga0500566_0000308
784 Ga0501084_0000055
785 Ga0501084_0006746
786 Ga0501084_0115101
787 Ga0501082_0026310
788 Ga0501082_0160054
789 Ga0466962_0016420
790 Ga0466962_0077187
791 Ga0530510_0004338
792 Ga0530510_0124729

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12833

HTH_18

Helix-turn-helix domain

283

362

0.98

PF12852

Cupin_6

Cupin

48

245

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lsg-assembly3.cif.gz_E the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.9101 246 332
3mkl-assembly2.cif.gz_B crystal structure of dna-binding transcriptional dual regulator from escherichia coli k-12 0.9091 244 341
3lsg-assembly1.cif.gz_A the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.9014 246 340
3lsg-assembly2.cif.gz_D the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.896 246 332
3oio-assembly1.cif.gz_A crystal structure of transcriptional regulator (arac-type dna-binding domain-containing proteins) from chromobacterium violaceum 0.8929 237 341
ID Description Score Start End Superfamily
3lsgA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9879 298 340 1.10.10.60
af_P32677_219_275_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9787 294 343 1.10.10.60
3lsgE02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9711 298 332 1.10.10.60
af_P96245_143_250_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9449 240 340 1.10.10.60
3lsgB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9443 297 340 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A3S3GLA0-F1-model_v4 Helix-turn-helix domain-containing protein 0.9563 241 342 GO:0003700
GO:0043565
AF-A0A2W4NK05-F1-model_v4 deleted 0.9531 240 342
AF-A0A4R1WHT8-F1-model_v4 Helix-turn-helix protein 0.9525 243 342 GO:0003700
GO:0043565
AF-A0A1F8V3J0-F1-model_v4 HTH araC/xylS-type domain-containing protein 0.9508 245 340 GO:0003700
GO:0043565
AF-A0A081PEV2-F1-model_v4 HTH araC/xylS-type domain-containing protein 0.9466 243 342 GO:0003700
GO:0016020
GO:0043565

Map