F433556

General Info

Members Datasets Scaffolds Average Seq Length
396 242 344 174

Family's Representative Sequence

Representative Sequence 3300032004|Ga0307414_10541372|Ga0307414_105413722
Length 180
Sequence VSQALTLARPYARAAFGIARDESAASTGSFAAWSQSLGFAAQVAADPRVAGLVGDPRLSDDNAASLLASPGAGESFKRFLALLADNRRLALLPEIAGLYEELRNEAERVVKATVTSAAALPPAELEAIKAALRKRFGREVEVDTAIDETLIGGAVIDAGDVVIDGSLKGKLARLQSALAQ

Samples

Sample ID Description Type Environment
1 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
2 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
3 2643221559 Lysobacter sp. Root559 Isolate Unclassified
4 2643221573 Lysobacter sp. Root604 Isolate Unclassified
5 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
6 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
7 2643221586 Lysobacter sp. Root667 Isolate Unclassified
8 2643221593 Lysobacter sp. Root690 Isolate Unclassified
9 2643221612 Lysobacter sp. Root76 Isolate Unclassified
10 2643221720 Lysobacter sp. Root916 Isolate Unclassified
11 2643221727 Lysobacter sp. Root96 Isolate Unclassified
12 2643221728 Lysobacter sp. Root983 Isolate Unclassified
13 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
14 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
15 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
16 2818991457 Xanthomonas translucens 569 Isolate Unclassified
17 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
18 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
19 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
20 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
21 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
22 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
23 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
24 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
25 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
26 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
27 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
28 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
29 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
30 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
31 2919513703 Luteimonas sp. 3794 Isolate Unclassified
32 2919675420 Luteimonas terrae 4099 Isolate Unclassified
33 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
34 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
35 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
36 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
37 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
38 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
39 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
40 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
41 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
42 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
43 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
44 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
45 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
46 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
47 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
48 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
49 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
50 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
51 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
52 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
53 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
54 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
55 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
56 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
57 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
58 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
59 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
60 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
61 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
62 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
63 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
64 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
65 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
66 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
67 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
68 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
69 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
70 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
71 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
80 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
94 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
95 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
96 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
97 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
100 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
103 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
106 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
108 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
130 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
131 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
132 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
133 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
134 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
135 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
138 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
139 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
144 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
145 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
146 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
147 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
148 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
149 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
150 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
151 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
152 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
153 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
154 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
155 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
156 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
157 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
158 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
159 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
160 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
161 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
162 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
163 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
164 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
165 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
166 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
167 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
168 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
169 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
170 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
171 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
172 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
173 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
174 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
175 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
176 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
177 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
178 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
179 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
180 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
181 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
182 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
183 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
184 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
185 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
186 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
187 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
188 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
189 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
190 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
191 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
192 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
193 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
194 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
195 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
196 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
197 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
198 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
203 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
204 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
205 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
206 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
207 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
208 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
209 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
210 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
211 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
212 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
213 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
214 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
215 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
227 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
228 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
229 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
230 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
231 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
232 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
233 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
235 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
236 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
237 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
238 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
239 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
240 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
241 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
242 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.62
Metatranscriptomes 0.25
Isolates 13.13

Biome Distribution

Category Percentage (%)
Aerial Root 0.25
Bulb 0
Endosphere 15.91
Nodule 0.25
Rhizoplane 6.31
Rhizosphere 57.32
Stem 0
Stem Tuber 0
Unclassified 19.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10009995 3300003320 Bacteria 5112
2 Ga0055526_1004555 3300003771 Bacteria 8280
3 Ga0055526_1006844 3300003771 Bacteria 6081
4 Ga0055537_1000201 3300003773 Bacteria 44718
5 Ga0055537_1007483 3300003773 Bacteria 2626
6 Ga0055524_1000002 3300003775 Bacteria 459550
7 Ga0055524_1007287 3300003775 Bacteria 4720
8 Ga0055536_1021544 3300003781 Bacteria 1951
9 Ga0055536_1043536 3300003781 Bacteria 1042
10 Ga0055534_1000075 3300003784 Bacteria 77072
11 Ga0055534_1000274 3300003784 Bacteria 35160
12 Ga0055534_1010949 3300003784 Bacteria 1868
13 Ga0055534_1012734 3300003784 Bacteria 1649
14 Ga0055528_1000155 3300003790 Bacteria 56992
15 Ga0055528_1000437 3300003790 Bacteria 33420
16 Ga0055530_10000799 3300003791 Bacteria 26159
17 Ga0055530_10070322 3300003791 Bacteria 756
18 Ga0055530_10079734 3300003791 Bacteria 689
19 Ga0055531_10045796 3300003794 Bacteria 1210
20 Ga0058692_1000142 3300003856 Bacteria 45378
21 Ga0058692_1001824 3300003856 Bacteria 7508
22 Ga0065165_1027218 3300005262 Bacteria 1868
23 Ga0065704_10078641 3300005289 Bacteria 4370
24 Ga0065704_10085932 3300005289 Bacteria 3172
25 Ga0065704_10499727 3300005289 Bacteria 668
26 Ga0065715_10017168 3300005293 Bacteria 2076
27 Ga0065715_10100818 3300005293 Bacteria 3267
28 Ga0070670_100018144 3300005331 Bacteria 6038
29 Ga0070666_10206129 3300005335 Bacteria 1384
30 Ga0070689_100134494 3300005340 Bacteria 1985
31 Ga0070668_100567393 3300005347 Bacteria 989
32 Ga0070668_101178639 3300005347 Bacteria 693
33 Ga0070669_100005771 3300005353 Bacteria 8920
34 Ga0070669_100977410 3300005353 Bacteria 725
35 Ga0070675_100181968 3300005354 Bacteria 1818
36 Ga0070675_100836903 3300005354 Bacteria 842
37 Ga0070671_100274245 3300005355 Bacteria 1434
38 Ga0068853_100190613 3300005539 Bacteria 1862
39 Ga0070672_100479942 3300005543 Bacteria 1073
40 Ga0070665_100174346 3300005548 Bacteria 2151
41 Ga0070665_100322353 3300005548 Bacteria 1549
42 Ga0070665_100346916 3300005548 Bacteria 1490
43 Ga0070665_101247515 3300005548 Bacteria 754
44 Ga0068854_100181297 3300005578 Bacteria 1645
45 Ga0068862_100824784 3300005844 Bacteria 907
46 Ga0081539_10017294 3300005985 Bacteria 5072
47 Ga0075364_10040877 3300006051 Bacteria 3008
48 Ga0075364_10248279 3300006051 Bacteria 1209
49 Ga0075364_10288639 3300006051 Bacteria 1116
50 Ga0075364_10524900 3300006051 Bacteria 809
51 Ga0075367_10132359 3300006178 Bacteria 1542
52 Ga0097621_101562190 3300006237 Bacteria 627
53 Ga0075370_10139146 3300006353 Bacteria 1419
54 Ga0105251_10000074 3300009011 Bacteria 95770
55 Ga0105251_10004851 3300009011 Bacteria 8980
56 Ga0105244_10057653 3300009036 Bacteria 1962
57 Ga0105244_10101641 3300009036 Bacteria 1405
58 Ga0105244_10328359 3300009036 Bacteria 706
59 Ga0111539_10408272 3300009094 Bacteria 1582
60 Ga0105243_10009005 3300009148 Bacteria 7627
61 Ga0105241_11704407 3300009174 Bacteria 612
62 Ga0105029_100242 3300009984 Bacteria 2794
63 Ga0157373_10340426 3300013100 Bacteria 1069
64 Ga0157371_10922155 3300013102 Bacteria 663
65 Ga0157370_10120634 3300013104 Bacteria 2448
66 Ga0163162_10039451 3300013306 Bacteria 4719
67 Ga0157375_10418066 3300013308 Bacteria 1507
68 Ga0157380_10118849 3300014326 Bacteria 2235
69 Ga0157380_10246657 3300014326 Bacteria 1614
70 Ga0182008_10028992 3300014497 Bacteria 2798
71 Ga0182008_10078403 3300014497 Bacteria 1625
72 Ga0157377_10280281 3300014745 Bacteria 1092
73 Ga0182006_1039733 3300015261 Bacteria 1855
74 Ga0182006_1123231 3300015261 Bacteria 898
75 Ga0182006_1274125 3300015261 Bacteria 553
76 Ga0182007_10000137 3300015262 Bacteria 50535
77 Ga0182005_1001048 3300015265 Bacteria 11692
78 Ga0182005_1021208 3300015265 Bacteria 1783
79 Ga0183360_10003 3300015689 Bacteria 713221
80 Ga0183361_10129 3300016635 Bacteria 2490
81 Ga0163161_10250648 3300017792 Bacteria 1380
82 Ga0163161_10647645 3300017792 Bacteria 875
83 Ga0207425_1003533 3300025245 Bacteria 4972
84 Ga0209565_1000002 3300025263 Bacteria 1423083
85 Ga0209565_1000050 3300025263 Bacteria 213856
86 Ga0209673_1000002 3300025273 Bacteria 1423083
87 Ga0209673_1000958 3300025273 Bacteria 36028
88 Ga0209130_1002233 3300025284 Bacteria 10123
89 Ga0209130_1009319 3300025284 Bacteria 2810
90 Ga0209675_1000002 3300025291 Bacteria 1423083
91 Ga0209675_1000007 3300025291 Bacteria 683430
92 Ga0209676_1000018 3300025292 Bacteria 631385
93 Ga0209676_1000063 3300025292 Bacteria 322025
94 Ga0209676_1003236 3300025292 Bacteria 10277
95 Ga0209676_1045664 3300025292 Bacteria 1190
96 Ga0209676_1060045 3300025292 Bacteria 951
97 Ga0209676_1108123 3300025292 Bacteria 579
98 Ga0209025_1000030 3300025294 Bacteria 441196
99 Ga0209025_1015025 3300025294 Bacteria 4704
100 Ga0209564_1000004 3300025295 Bacteria 1424639
101 Ga0209564_1000061 3300025295 Bacteria 322795
102 Ga0209564_1006339 3300025295 Bacteria 6417
103 Ga0209758_1017855 3300025297 Bacteria 3507
104 Ga0209050_1001409 3300025298 Bacteria 26088
105 Ga0209050_1008410 3300025298 Bacteria 5526
106 Ga0209256_1000004 3300025299 Bacteria 1424643
107 Ga0209256_1002580 3300025299 Bacteria 14451
108 Ga0209256_1010668 3300025299 Bacteria 3806
109 Ga0209051_1004285 3300025303 Bacteria 8873
110 Ga0209051_1005816 3300025303 Bacteria 7096
111 Ga0209257_1000035 3300025304 Bacteria 631463
112 Ga0209257_1001076 3300025304 Bacteria 35902
113 Ga0209257_1004672 3300025304 Bacteria 10304
114 Ga0207713_1000311 3300025735 Bacteria 55596
115 Ga0207713_1043465 3300025735 Bacteria 1856
116 Ga0207680_10226434 3300025903 Bacteria 1284
117 Ga0207681_10003350 3300025923 Bacteria 10031
118 Ga0207681_10068707 3300025923 Bacteria 2462
119 Ga0207681_10277138 3300025923 Bacteria 1319
120 Ga0207681_10354760 3300025923 Bacteria 1175
121 Ga0207681_11005825 3300025923 Bacteria 699
122 Ga0207650_10002487 3300025925 Bacteria 12814
123 Ga0207650_10016249 3300025925 Bacteria 5199
124 Ga0207659_10237157 3300025926 Bacteria 1474
125 Ga0207659_10418497 3300025926 Bacteria 1123
126 Ga0207644_10061362 3300025931 Bacteria 2723
127 Ga0207709_10000959 3300025935 Bacteria 21577
128 Ga0207709_10002579 3300025935 Bacteria 11285
129 Ga0207691_10057963 3300025940 Bacteria 3523
130 Ga0207711_11540494 3300025941 Bacteria 608
131 Ga0207679_11595021 3300025945 Bacteria 598
132 Ga0207651_10857162 3300025960 Bacteria 808
133 Ga0207668_10097233 3300025972 Bacteria 2178
134 Ga0207648_11334662 3300026089 Bacteria 674
135 Ga0207683_10077184 3300026121 Bacteria 2950
136 Ga0209371_1000018 3300027312 Bacteria 614700
137 Ga0209371_1000048 3300027312 Bacteria 281705
138 Ga0268266_10063684 3300028379 Bacteria 3183
139 Ga0268266_10104634 3300028379 Bacteria 2499
140 Ga0268266_11236671 3300028379 Bacteria 722
141 Ga0268265_10829335 3300028380 Bacteria 903
142 Ga0307515_10518887 3300028794 Bacteria 801
143 Ga0268256_1000016 3300030500 Bacteria 614700
144 Ga0268256_1000049 3300030500 Bacteria 307229
145 Ga0316176_1048551 3300030732 Bacteria 1832
146 Ga0314311_1211600 3300030733 Bacteria 834
147 Ga0316178_1066331 3300030735 Bacteria 795
148 Ga0316180_1169024 3300030736 Bacteria 3075
149 Ga0307513_10012750 3300031456 Bacteria 10353
150 Ga0307408_100273966 3300031548 Bacteria 1402
151 Ga0307408_100850418 3300031548 Bacteria 832
152 Ga0307514_10336595 3300031649 Bacteria 816
153 Ga0307413_10502130 3300031824 Bacteria 974
154 Ga0307406_10272076 3300031901 Bacteria 1287
155 Ga0307406_10371190 3300031901 Bacteria 1125
156 Ga0307412_10685359 3300031911 Bacteria 878
157 Ga0307412_10969709 3300031911 Bacteria 749
158 Ga0307412_11336966 3300031911 Bacteria 646
159 Ga0307414_10003429 3300032004 Bacteria 8459
160 Ga0307414_10021366 3300032004 Bacteria 4059
161 Ga0307414_10094000 3300032004 Bacteria 2236
162 Ga0307414_10106026 3300032004 Bacteria 2126
163 Ga0307414_10385286 3300032004 Bacteria 1213
164 Ga0307414_10452350 3300032004 Bacteria 1126
165 Ga0307414_10541372 3300032004 Bacteria 1036
166 Ga0307414_10823694 3300032004 Bacteria 847
167 Ga0307414_11259706 3300032004 Bacteria 685
168 Ga0307411_10231968 3300032005 Bacteria 1439
169 Ga0307411_10290083 3300032005 Bacteria 1307
170 Ga0307411_10562260 3300032005 Bacteria 975
171 Ga0373944_0137390 3300035089 Bacteria 854
172 Ga0373925_1105213 3300037068 Unclassified 652
173 Ga0237819_14410 3300038705 Bacteria 930
174 Ga0237816_01202 3300039145 Bacteria 2124
175 Ga0439436_0008310 3300041404 Bacteria 3189
176 Ga0439436_0016337 3300041404 Bacteria 2227
177 Ga0439436_0038388 3300041404 Bacteria 1377
178 Ga0439436_0109411 3300041404 Bacteria 771
179 Ga0439439_0001243 3300041406 Bacteria 4953
180 Ga0439461_0023890 3300041410 Bacteria 1232
181 Ga0439465_0002733 3300041413 Bacteria 5767
182 Ga0439465_0006838 3300041413 Bacteria 3624
183 Ga0439465_0017959 3300041413 Bacteria 2210
184 Ga0439465_0018015 3300041413 Bacteria 2206
185 Ga0439465_0114124 3300041413 Bacteria 942
186 Ga0451787_375349 3300041441 Bacteria 596
187 Ga0451787_617797 3300041441 Bacteria 854
188 Ga0451791_1218095 3300041451 Bacteria 841
189 Ga0451791_1372475 3300041451 Bacteria 1203
190 Ga0451793_0777129 3300041452 Bacteria 2819
191 Ga0451797_0495261 3300041453 Bacteria 1875
192 Ga0451797_0545173 3300041453 Bacteria 1372
193 Ga0451797_0771867 3300041453 Bacteria 925
194 Ga0451795_1214017 3300041456 Bacteria 1217
195 Ga0451798_1171009 3300041458 Bacteria 1374
196 Ga0451800_0149708 3300041459 Bacteria 1060
197 Ga0451800_0797096 3300041459 Bacteria 4965
198 Ga0451802_0884482 3300041460 Bacteria 1190
199 Ga0451802_1681777 3300041460 Bacteria 892
200 Ga0451806_060780 3300041462 Bacteria 9628
201 Ga0451807_1769360 3300041486 Bacteria 4434
202 Ga0451807_1948303 3300041486 Bacteria 829
203 Ga0451807_2101887 3300041486 Bacteria 579
204 Ga0451807_2311883 3300041486 Bacteria 2160
205 Ga0451807_2689742 3300041486 Bacteria 794
206 Ga0451837_0056059 3300041494 Bacteria 1174
207 Ga0451837_0438379 3300041494 Bacteria 889
208 Ga0451837_1379588 3300041494 Bacteria 1337
209 Ga0451837_1590092 3300041494 Bacteria 1261
210 Ga0451839_1039621 3300041496 Bacteria 1016
211 Ga0451839_1448608 3300041496 Bacteria 583
212 Ga0451841_0506754 3300041498 Bacteria 874
213 Ga0451841_1379153 3300041498 Bacteria 1410
214 Ga0451843_0521013 3300041509 Bacteria 3149
215 Ga0451843_0523403 3300041509 Bacteria 801
216 Ga0451843_0936005 3300041509 Bacteria 1166
217 Ga0451843_1490071 3300041509 Bacteria 878
218 Ga0451855_0380233 3300041511 Bacteria 1009
219 Ga0451853_0722649 3300041512 Bacteria 969
220 Ga0439431_0036006 3300041997 Bacteria 1245
221 Ga0439445_0006297 3300042004 Bacteria 2726
222 Ga0439445_0038519 3300042004 Bacteria 1264
223 Ga0439432_054066 3300042006 Bacteria 1248
224 Ga0439432_085632 3300042006 Bacteria 951
225 Ga0439449_0000121 3300042007 Bacteria 25934
226 Ga0439449_0059939 3300042007 Bacteria 1404
227 Ga0439449_0070646 3300042007 Bacteria 1286
228 Ga0439449_0156120 3300042007 Bacteria 851
229 Ga0439449_0156834 3300042007 Bacteria 849
230 Ga0439455_0075801 3300042012 Bacteria 909
231 Ga0439462_0035294 3300042015 Bacteria 1329
232 Ga0439462_0064126 3300042015 Bacteria 995
233 Ga0450899_031352 3300042135 Bacteria 647
234 Ga0495638_0327418 3300046460 Bacteria 816
235 Ga0495605_0227437 3300046474 Bacteria 804
236 Ga0495607_0009364 3300046501 Bacteria 6631
237 Ga0495606_0013360 3300046507 Bacteria 6492
238 Ga0495610_0015708 3300046512 Bacteria 4389
239 Ga0495610_0051897 3300046512 Bacteria 1993
240 Ga0495616_0017533 3300046513 Bacteria 3949
241 Ga0495616_0056000 3300046513 Bacteria 1949
242 Ga0495632_0056091 3300046519 Bacteria 1927
243 Ga0495643_0007780 3300046522 Bacteria 6855
244 Ga0495643_0111135 3300046522 Bacteria 1393
245 Ga0495663_0002247 3300046525 Bacteria 5868
246 Ga0495663_0030772 3300046525 Bacteria 1592
247 Ga0495663_0103333 3300046525 Bacteria 940
248 Ga0495654_0156933 3300046530 Bacteria 1002
249 Ga0495598_0002579 3300046537 Bacteria 3749
250 Ga0495598_0041783 3300046537 Bacteria 1343
251 Ga0495621_0024149 3300046539 Bacteria 2028
252 Ga0495633_0012679 3300046558 Bacteria 4472
253 Ga0495633_0065502 3300046558 Bacteria 1697
254 Ga0495633_0105842 3300046558 Bacteria 1305
255 Ga0495633_0570578 3300046558 Bacteria 509
256 Ga0495656_0003126 3300046615 Bacteria 5567
257 Ga0495668_0002136 3300046616 Bacteria 17033
258 Ga0495625_0198518 3300046660 Bacteria 1325
259 Ga0495658_0124959 3300046683 Bacteria 1560
260 Ga0495670_0099120 3300046691 Bacteria 1499
261 Ga0495671_0042214 3300046692 Bacteria 2293
262 Ga0495660_0075889 3300046810 Bacteria 1772
263 Ga0495636_0004247 3300047318 Bacteria 5620
264 Ga0495672_0005636 3300047320 Bacteria 9882
265 Ga0495681_0033734 3300047470 Bacteria 2559
266 Ga0495686_0024353 3300047472 Bacteria 3979
267 Ga0495615_0008758 3300048090 Bacteria 1967
268 Ga0496104_0952204 3300048907 Bacteria 763
269 Ga0496105_0302835 3300048908 Bacteria 1284
270 Ga0496110_0894256 3300048913 Bacteria 794
271 Ga0496113_0489118 3300048916 Bacteria 988
272 Ga0496114_0231793 3300048917 Bacteria 1622
273 Ga0496116_0084278 3300048919 Bacteria 1958
274 Ga0496116_0133115 3300048919 Bacteria 1413
275 Ga0496117_0377688 3300048920 Bacteria 722
276 Ga0496118_0014400 3300048921 Bacteria 7406
277 Ga0496118_0137854 3300048921 Bacteria 1553
278 Ga0496118_0181800 3300048921 Bacteria 1269
279 Ga0496119_0001745 3300048922 Bacteria 25344
280 Ga0496119_0015453 3300048922 Bacteria 5875
281 Ga0496120_0000196 3300048923 Bacteria 103427
282 Ga0496120_0012258 3300048923 Bacteria 5843
283 Ga0496121_0000724 3300048924 Bacteria 61072
284 Ga0496121_0547624 3300048924 Bacteria 724
285 Ga0496122_0020019 3300048925 Bacteria 6078
286 Ga0496122_0067695 3300048925 Bacteria 2570
287 Ga0496122_0079429 3300048925 Bacteria 2292
288 Ga0496122_0158138 3300048925 Bacteria 1386
289 Ga0496123_0016813 3300048926 Bacteria 5914
290 Ga0496123_0101932 3300048926 Bacteria 1667
291 Ga0496123_0348463 3300048926 Bacteria 689
292 Ga0496124_0022045 3300048927 Bacteria 5850
293 Ga0496124_0038401 3300048927 Bacteria 4159
294 Ga0496124_0548069 3300048927 Bacteria 764
295 Ga0496124_0668502 3300048927 Bacteria 663
296 Ga0496124_0692136 3300048927 Bacteria 647
297 Ga0496124_0710797 3300048927 Bacteria 635
298 Ga0496125_0553933 3300048928 Bacteria 636
299 Ga0496125_0583352 3300048928 Bacteria 613
300 Ga0496126_0001087 3300048929 Bacteria 45711
301 Ga0496126_0179815 3300048929 Bacteria 1797
302 Ga0496126_0771399 3300048929 Bacteria 740
303 Ga0501304_001273 3300049160 Bacteria 1587
304 Ga0501031_0012690 3300049568 Bacteria 5503
305 Ga0501031_0053357 3300049568 Bacteria 2634
306 Ga0501032_0037402 3300049569 Bacteria 3310
307 Ga0501032_0081899 3300049569 Bacteria 2147
308 Ga0501033_0156211 3300049570 Bacteria 1644
309 Ga0501033_0177752 3300049570 Bacteria 1526
310 Ga0501034_0030305 3300049571 Bacteria 5498
311 Ga0501034_0063240 3300049571 Bacteria 3714
312 Ga0501036_0015568 3300049572 Bacteria 6354
313 Ga0501036_1260468 3300049572 Bacteria 601
314 Ga0501037_0007296 3300049573 Bacteria 8082
315 Ga0501037_0741111 3300049573 Bacteria 651
316 Ga0501038_0028108 3300049574 Bacteria 4996
317 Ga0501038_0054379 3300049574 Bacteria 3443
318 Ga0501039_0038157 3300049575 Bacteria 3711
319 Ga0501039_0175288 3300049575 Bacteria 1686
320 Ga0501043_0002784 3300049579 Bacteria 14613
321 Ga0501043_0078822 3300049579 Bacteria 2588
322 Ga0501043_0376525 3300049579 Bacteria 1075
323 Ga0501047_0113540 3300049581 Bacteria 2591
324 Ga0501047_0215483 3300049581 Bacteria 1777
325 Ga0501068_0046015 3300049584 Bacteria 2630
326 Ga0501070_0043785 3300049586 Bacteria 3725
327 Ga0501070_0110292 3300049586 Bacteria 2274
328 Ga0501071_0203052 3300049587 Bacteria 1489
329 Ga0501073_0108149 3300049589 Bacteria 1929
330 Ga0501080_0051035 3300049742 Bacteria 3848
331 Ga0501080_0185640 3300049742 Bacteria 1912
332 Ga0501265_009361 3300049762 Bacteria 1183
333 Ga0501275_002960 3300049772 Bacteria 1558
334 Ga0501035_0003173 3300049822 Bacteria 15770
335 Ga0501035_0156832 3300049822 Bacteria 1972
336 Ga0501044_0008103 3300049823 Bacteria 11532
337 Ga0501044_0044423 3300049823 Bacteria 4610
338 nmdc:mga03n38_476497_c1 3300050490 Bacteria 697
339 nmdc:mga00v17_147656_c1 3300050491 Bacteria 1510
340 nmdc:mga00v17_148238_c1 3300050491 Bacteria 1507
341 nmdc:mga00v17_390423_c1 3300050491 Bacteria 905
342 nmdc:mga00v17_9971_c1 3300050491 Bacteria 5168
343 nmdc:mga06z11_436549_c1 3300050494 Bacteria 790
344 Ga0500634_0011986 3300053161 Bacteria 4497

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046558 Ga0495633_0570578 Ga0495633_0570578_58_492 144
2 3300041441 Ga0451787_375349 Ga0451787_375349_43_519 158
3 3300041486 Ga0451807_2101887 Ga0451807_2101887_21_497 158
4 3300046525 Ga0495663_0002247 Ga0495663_0002247_483_959 158
5 3300046692 Ga0495671_0042214 Ga0495671_0042214_40_516 158
6 3300013104 Ga0157370_10120634 Ga0157370_101206344 160
7 3300014497 Ga0182008_10078403 Ga0182008_100784032 160
8 3300030732 Ga0316176_1048551 Ga0316176_10485512 160
9 3300032004 Ga0307414_10021366 Ga0307414_100213666 160
10 3300041496 Ga0451839_1448608 Ga0451839_1448608_41_568 160
11 3300041498 Ga0451841_1379153 Ga0451841_1379153_493_1020 160
12 3300041509 Ga0451843_1490071 Ga0451843_1490071_224_751 160
13 3300046460 Ga0495638_0327418 Ga0495638_0327418_100_627 160
14 3300048920 Ga0496117_0377688 Ga0496117_0377688_99_626 160
15 3300048921 Ga0496118_0014400 Ga0496118_0014400_123_650 160
16 3300048921 Ga0496118_0181800 Ga0496118_0181800_99_626 160
17 3300048924 Ga0496121_0547624 Ga0496121_0547624_101_628 160
18 3300048925 Ga0496122_0158138 Ga0496122_0158138_739_1266 160
19 3300048927 Ga0496124_0668502 Ga0496124_0668502_121_648 160
20 3300048927 Ga0496124_0710797 Ga0496124_0710797_91_618 161
21 3300041452 Ga0451793_0777129 Ga0451793_0777129_1060_1587 162
22 3300041459 Ga0451800_0797096 Ga0451800_0797096_984_1511 162
23 3300041462 Ga0451806_060780 Ga0451806_060780_4020_4547 162
24 3300041486 Ga0451807_1769360 Ga0451807_1769360_3602_4129 162
25 3300006051 Ga0075364_10524900 Ga0075364_105249002 171
26 iso_pu_bacteria 2547132130 2547503627 171
27 iso_pu_bacteria 2576861471 2578456889 171
28 iso_pu_bacteria 2643221559 2643816896 171
29 iso_pu_bacteria 2643221573 2643881183 171
30 iso_pu_bacteria 2643221579 2643908306 171
31 iso_pu_bacteria 2643221581 2643914605 171
32 iso_pu_bacteria 2643221586 2643939316 171
33 iso_pu_bacteria 2643221593 2643977418 171
34 iso_pu_bacteria 2643221612 2644077998 171
35 iso_pu_bacteria 2643221720 2644661955 171
36 iso_pu_bacteria 2643221727 2644696299 171
37 iso_pu_bacteria 2643221728 2644700094 171
38 iso_pu_bacteria 2747842428 2747948594 171
39 iso_pu_bacteria 2765235840 2765580638 171
40 iso_pu_bacteria 2816332141 2816518371 171
41 iso_pu_bacteria 2818991457 2819662428 171
42 iso_pu_bacteria 2842391507 2842395125 171
43 iso_pu_bacteria 2842757796 2842758911 171
44 iso_pu_bacteria 2852649853 2852652045 171
45 iso_pu_bacteria 2852684882 2852687855 171
46 iso_pu_bacteria 2857442823 2857444271 171
47 iso_pu_bacteria 2874220319 2874223276 171
48 iso_pu_bacteria 2894414249 2894416618 171
49 iso_pu_bacteria 2895498888 2895499835 171
50 iso_pu_bacteria 2895511927 2895512811 171
51 iso_pu_bacteria 2895522137 2895522826 171
52 iso_pu_bacteria 2895525241 2895525401 171
53 iso_pu_bacteria 2919089067 2919092353 171
54 iso_pu_bacteria 2919130084 2919131976 171
55 iso_pu_bacteria 2919134579 2919137071 171
56 iso_pu_bacteria 2919513703 2919517067 171
57 iso_pu_bacteria 2919675420 2919678945 171
58 iso_pu_bacteria 2928496128 2928500277 171
59 iso_pu_bacteria 2929195423 2929199285 171
60 iso_pu_bacteria 2931380184 2931383287 171
61 iso_pu_bacteria 2937610967 2937614261 171
62 iso_pu_bacteria 2939589442 2939589905 171
63 iso_pu_bacteria 2939622612 2939625030 171
64 iso_pu_bacteria 2939626828 2939629229 171
65 iso_pu_bacteria 2941475908 2941478668 171
66 iso_pu_bacteria 2941489479 2941493280 171
67 iso_pu_bacteria 2961047084 2961050040 171
68 iso_pu_bacteria 2961064222 2961064805 171
69 iso_pu_bacteria 2974307012 2974307550 171
70 iso_pu_bacteria 2977247770 2977248263 171
71 iso_pu_bacteria 2984514374 2984517246 171
72 iso_pu_bacteria 2987605356 2987608941 171
73 iso_pu_bacteria 2995948881 2995953406 171
74 iso_pu_bacteria 8003014200 8003017553 171
75 iso_pu_bacteria 8021622325 8021624082 171
76 iso_pu_bacteria 8021626552 8021628329 171
77 iso_pu_bacteria 8021648035 8021648366 171
78 3300006051 Ga0075364_10248279 Ga0075364_102482792 173
79 3300050491 nmdc:mga00v17_148238_c1 nmdc:mga00v17_148238_c1_753_1274 173
80 3300003320 rootH2_10009995 rootH2_100099952 175
81 3300003771 Ga0055526_1004555 Ga0055526_10045559 175
82 3300003771 Ga0055526_1006844 Ga0055526_10068444 175
83 3300003773 Ga0055537_1000201 Ga0055537_100020110 175
84 3300003773 Ga0055537_1007483 Ga0055537_10074833 175
85 3300003775 Ga0055524_1000002 Ga0055524_1000002401 175
86 3300003775 Ga0055524_1007287 Ga0055524_10072875 175
87 3300003781 Ga0055536_1021544 Ga0055536_10215442 175
88 3300003781 Ga0055536_1043536 Ga0055536_10435362 175
89 3300003784 Ga0055534_1000075 Ga0055534_10000754 175
90 3300003784 Ga0055534_1000274 Ga0055534_100027418 175
91 3300003784 Ga0055534_1010949 Ga0055534_10109491 175
92 3300003784 Ga0055534_1012734 Ga0055534_10127342 175
93 3300003790 Ga0055528_1000155 Ga0055528_100015545 175
94 3300003790 Ga0055528_1000437 Ga0055528_100043712 175
95 3300003791 Ga0055530_10000799 Ga0055530_1000079928 175
96 3300003791 Ga0055530_10070322 Ga0055530_100703222 175
97 3300003791 Ga0055530_10079734 Ga0055530_100797341 175
98 3300003794 Ga0055531_10045796 Ga0055531_100457962 175
99 3300003856 Ga0058692_1000142 Ga0058692_100014248 175
100 3300003856 Ga0058692_1001824 Ga0058692_10018247 175
101 3300005262 Ga0065165_1027218 Ga0065165_10272182 175
102 3300005289 Ga0065704_10078641 Ga0065704_100786412 175
103 3300005289 Ga0065704_10085932 Ga0065704_100859322 175
104 3300005289 Ga0065704_10499727 Ga0065704_104997271 175
105 3300005293 Ga0065715_10017168 Ga0065715_100171682 175
106 3300005293 Ga0065715_10100818 Ga0065715_101008184 175
107 3300005331 Ga0070670_100018144 Ga0070670_1000181442 175
108 3300005335 Ga0070666_10206129 Ga0070666_102061291 175
109 3300005340 Ga0070689_100134494 Ga0070689_1001344942 175
110 3300005347 Ga0070668_100567393 Ga0070668_1005673932 175
111 3300005347 Ga0070668_101178639 Ga0070668_1011786391 175
112 3300005353 Ga0070669_100005771 Ga0070669_10000577111 175
113 3300005353 Ga0070669_100977410 Ga0070669_1009774101 175
114 3300005354 Ga0070675_100181968 Ga0070675_1001819682 175
115 3300005354 Ga0070675_100836903 Ga0070675_1008369032 175
116 3300005355 Ga0070671_100274245 Ga0070671_1002742452 175
117 3300005539 Ga0068853_100190613 Ga0068853_1001906132 175
118 3300005543 Ga0070672_100479942 Ga0070672_1004799422 175
119 3300005548 Ga0070665_100174346 Ga0070665_1001743462 175
120 3300005548 Ga0070665_100322353 Ga0070665_1003223532 175
121 3300005548 Ga0070665_100346916 Ga0070665_1003469162 175
122 3300005548 Ga0070665_101247515 Ga0070665_1012475152 175
123 3300005578 Ga0068854_100181297 Ga0068854_1001812972 175
124 3300005844 Ga0068862_100824784 Ga0068862_1008247841 175
125 3300005985 Ga0081539_10017294 Ga0081539_100172942 175
126 3300006051 Ga0075364_10040877 Ga0075364_100408774 175
127 3300006051 Ga0075364_10288639 Ga0075364_102886392 175
128 3300006178 Ga0075367_10132359 Ga0075367_101323592 175
129 3300006237 Ga0097621_101562190 Ga0097621_1015621901 175
130 3300006353 Ga0075370_10139146 Ga0075370_101391462 175
131 3300009011 Ga0105251_10000074 Ga0105251_1000007490 175
132 3300009011 Ga0105251_10004851 Ga0105251_100048519 175
133 3300009036 Ga0105244_10057653 Ga0105244_100576534 175
134 3300009036 Ga0105244_10101641 Ga0105244_101016413 175
135 3300009036 Ga0105244_10328359 Ga0105244_103283592 175
136 3300009094 Ga0111539_10408272 Ga0111539_104082722 175
137 3300009148 Ga0105243_10009005 Ga0105243_100090059 175
138 3300009174 Ga0105241_11704407 Ga0105241_117044071 175
139 3300009984 Ga0105029_100242 Ga0105029_1002422 175
140 3300013100 Ga0157373_10340426 Ga0157373_103404261 175
141 3300013102 Ga0157371_10922155 Ga0157371_109221552 175
142 3300013306 Ga0163162_10039451 Ga0163162_100394516 175
143 3300013308 Ga0157375_10418066 Ga0157375_104180662 175
144 3300014326 Ga0157380_10118849 Ga0157380_101188494 175
145 3300014326 Ga0157380_10246657 Ga0157380_102466572 175
146 3300014497 Ga0182008_10028992 Ga0182008_100289921 175
147 3300014745 Ga0157377_10280281 Ga0157377_102802812 175
148 3300015261 Ga0182006_1039733 Ga0182006_10397332 175
149 3300015261 Ga0182006_1123231 Ga0182006_11232311 175
150 3300015261 Ga0182006_1274125 Ga0182006_12741251 175
151 3300015262 Ga0182007_10000137 Ga0182007_100001372 175
152 3300015265 Ga0182005_1001048 Ga0182005_10010481 175
153 3300015265 Ga0182005_1021208 Ga0182005_10212083 175
154 3300015689 Ga0183360_10003 Ga0183360_10003191 175
155 3300016635 Ga0183361_10129 Ga0183361_101292 175
156 3300017792 Ga0163161_10250648 Ga0163161_102506483 175
157 3300017792 Ga0163161_10647645 Ga0163161_106476452 175
158 3300025245 Ga0207425_1003533 Ga0207425_10035339 175
159 3300025263 Ga0209565_1000002 Ga0209565_1000002190 175
160 3300025263 Ga0209565_1000050 Ga0209565_1000050170 175
161 3300025273 Ga0209673_1000002 Ga0209673_1000002190 175
162 3300025273 Ga0209673_1000958 Ga0209673_100095813 175
163 3300025284 Ga0209130_1002233 Ga0209130_10022339 175
164 3300025284 Ga0209130_1009319 Ga0209130_10093195 175
165 3300025291 Ga0209675_1000002 Ga0209675_1000002190 175
166 3300025291 Ga0209675_1000007 Ga0209675_1000007496 175
167 3300025292 Ga0209676_1000018 Ga0209676_100001893 175
168 3300025292 Ga0209676_1000063 Ga0209676_1000063207 175
169 3300025292 Ga0209676_1003236 Ga0209676_10032368 175
170 3300025292 Ga0209676_1045664 Ga0209676_10456641 175
171 3300025292 Ga0209676_1060045 Ga0209676_10600452 175
172 3300025292 Ga0209676_1108123 Ga0209676_11081231 175
173 3300025294 Ga0209025_1000030 Ga0209025_1000030306 175
174 3300025294 Ga0209025_1015025 Ga0209025_10150254 175
175 3300025295 Ga0209564_1000004 Ga0209564_1000004191 175
176 3300025295 Ga0209564_1000061 Ga0209564_1000061269 175
177 3300025295 Ga0209564_1006339 Ga0209564_10063395 175
178 3300025297 Ga0209758_1017855 Ga0209758_10178553 175
179 3300025298 Ga0209050_1001409 Ga0209050_100140918 175
180 3300025298 Ga0209050_1008410 Ga0209050_10084104 175
181 3300025299 Ga0209256_1000004 Ga0209256_1000004191 175
182 3300025299 Ga0209256_1002580 Ga0209256_10025802 175
183 3300025299 Ga0209256_1010668 Ga0209256_10106682 175
184 3300025303 Ga0209051_1004285 Ga0209051_10042857 175
185 3300025303 Ga0209051_1005816 Ga0209051_10058164 175
186 3300025304 Ga0209257_1000035 Ga0209257_100003593 175
187 3300025304 Ga0209257_1001076 Ga0209257_100107622 175
188 3300025304 Ga0209257_1004672 Ga0209257_10046724 175
189 3300025735 Ga0207713_1000311 Ga0207713_100031134 175
190 3300025735 Ga0207713_1043465 Ga0207713_10434654 175
191 3300025903 Ga0207680_10226434 Ga0207680_102264341 175
192 3300025923 Ga0207681_10003350 Ga0207681_1000335010 175
193 3300025923 Ga0207681_10068707 Ga0207681_100687072 175
194 3300025923 Ga0207681_10277138 Ga0207681_102771382 175
195 3300025923 Ga0207681_10354760 Ga0207681_103547602 175
196 3300025923 Ga0207681_11005825 Ga0207681_110058252 175
197 3300025925 Ga0207650_10002487 Ga0207650_100024874 175
198 3300025925 Ga0207650_10016249 Ga0207650_100162496 175
199 3300025926 Ga0207659_10237157 Ga0207659_102371572 175
200 3300025926 Ga0207659_10418497 Ga0207659_104184972 175
201 3300025931 Ga0207644_10061362 Ga0207644_100613625 175
202 3300025935 Ga0207709_10000959 Ga0207709_100009595 175
203 3300025935 Ga0207709_10002579 Ga0207709_1000257912 175
204 3300025940 Ga0207691_10057963 Ga0207691_100579633 175
205 3300025941 Ga0207711_11540494 Ga0207711_115404941 175
206 3300025945 Ga0207679_11595021 Ga0207679_115950211 175
207 3300025960 Ga0207651_10857162 Ga0207651_108571621 175
208 3300025972 Ga0207668_10097233 Ga0207668_100972332 175
209 3300026089 Ga0207648_11334662 Ga0207648_113346621 175
210 3300026121 Ga0207683_10077184 Ga0207683_100771841 175
211 3300027312 Ga0209371_1000018 Ga0209371_1000018463 175
212 3300027312 Ga0209371_1000048 Ga0209371_1000048127 175
213 3300028379 Ga0268266_10063684 Ga0268266_100636842 175
214 3300028379 Ga0268266_10104634 Ga0268266_101046344 175
215 3300028379 Ga0268266_11236671 Ga0268266_112366712 175
216 3300028380 Ga0268265_10829335 Ga0268265_108293352 175
217 3300028794 Ga0307515_10518887 Ga0307515_105188872 175
218 3300030500 Ga0268256_1000016 Ga0268256_1000016463 175
219 3300030500 Ga0268256_1000049 Ga0268256_1000049141 175
220 3300030733 Ga0314311_1211600 Ga0314311_12116001 175
221 3300030735 Ga0316178_1066331 Ga0316178_10663312 175
222 3300030736 Ga0316180_1169024 Ga0316180_11690242 175
223 3300031456 Ga0307513_10012750 Ga0307513_100127502 175
224 3300031548 Ga0307408_100273966 Ga0307408_1002739662 175
225 3300031548 Ga0307408_100850418 Ga0307408_1008504182 175
226 3300031649 Ga0307514_10336595 Ga0307514_103365951 175
227 3300031824 Ga0307413_10502130 Ga0307413_105021302 175
228 3300031901 Ga0307406_10272076 Ga0307406_102720762 175
229 3300031901 Ga0307406_10371190 Ga0307406_103711902 175
230 3300031911 Ga0307412_10685359 Ga0307412_106853591 175
231 3300031911 Ga0307412_10969709 Ga0307412_109697091 175
232 3300031911 Ga0307412_11336966 Ga0307412_113369661 175
233 3300032004 Ga0307414_10003429 Ga0307414_100034298 175
234 3300032004 Ga0307414_10094000 Ga0307414_100940003 175
235 3300032004 Ga0307414_10106026 Ga0307414_101060264 175
236 3300032004 Ga0307414_10385286 Ga0307414_103852862 175
237 3300032004 Ga0307414_10452350 Ga0307414_104523502 175
238 3300032004 Ga0307414_10541372 Ga0307414_105413722 175
239 3300032004 Ga0307414_10823694 Ga0307414_108236942 175
240 3300032004 Ga0307414_11259706 Ga0307414_112597062 175
241 3300032005 Ga0307411_10231968 Ga0307411_102319681 175
242 3300032005 Ga0307411_10290083 Ga0307411_102900832 175
243 3300032005 Ga0307411_10562260 Ga0307411_105622602 175
244 3300035089 Ga0373944_0137390 Ga0373944_0137390_152_685 175
245 3300037068 Ga0373925_1105213 Ga0373925_1105213_21_554 175
246 3300038705 Ga0237819_14410 Ga0237819_14410_82_609 175
247 3300039145 Ga0237816_01202 Ga0237816_01202_852_1379 175
248 3300041404 Ga0439436_0008310 Ga0439436_0008310_2337_2864 175
249 3300041404 Ga0439436_0016337 Ga0439436_0016337_1318_1845 175
250 3300041404 Ga0439436_0038388 Ga0439436_0038388_181_708 175
251 3300041404 Ga0439436_0109411 Ga0439436_0109411_150_692 175
252 3300041406 Ga0439439_0001243 Ga0439439_0001243_4219_4746 175
253 3300041410 Ga0439461_0023890 Ga0439461_0023890_292_819 175
254 3300041413 Ga0439465_0002733 Ga0439465_0002733_291_818 175
255 3300041413 Ga0439465_0006838 Ga0439465_0006838_420_947 175
256 3300041413 Ga0439465_0017959 Ga0439465_0017959_487_1014 175
257 3300041413 Ga0439465_0018015 Ga0439465_0018015_1208_1735 175
258 3300041413 Ga0439465_0114124 Ga0439465_0114124_189_716 175
259 3300041441 Ga0451787_617797 Ga0451787_617797_220_747 175
260 3300041451 Ga0451791_1218095 Ga0451791_1218095_233_760 175
261 3300041451 Ga0451791_1372475 Ga0451791_1372475_361_888 175
262 3300041453 Ga0451797_0495261 Ga0451797_0495261_1272_1799 175
263 3300041453 Ga0451797_0545173 Ga0451797_0545173_631_1158 175
264 3300041453 Ga0451797_0771867 Ga0451797_0771867_182_709 175
265 3300041456 Ga0451795_1214017 Ga0451795_1214017_80_607 175
266 3300041458 Ga0451798_1171009 Ga0451798_1171009_480_1007 175
267 3300041459 Ga0451800_0149708 Ga0451800_0149708_452_979 175
268 3300041460 Ga0451802_0884482 Ga0451802_0884482_489_1016 175
269 3300041460 Ga0451802_1681777 Ga0451802_1681777_289_816 175
270 3300041486 Ga0451807_1948303 Ga0451807_1948303_268_795 175
271 3300041486 Ga0451807_2311883 Ga0451807_2311883_581_1108 175
272 3300041486 Ga0451807_2689742 Ga0451807_2689742_172_699 175
273 3300041494 Ga0451837_0056059 Ga0451837_0056059_411_938 175
274 3300041494 Ga0451837_0438379 Ga0451837_0438379_207_734 175
275 3300041494 Ga0451837_1379588 Ga0451837_1379588_491_1018 175
276 3300041494 Ga0451837_1590092 Ga0451837_1590092_26_553 175
277 3300041496 Ga0451839_1039621 Ga0451839_1039621_316_843 175
278 3300041498 Ga0451841_0506754 Ga0451841_0506754_267_794 175
279 3300041509 Ga0451843_0521013 Ga0451843_0521013_771_1298 175
280 3300041509 Ga0451843_0523403 Ga0451843_0523403_232_759 175
281 3300041509 Ga0451843_0936005 Ga0451843_0936005_225_752 175
282 3300041511 Ga0451855_0380233 Ga0451855_0380233_357_884 175
283 3300041512 Ga0451853_0722649 Ga0451853_0722649_282_809 175
284 3300041997 Ga0439431_0036006 Ga0439431_0036006_698_1225 175
285 3300042004 Ga0439445_0006297 Ga0439445_0006297_853_1380 175
286 3300042004 Ga0439445_0038519 Ga0439445_0038519_199_726 175
287 3300042006 Ga0439432_054066 Ga0439432_054066_181_708 175
288 3300042006 Ga0439432_085632 Ga0439432_085632_341_868 175
289 3300042007 Ga0439449_0000121 Ga0439449_0000121_24773_25300 175
290 3300042007 Ga0439449_0059939 Ga0439449_0059939_706_1233 175
291 3300042007 Ga0439449_0070646 Ga0439449_0070646_250_777 175
292 3300042007 Ga0439449_0156120 Ga0439449_0156120_137_664 175
293 3300042007 Ga0439449_0156834 Ga0439449_0156834_104_631 175
294 3300042012 Ga0439455_0075801 Ga0439455_0075801_333_860 175
295 3300042015 Ga0439462_0035294 Ga0439462_0035294_189_716 175
296 3300042015 Ga0439462_0064126 Ga0439462_0064126_37_564 175
297 3300042135 Ga0450899_031352 Ga0450899_031352_42_569 175
298 3300046474 Ga0495605_0227437 Ga0495605_0227437_45_572 175
299 3300046501 Ga0495607_0009364 Ga0495607_0009364_453_980 175
300 3300046507 Ga0495606_0013360 Ga0495606_0013360_5321_5848 175
301 3300046512 Ga0495610_0015708 Ga0495610_0015708_60_587 175
302 3300046512 Ga0495610_0051897 Ga0495610_0051897_1188_1715 175
303 3300046513 Ga0495616_0017533 Ga0495616_0017533_368_895 175
304 3300046513 Ga0495616_0056000 Ga0495616_0056000_1174_1701 175
305 3300046519 Ga0495632_0056091 Ga0495632_0056091_1140_1667 175
306 3300046522 Ga0495643_0007780 Ga0495643_0007780_6218_6745 175
307 3300046522 Ga0495643_0111135 Ga0495643_0111135_699_1226 175
308 3300046525 Ga0495663_0030772 Ga0495663_0030772_246_773 175
309 3300046525 Ga0495663_0103333 Ga0495663_0103333_304_831 175
310 3300046530 Ga0495654_0156933 Ga0495654_0156933_422_949 175
311 3300046537 Ga0495598_0002579 Ga0495598_0002579_188_715 175
312 3300046537 Ga0495598_0041783 Ga0495598_0041783_479_1015 175
313 3300046539 Ga0495621_0024149 Ga0495621_0024149_437_964 175
314 3300046558 Ga0495633_0012679 Ga0495633_0012679_98_625 175
315 3300046558 Ga0495633_0065502 Ga0495633_0065502_678_1205 175
316 3300046558 Ga0495633_0105842 Ga0495633_0105842_73_600 175
317 3300046615 Ga0495656_0003126 Ga0495656_0003126_331_861 175
318 3300046616 Ga0495668_0002136 Ga0495668_0002136_16113_16640 175
319 3300046660 Ga0495625_0198518 Ga0495625_0198518_682_1209 175
320 3300046683 Ga0495658_0124959 Ga0495658_0124959_180_713 175
321 3300046691 Ga0495670_0099120 Ga0495670_0099120_737_1267 175
322 3300046810 Ga0495660_0075889 Ga0495660_0075889_91_618 175
323 3300047318 Ga0495636_0004247 Ga0495636_0004247_4721_5251 175
324 3300047320 Ga0495672_0005636 Ga0495672_0005636_3111_3638 175
325 3300047470 Ga0495681_0033734 Ga0495681_0033734_1830_2357 175
326 3300047472 Ga0495686_0024353 Ga0495686_0024353_3359_3886 175
327 3300048090 Ga0495615_0008758 Ga0495615_0008758_306_833 175
328 3300048907 Ga0496104_0952204 Ga0496104_0952204_91_618 175
329 3300048908 Ga0496105_0302835 Ga0496105_0302835_69_596 175
330 3300048913 Ga0496110_0894256 Ga0496110_0894256_170_712 175
331 3300048916 Ga0496113_0489118 Ga0496113_0489118_255_782 175
332 3300048917 Ga0496114_0231793 Ga0496114_0231793_107_634 175
333 3300048919 Ga0496116_0084278 Ga0496116_0084278_1362_1889 175
334 3300048919 Ga0496116_0133115 Ga0496116_0133115_117_644 175
335 3300048921 Ga0496118_0137854 Ga0496118_0137854_326_853 175
336 3300048922 Ga0496119_0001745 Ga0496119_0001745_24704_25231 175
337 3300048922 Ga0496119_0015453 Ga0496119_0015453_554_1081 175
338 3300048923 Ga0496120_0000196 Ga0496120_0000196_120_647 175
339 3300048923 Ga0496120_0012258 Ga0496120_0012258_4783_5310 175
340 3300048924 Ga0496121_0000724 Ga0496121_0000724_38884_39411 175
341 3300048925 Ga0496122_0020019 Ga0496122_0020019_4959_5486 175
342 3300048925 Ga0496122_0067695 Ga0496122_0067695_56_583 175
343 3300048925 Ga0496122_0079429 Ga0496122_0079429_1009_1536 175
344 3300048926 Ga0496123_0016813 Ga0496123_0016813_574_1101 175
345 3300048926 Ga0496123_0101932 Ga0496123_0101932_754_1281 175
346 3300048926 Ga0496123_0348463 Ga0496123_0348463_60_587 175
347 3300048927 Ga0496124_0022045 Ga0496124_0022045_550_1077 175
348 3300048927 Ga0496124_0038401 Ga0496124_0038401_3519_4046 175
349 3300048927 Ga0496124_0548069 Ga0496124_0548069_143_670 175
350 3300048927 Ga0496124_0692136 Ga0496124_0692136_109_636 175
351 3300048928 Ga0496125_0553933 Ga0496125_0553933_88_615 175
352 3300048928 Ga0496125_0583352 Ga0496125_0583352_69_596 175
353 3300048929 Ga0496126_0001087 Ga0496126_0001087_110_637 175
354 3300048929 Ga0496126_0179815 Ga0496126_0179815_494_1021 175
355 3300048929 Ga0496126_0771399 Ga0496126_0771399_108_635 175
356 3300049160 Ga0501304_001273 Ga0501304_001273_997_1524 175
357 3300049568 Ga0501031_0012690 Ga0501031_0012690_225_752 175
358 3300049568 Ga0501031_0053357 Ga0501031_0053357_181_723 175
359 3300049569 Ga0501032_0037402 Ga0501032_0037402_2118_2660 175
360 3300049569 Ga0501032_0081899 Ga0501032_0081899_582_1124 175
361 3300049570 Ga0501033_0156211 Ga0501033_0156211_485_1027 175
362 3300049570 Ga0501033_0177752 Ga0501033_0177752_920_1462 175
363 3300049571 Ga0501034_0030305 Ga0501034_0030305_4752_5294 175
364 3300049571 Ga0501034_0063240 Ga0501034_0063240_2616_3158 175
365 3300049572 Ga0501036_0015568 Ga0501036_0015568_1721_2263 175
366 3300049572 Ga0501036_1260468 Ga0501036_1260468_48_590 175
367 3300049573 Ga0501037_0007296 Ga0501037_0007296_7054_7596 175
368 3300049573 Ga0501037_0741111 Ga0501037_0741111_85_627 175
369 3300049574 Ga0501038_0028108 Ga0501038_0028108_3595_4137 175
370 3300049574 Ga0501038_0054379 Ga0501038_0054379_2683_3225 175
371 3300049575 Ga0501039_0038157 Ga0501039_0038157_1084_1626 175
372 3300049575 Ga0501039_0175288 Ga0501039_0175288_653_1195 175
373 3300049579 Ga0501043_0002784 Ga0501043_0002784_125_652 175
374 3300049579 Ga0501043_0078822 Ga0501043_0078822_490_1017 175
375 3300049579 Ga0501043_0376525 Ga0501043_0376525_28_570 175
376 3300049581 Ga0501047_0113540 Ga0501047_0113540_305_847 175
377 3300049581 Ga0501047_0215483 Ga0501047_0215483_727_1269 175
378 3300049584 Ga0501068_0046015 Ga0501068_0046015_1598_2140 175
379 3300049586 Ga0501070_0043785 Ga0501070_0043785_2801_3343 175
380 3300049586 Ga0501070_0110292 Ga0501070_0110292_1129_1671 175
381 3300049587 Ga0501071_0203052 Ga0501071_0203052_675_1217 175
382 3300049589 Ga0501073_0108149 Ga0501073_0108149_233_775 175
383 3300049742 Ga0501080_0051035 Ga0501080_0051035_2898_3425 175
384 3300049742 Ga0501080_0185640 Ga0501080_0185640_647_1189 175
385 3300049762 Ga0501265_009361 Ga0501265_009361_633_1160 175
386 3300049772 Ga0501275_002960 Ga0501275_002960_548_1075 175
387 3300049822 Ga0501035_0003173 Ga0501035_0003173_8349_8891 175
388 3300049822 Ga0501035_0156832 Ga0501035_0156832_827_1369 175
389 3300049823 Ga0501044_0008103 Ga0501044_0008103_595_1137 175
390 3300049823 Ga0501044_0044423 Ga0501044_0044423_3377_3919 175
391 3300050490 nmdc:mga03n38_476497_c1 nmdc:mga03n38_476497_c1_28_555 175
392 3300050491 nmdc:mga00v17_147656_c1 nmdc:mga00v17_147656_c1_178_705 175
393 3300050491 nmdc:mga00v17_390423_c1 nmdc:mga00v17_390423_c1_93_620 175
394 3300050491 nmdc:mga00v17_9971_c1 nmdc:mga00v17_9971_c1_216_743 175
395 3300050494 nmdc:mga06z11_436549_c1 nmdc:mga06z11_436549_c1_187_714 175
396 3300053161 Ga0500634_0011986 Ga0500634_0011986_497_1024 175

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00213

OSCP

ATP synthase delta (OSCP) subunit

7

178

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6m6w-assembly1.cif.gz_F crystal structure the toxin-antitoxin mnta-hpet mutant-y104a 0.8636 104 139
7bxo-assembly1.cif.gz_A crystal structure of the toxin-antitoxin with amp-pnp 0.8634 104 139
6m6v-assembly1.cif.gz_A crystal structure the toxin-antitoxin mnta-hept 0.8613 104 139
7p3w-assembly1.cif.gz_d f1fo-atp synthase from acinetobacter baumannii (state 3) 0.859 5 172
7aer-assembly1.cif.gz_A rebuilt and re-refined pdb entry 5yep: tri-ampylated shewanella oneidensis hepn toxin in complex with mnt antitoxin 0.8434 106 139
ID Description Score Start End Superfamily
af_Q84R40_123_196_3.30.2320.30 Alpha Beta;2-Layer Sandwich;hypothetical protein PF0899 fold;ATP synthase, E subunit, C-terminal 0.9698 103 171 3.30.2320.30
af_P0ABA4_107_177_3.30.2320.30 Alpha Beta;2-Layer Sandwich;hypothetical protein PF0899 fold;ATP synthase, E subunit, C-terminal 0.9607 106 175 3.30.2320.30
af_P0ABA4_107_177_3.30.2320.30 Alpha Beta;2-Layer Sandwich;hypothetical protein PF0899 fold;ATP synthase, E subunit, C-terminal 0.935 106 175 3.30.2320.30
af_Q2FWE7_104_179_3.30.2320.30 Alpha Beta;2-Layer Sandwich;hypothetical protein PF0899 fold;ATP synthase, E subunit, C-terminal 0.923 104 174 3.30.2320.30
af_Q7JNG1_146_228_3.30.2320.30 Alpha Beta;2-Layer Sandwich;hypothetical protein PF0899 fold;ATP synthase, E subunit, C-terminal 0.8955 98 174 3.30.2320.30
ID Description Score Start End GO Terms
AF-A0A3D1SJJ7-F1-model_v4 ATP synthase F1 subunit delta 0.9536 95 174 GO:0016020
GO:0046933
AF-A0A5A4W9L2-F1-model_v4 deleted 0.9412 104 171
AF-A0A536TKY3-F1-model_v4 ATP synthase F1 subunit delta 0.9355 83 175 GO:0045261
GO:0046933
AF-A0A7V9V6W5-F1-model_v4 F0F1 ATP synthase subunit delta 0.9268 102 172 GO:0016020
GO:0046933
AF-A0A0D3FAI6-F1-model_v4 Uncharacterized protein 0.9267 7 172 GO:0016020
GO:0046933

Feature Viewer

pLDDT pTM Quality
87.2 0.61 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map