F433486

General Info

Members Datasets Scaffolds Average Seq Length
396 238 316 203

Family's Representative Sequence

Representative Sequence 3300009011|Ga0105251_10041053|Ga0105251_100410533
Length 233
Sequence LPHYKSIFRALPGLDNAHICAFSSSIEDLPVTELLAVALFTLLAVISPGADFAMVTRSSYAQGRKAGLAAATGIALGVQVHVLYTVLGIAVIISQSPVLFLAMKVLGAGYLIYLGYQSLTNTTRISLEGQPSATGLLAAMRTGFLTNALNPKTMLFVVSAYTQVVQPGTPLGVDFAYGAFMSFAHWVWFSLVAVFFSSAGLRKAMIERQVVVDRVIGVALIGLGLAVVVAGVR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231006 Pseudomonas sp. GM17 Isolate Nodule
3 2511231011 Pseudomonas sp. GM30 Isolate Nodule
4 2511231012 Pseudomonas sp. GM33 Isolate Nodule
5 2511231021 Pseudomonas sp. GM78 Isolate Nodule
6 2511231024 Pseudomonas sp. GM84 Isolate Nodule
7 2511231031 Pseudomonas sp. GM16 Isolate Nodule
8 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
9 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
10 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
11 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
12 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
13 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
14 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
15 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
16 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
17 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
18 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
19 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
20 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
21 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
22 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
23 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
24 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
25 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
26 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
27 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
28 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
29 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
30 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
31 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
32 2643221580 Devosia sp. Root635 Isolate Unclassified
33 2643221591 Devosia sp. Root685 Isolate Unclassified
34 2643221594 Achromobacter sp. Root170 Isolate Unclassified
35 2643221674 Devosia sp. Root436 Isolate Unclassified
36 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
37 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
38 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
39 2721755523 Delftia sp. HK171 Isolate Unclassified
40 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
41 2765235841 Pseudomonas putida AA7 Isolate Unclassified
42 2773857673 Pseudomonas sp. 443 Isolate Unclassified
43 2784132063 Pseudomonas sp. 424 Isolate Unclassified
44 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
45 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
46 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
47 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
48 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
49 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
50 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
51 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
52 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
53 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
54 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
55 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
56 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
57 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
58 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
59 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
60 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
61 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
62 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
63 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
64 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
65 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
66 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
67 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
68 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
69 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
70 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
71 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
72 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
73 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
74 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
75 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
76 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
77 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
78 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
79 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
80 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
81 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
82 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
85 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
86 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
87 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
88 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
98 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
101 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
103 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
104 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
105 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
114 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
115 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
118 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
119 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
120 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
121 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
122 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
123 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
124 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
125 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
126 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
127 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
128 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
129 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
130 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
131 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
132 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
133 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
134 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
135 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
136 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
137 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
138 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
139 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
140 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
141 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
142 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
143 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
144 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
145 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
146 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
147 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
148 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
149 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
150 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
151 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
152 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
153 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
154 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
155 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
156 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
157 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
158 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
159 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
160 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
161 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
162 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
163 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
164 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
165 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
166 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
167 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
168 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
169 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
170 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
171 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
172 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
173 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
174 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
175 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
176 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
177 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
178 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
179 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
180 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
181 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
182 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
183 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
184 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
185 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
186 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
187 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
188 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
189 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
190 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
191 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
192 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
193 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
194 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
195 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
196 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
197 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
198 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
199 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
200 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
201 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
202 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
203 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
208 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
209 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
210 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
211 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
212 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
213 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
214 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
215 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
216 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
217 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
218 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
219 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
220 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
221 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
222 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
223 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
224 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
225 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
226 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
227 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
228 641522639 Methylobacterium sp. 4-46 Isolate Nodule
229 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
230 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
231 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
232 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
233 8052494512 Pseudomonas putida LD6 Isolate Unclassified
234 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
235 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
236 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
237 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
238 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.8
Metatranscriptomes 0
Isolates 20.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.31
Nodule 3.03
Rhizoplane 7.07
Rhizosphere 60.61
Stem 0
Stem Tuber 1.01
Unclassified 21.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1239518 2162886007 Bacteria 977
2 SwRhRL2b_contig_1412887 2162886007 Bacteria 1254
3 SwRhRL2b_contig_1576138 2162886007 Bacteria 1493
4 JGI25162J39368_1000073 3300002737 Bacteria 121835
5 JGI25163J39215_1000344 3300002771 Bacteria 15364
6 JGI25164J39214_1000052 3300002772 Bacteria 121835
7 JGI25165J46597_1000137 3300003214 Bacteria 121835
8 rootL2_10034844 3300003322 Bacteria 4872
9 rootL2_10061469 3300003322 Bacteria 5732
10 Ga0065714_10005176 3300005288 Bacteria 6060
11 Ga0065714_10007326 3300005288 Bacteria 3413
12 Ga0065704_10018605 3300005289 Bacteria 1395
13 Ga0065704_10019726 3300005289 Bacteria 1345
14 Ga0065704_10082445 3300005289 Bacteria 3598
15 Ga0065704_10213646 3300005289 Bacteria 1099
16 Ga0065715_10110412 3300005293 Bacteria 2621
17 Ga0070669_100452815 3300005353 Bacteria 1058
18 Ga0070710_10615877 3300005437 Bacteria 757
19 Ga0075364_10018607 3300006051 Bacteria 4351
20 Ga0075364_10103398 3300006051 Bacteria 1897
21 Ga0075432_10000283 3300006058 Bacteria 14091
22 Ga0075432_10006283 3300006058 Bacteria 4038
23 Ga0075432_10014416 3300006058 Bacteria 2693
24 Ga0075362_10208040 3300006177 Bacteria 954
25 Ga0075436_100167993 3300006914 Bacteria 1548
26 Ga0099823_1001409 3300006944 Bacteria 19810
27 Ga0079104_1000096 3300006946 Bacteria 129793
28 Ga0105251_10000003 3300009011 Bacteria 311814
29 Ga0105251_10000666 3300009011 Bacteria 31657
30 Ga0105251_10004069 3300009011 Bacteria 10265
31 Ga0105251_10012563 3300009011 Bacteria 4785
32 Ga0105251_10023139 3300009011 Bacteria 3212
33 Ga0105251_10041053 3300009011 Bacteria 2253
34 Ga0105251_10050437 3300009011 Bacteria 1988
35 Ga0105251_10315674 3300009011 Bacteria 710
36 Ga0105244_10009666 3300009036 Bacteria 5904
37 Ga0105244_10010261 3300009036 Bacteria 5688
38 Ga0105244_10013142 3300009036 Bacteria 4851
39 Ga0105244_10015110 3300009036 Bacteria 4437
40 Ga0105244_10022084 3300009036 Bacteria 3508
41 Ga0105244_10024383 3300009036 Bacteria 3302
42 Ga0105244_10038938 3300009036 Bacteria 2477
43 Ga0105244_10111220 3300009036 Bacteria 1332
44 Ga0105250_10000160 3300009092 Bacteria 57969
45 Ga0105250_10000207 3300009092 Bacteria 49366
46 Ga0105250_10024225 3300009092 Bacteria 2445
47 Ga0105250_10025257 3300009092 Bacteria 2394
48 Ga0105250_10043853 3300009092 Bacteria 1793
49 Ga0105250_10118011 3300009092 Bacteria 1089
50 Ga0105243_10000469 3300009148 Bacteria 41718
51 Ga0105243_10021356 3300009148 Bacteria 4914
52 Ga0105243_10120836 3300009148 Bacteria 2208
53 Ga0105243_10239901 3300009148 Bacteria 1612
54 Ga0157373_10164731 3300013100 Bacteria 1560
55 Ga0157371_10001034 3300013102 Bacteria 30510
56 Ga0157370_10075897 3300013104 Bacteria 3167
57 Ga0157370_10290325 3300013104 Bacteria 1510
58 Ga0163162_10000137 3300013306 Bacteria 66670
59 Ga0163162_10197112 3300013306 Bacteria 2143
60 Ga0163162_10795267 3300013306 Bacteria 1063
61 Ga0157372_10005048 3300013307 Bacteria 14020
62 Ga0157372_10107160 3300013307 Bacteria 3197
63 Ga0157375_10105830 3300013308 Bacteria 2904
64 Ga0182008_10000356 3300014497 Bacteria 35646
65 Ga0182008_10002102 3300014497 Bacteria 12705
66 Ga0182008_10023510 3300014497 Bacteria 3147
67 Ga0182006_1005569 3300015261 Bacteria 5981
68 Ga0182006_1031953 3300015261 Bacteria 2119
69 Ga0182005_1025474 3300015265 Bacteria 1614
70 Ga0182005_1066346 3300015265 Bacteria 988
71 Ga0163161_10000054 3300017792 Bacteria 117153
72 Ga0163161_10020632 3300017792 Bacteria 4626
73 Ga0163161_10114034 3300017792 Bacteria 2024
74 Ga0209760_100068 3300025207 Bacteria 85849
75 Ga0209563_100671 3300025230 Bacteria 10840
76 Ga0207427_100007 3300025231 Bacteria 746220
77 Ga0209437_100006 3300025233 Bacteria 1042724
78 Ga0209233_1000086 3300025261 Bacteria 331687
79 Ga0209676_1004835 3300025292 Bacteria 7315
80 Ga0209676_1006898 3300025292 Bacteria 5487
81 Ga0209050_1000229 3300025298 Bacteria 123110
82 Ga0209051_1003454 3300025303 Bacteria 10348
83 Ga0207696_1000002 3300025711 Bacteria 1098043
84 Ga0207696_1000075 3300025711 Bacteria 210629
85 Ga0207696_1000172 3300025711 Bacteria 102404
86 Ga0207696_1005413 3300025711 Bacteria 5301
87 Ga0207696_1025937 3300025711 Bacteria 1820
88 Ga0207696_1030104 3300025711 Bacteria 1652
89 Ga0207696_1045012 3300025711 Bacteria 1278
90 Ga0207655_1000019 3300025728 Bacteria 536324
91 Ga0207655_1000445 3300025728 Bacteria 54522
92 Ga0207655_1000523 3300025728 Bacteria 48957
93 Ga0207655_1002113 3300025728 Bacteria 16620
94 Ga0207655_1007560 3300025728 Bacteria 7034
95 Ga0207655_1024013 3300025728 Bacteria 3001
96 Ga0207655_1042293 3300025728 Bacteria 1942
97 Ga0207655_1088078 3300025728 Bacteria 1100
98 Ga0207713_1000009 3300025735 Bacteria 551314
99 Ga0207713_1007332 3300025735 Bacteria 6533
100 Ga0207713_1014064 3300025735 Bacteria 4179
101 Ga0207713_1015213 3300025735 Bacteria 3961
102 Ga0207713_1028956 3300025735 Bacteria 2489
103 Ga0207713_1031138 3300025735 Bacteria 2363
104 Ga0207713_1056410 3300025735 Bacteria 1526
105 Ga0207713_1058945 3300025735 Bacteria 1476
106 Ga0207713_1094132 3300025735 Bacteria 1047
107 Ga0207713_1153740 3300025735 Bacteria 740
108 Ga0207706_10063173 3300025933 Bacteria 3261
109 Ga0207709_10000413 3300025935 Bacteria 41737
110 Ga0207709_10000439 3300025935 Bacteria 39121
111 Ga0207709_10005415 3300025935 Bacteria 7255
112 Ga0207709_10008803 3300025935 Bacteria 5567
113 Ga0209281_1000020 3300027111 Bacteria 575972
114 Ga0209389_1000125 3300027296 Bacteria 68494
115 Ga0209371_1000516 3300027312 Bacteria 36907
116 Ga0207428_10003937 3300027907 Bacteria 14237
117 Ga0207428_10028258 3300027907 Bacteria 4662
118 Ga0207428_10202528 3300027907 Bacteria 1493
119 Ga0268256_1000213 3300030500 Bacteria 65237
120 Ga0307516_10350382 3300031730 Bacteria 1142
121 Ga0307407_10327748 3300031903 Bacteria 1077
122 Ga0307412_10479823 3300031911 Bacteria 1031
123 Ga0307414_10180938 3300032004 Bacteria 1695
124 Ga0307414_10355495 3300032004 Bacteria 1259
125 Ga0307414_10581700 3300032004 Bacteria 1002
126 Ga0307510_10005552 3300033180 Bacteria 15031
127 Ga0237819_00713 3300038705 Bacteria 10756
128 Ga0400483_097404 3300039062 Bacteria 15635
129 Ga0436365_0097220 3300039437 Bacteria 1431
130 Ga0436361_1040516 3300039447 Bacteria 1168
131 Ga0439438_001397 3300041405 Bacteria 10650
132 Ga0439438_002347 3300041405 Bacteria 8070
133 Ga0439447_006392 3300041407 Bacteria 3832
134 Ga0439466_0000953 3300041411 Bacteria 11092
135 Ga0439466_0074771 3300041411 Bacteria 1074
136 Ga0451791_0751728 3300041451 Bacteria 973
137 Ga0439451_000933 3300042009 Bacteria 5629
138 Ga0439456_000060 3300042013 Bacteria 39159
139 Ga0439456_009462 3300042013 Bacteria 2012
140 Ga0439463_000047 3300042016 Bacteria 25575
141 Ga0450911_019095 3300042115 Bacteria 899
142 Ga0450919_007258 3300042121 Bacteria 1297
143 Ga0450920_000989 3300042122 Bacteria 4648
144 Ga0450922_003400 3300042124 Bacteria 1467
145 Ga0450902_000056 3300042137 Bacteria 10663
146 Ga0450903_003590 3300042138 Bacteria 2678
147 Ga0450903_010503 3300042138 Bacteria 1497
148 Ga0450905_004957 3300042142 Bacteria 1780
149 Ga0450906_010731 3300042145 Bacteria 1725
150 Ga0450907_003059 3300042146 Bacteria 3041
151 Ga0450910_008317 3300042147 Bacteria 1457
152 Ga0450908_006096 3300042184 Bacteria 2298
153 Ga0439464_0015962 3300042439 Bacteria 2029
154 Ga0439460_0000975 3300042461 Bacteria 6577
155 Ga0439460_0001906 3300042461 Bacteria 4984
156 Ga0450918_010238 3300042531 Bacteria 1638
157 Ga0450901_000333 3300042533 Bacteria 5779
158 Ga0451577_0005424 3300042876 Bacteria 13079
159 Ga0439440_0013058 3300042993 Bacteria 1775
160 Ga0439440_0067613 3300042993 Bacteria 924
161 Ga0466961_0112028 3300044693 Bacteria 1716
162 Ga0495617_000415 3300046452 Bacteria 23324
163 Ga0495617_001567 3300046452 Bacteria 9888
164 Ga0495617_002350 3300046452 Bacteria 7575
165 Ga0495617_008457 3300046452 Bacteria 3548
166 Ga0495627_000497 3300046453 Bacteria 32934
167 Ga0495592_0001251 3300046454 Bacteria 17591
168 Ga0495590_0000491 3300046457 Bacteria 19416
169 Ga0495591_018413 3300046458 Bacteria 2369
170 Ga0495638_0005389 3300046460 Bacteria 9536
171 Ga0495638_0131044 3300046460 Bacteria 1472
172 Ga0495653_0000250 3300046463 Bacteria 43089
173 Ga0495584_0001284 3300046491 Bacteria 15285
174 Ga0495585_0184598 3300046492 Bacteria 1070
175 Ga0495596_0133451 3300046500 Bacteria 963
176 Ga0495596_0280352 3300046500 Bacteria 647
177 Ga0495607_0005029 3300046501 Bacteria 9587
178 Ga0495607_0010875 3300046501 Bacteria 6089
179 Ga0495607_0038668 3300046501 Bacteria 2857
180 Ga0495607_0217262 3300046501 Bacteria 937
181 Ga0495583_0002309 3300046506 Bacteria 16613
182 Ga0495610_0003412 3300046512 Bacteria 12401
183 Ga0495616_0003859 3300046513 Bacteria 9552
184 Ga0495620_0000124 3300046515 Bacteria 62374
185 Ga0495620_0121380 3300046515 Bacteria 1029
186 Ga0495632_0000277 3300046519 Bacteria 50320
187 Ga0495632_0000466 3300046519 Bacteria 38410
188 Ga0495632_0002099 3300046519 Bacteria 15592
189 Ga0495637_0000275 3300046520 Bacteria 40472
190 Ga0495643_0000783 3300046522 Bacteria 35376
191 Ga0495643_0000810 3300046522 Bacteria 34361
192 Ga0495643_0006497 3300046522 Bacteria 7693
193 Ga0495648_0000318 3300046524 Bacteria 53345
194 Ga0495648_0000606 3300046524 Bacteria 38334
195 Ga0495666_0000454 3300046526 Bacteria 18249
196 Ga0495652_0239890 3300046529 Bacteria 1350
197 Ga0495654_0001187 3300046530 Bacteria 18541
198 Ga0495654_0001645 3300046530 Bacteria 15120
199 Ga0495609_0001884 3300046538 Bacteria 13379
200 Ga0495597_0033649 3300046542 Bacteria 2319
201 Ga0495597_0063130 3300046542 Bacteria 1610
202 Ga0495645_0048549 3300046543 Bacteria 3091
203 Ga0495633_0194862 3300046558 Bacteria 931
204 Ga0495656_0107424 3300046615 Bacteria 1300
205 Ga0495668_0016020 3300046616 Bacteria 4365
206 Ga0495611_0000067 3300046648 Bacteria 72577
207 Ga0495625_0001947 3300046660 Bacteria 23353
208 Ga0495625_0006625 3300046660 Bacteria 10280
209 Ga0495661_0002810 3300046665 Bacteria 13185
210 Ga0495661_0082226 3300046665 Bacteria 1854
211 Ga0495646_0002463 3300046680 Bacteria 11376
212 Ga0495613_0000743 3300046689 Bacteria 25557
213 Ga0495613_0000978 3300046689 Bacteria 21774
214 Ga0495624_0000034 3300046690 Bacteria 90505
215 Ga0495670_0000061 3300046691 Bacteria 48947
216 Ga0495671_0003987 3300046692 Bacteria 8925
217 Ga0495671_0007360 3300046692 Bacteria 6281
218 Ga0495671_0027672 3300046692 Bacteria 2926
219 Ga0495671_0032666 3300046692 Bacteria 2656
220 Ga0495649_0000735 3300046694 Bacteria 26611
221 Ga0495589_0103748 3300046794 Bacteria 1374
222 Ga0495660_0006651 3300046810 Bacteria 6833
223 Ga0495660_0031886 3300046810 Bacteria 2960
224 Ga0495604_0024755 3300047317 Bacteria 4788
225 Ga0495672_0000151 3300047320 Bacteria 100793
226 Ga0495672_0009871 3300047320 Bacteria 6864
227 Ga0495672_0038295 3300047320 Bacteria 2926
228 Ga0495676_0006569 3300047321 Bacteria 10717
229 Ga0495680_0006037 3300047322 Bacteria 11321
230 Ga0495680_0006176 3300047322 Bacteria 11173
231 Ga0495683_0001526 3300047323 Bacteria 15007
232 Ga0495683_0006336 3300047323 Bacteria 6469
233 Ga0495679_018701 3300047446 Bacteria 2452
234 Ga0495673_0005971 3300047469 Bacteria 7246
235 Ga0495673_0021835 3300047469 Bacteria 3151
236 Ga0495681_0000240 3300047470 Bacteria 45463
237 Ga0495684_0069646 3300047471 Bacteria 2674
238 Ga0495686_0002037 3300047472 Bacteria 19919
239 Ga0495593_0002122 3300047673 Bacteria 11850
240 Ga0495593_0009438 3300047673 Bacteria 5660
241 Ga0495602_0000429 3300048088 Bacteria 39500
242 Ga0496106_0350101 3300048909 Bacteria 1186
243 Ga0496110_0116482 3300048913 Bacteria 2405
244 Ga0496111_0074786 3300048914 Bacteria 2468
245 Ga0496114_0041244 3300048917 Bacteria 3824
246 Ga0496114_0172720 3300048917 Bacteria 1884
247 Ga0496116_0000399 3300048919 Bacteria 63018
248 Ga0496116_0000827 3300048919 Bacteria 39072
249 Ga0496116_0005079 3300048919 Bacteria 12365
250 Ga0496116_0020546 3300048919 Bacteria 5011
251 Ga0496116_0180478 3300048919 Bacteria 1131
252 Ga0496117_0000133 3300048920 Bacteria 161454
253 Ga0496117_0001129 3300048920 Bacteria 40277
254 Ga0496117_0002629 3300048920 Bacteria 22276
255 Ga0496117_0004196 3300048920 Bacteria 16096
256 Ga0496117_0004685 3300048920 Bacteria 14857
257 Ga0496117_0053283 3300048920 Bacteria 2843
258 Ga0496118_0000752 3300048921 Bacteria 52469
259 Ga0496118_0000966 3300048921 Bacteria 44919
260 Ga0496118_0003371 3300048921 Bacteria 20185
261 Ga0496118_0003476 3300048921 Bacteria 19765
262 Ga0496118_0031423 3300048921 Bacteria 4402
263 Ga0496118_0033228 3300048921 Bacteria 4236
264 Ga0496119_0000811 3300048922 Bacteria 41743
265 Ga0496119_0068557 3300048922 Bacteria 2088
266 Ga0496119_0268682 3300048922 Bacteria 853
267 Ga0496120_0002513 3300048923 Bacteria 18364
268 Ga0496121_0000691 3300048924 Bacteria 62894
269 Ga0496121_0001424 3300048924 Bacteria 40476
270 Ga0496121_0051069 3300048924 Bacteria 3486
271 Ga0496121_0245769 3300048924 Bacteria 1244
272 Ga0496121_0659065 3300048924 Bacteria 636
273 Ga0496122_0005114 3300048925 Bacteria 15825
274 Ga0496122_0005493 3300048925 Bacteria 15082
275 Ga0496122_0015460 3300048925 Bacteria 7296
276 Ga0496122_0038001 3300048925 Bacteria 3865
277 Ga0496123_0000567 3300048926 Bacteria 63083
278 Ga0496123_0003087 3300048926 Bacteria 19126
279 Ga0496123_0003948 3300048926 Bacteria 16072
280 Ga0496123_0023486 3300048926 Bacteria 4718
281 Ga0496123_0062703 3300048926 Bacteria 2379
282 Ga0496124_0002720 3300048927 Bacteria 22570
283 Ga0496124_0003048 3300048927 Bacteria 20889
284 Ga0496124_0003771 3300048927 Bacteria 18230
285 Ga0496124_0006599 3300048927 Bacteria 12601
286 Ga0496124_0022517 3300048927 Bacteria 5772
287 Ga0496124_0031391 3300048927 Bacteria 4703
288 Ga0496124_0039598 3300048927 Bacteria 4084
289 Ga0496124_0044576 3300048927 Bacteria 3804
290 Ga0496124_0044708 3300048927 Bacteria 3798
291 Ga0496124_0046841 3300048927 Bacteria 3701
292 Ga0496124_0373888 3300048927 Bacteria 999
293 Ga0496125_0000191 3300048928 Bacteria 131220
294 Ga0496125_0002428 3300048928 Bacteria 24231
295 Ga0496125_0012112 3300048928 Bacteria 8580
296 Ga0496125_0012244 3300048928 Bacteria 8532
297 Ga0496125_0031043 3300048928 Bacteria 4768
298 Ga0496125_0040250 3300048928 Bacteria 4012
299 Ga0496125_0096839 3300048928 Bacteria 2189
300 Ga0496125_0244342 3300048928 Bacteria 1137
301 Ga0496125_0399002 3300048928 Bacteria 804
302 Ga0496126_0116662 3300048929 Bacteria 2320
303 Ga0496126_0189995 3300048929 Bacteria 1740
304 Ga0496126_0326544 3300048929 Bacteria 1260
305 Ga0496126_0504806 3300048929 Bacteria 966
306 Ga0501034_0000131 3300049571 Bacteria 139479
307 Ga0501034_1321237 3300049571 Bacteria 597
308 nmdc:mga00v17_17312_c1 3300050491 Bacteria 4077
309 nmdc:mga00v17_324438_c1 3300050491 Bacteria 1000
310 Ga0500593_157485 3300053117 Bacteria 872
311 Ga0500618_003827 3300053125 Bacteria 5025
312 Ga0500659_0005131 3300053135 Bacteria 7372
313 Ga0500600_0235318 3300053149 Unclassified 833
314 Ga0500604_0002462 3300053151 Bacteria 5046
315 Ga0500624_002614 3300053157 Bacteria 2417
316 Ga0500634_0000461 3300053161 Bacteria 13217

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048924 Ga0496121_0659065 Ga0496121_0659065_23_568 169
2 3300013104 Ga0157370_10075897 Ga0157370_100758975 177
3 3300046542 Ga0495597_0063130 Ga0495597_0063130_861_1478 180
4 3300049571 Ga0501034_1321237 Ga0501034_1321237_19_570 181
5 3300009011 Ga0105251_10012563 Ga0105251_100125632 182
6 3300009036 Ga0105244_10024383 Ga0105244_100243834 182
7 3300009148 Ga0105243_10120836 Ga0105243_101208364 182
8 3300013306 Ga0163162_10795267 Ga0163162_107952672 182
9 3300014497 Ga0182008_10023510 Ga0182008_100235102 182
10 3300015261 Ga0182006_1031953 Ga0182006_10319531 182
11 3300015265 Ga0182005_1025474 Ga0182005_10254742 182
12 3300046500 Ga0495596_0133451 Ga0495596_0133451_396_947 182
13 3300046500 Ga0495596_0280352 Ga0495596_0280352_17_568 182
14 3300046526 Ga0495666_0000454 Ga0495666_0000454_9942_10490 182
15 3300047322 Ga0495680_0006037 Ga0495680_0006037_2897_3445 182
16 3300047673 Ga0495593_0002122 Ga0495593_0002122_2410_2958 182
17 3300048928 Ga0496125_0244342 Ga0496125_0244342_523_1071 182
18 3300042013 Ga0439456_000060 Ga0439456_000060_9517_10131 183
19 3300042137 Ga0450902_000056 Ga0450902_000056_775_1392 183
20 3300042533 Ga0450901_000333 Ga0450901_000333_1052_1669 183
21 3300009036 Ga0105244_10010261 Ga0105244_100102617 191
22 3300013307 Ga0157372_10005048 Ga0157372_100050481 191
23 3300025728 Ga0207655_1000523 Ga0207655_100052310 191
24 3300027312 Ga0209371_1000516 Ga0209371_100051612 191
25 3300030500 Ga0268256_1000213 Ga0268256_100021312 191
26 3300048922 Ga0496119_0000811 Ga0496119_0000811_22578_23189 191
27 3300048923 Ga0496120_0002513 Ga0496120_0002513_10556_11167 191
28 3300048924 Ga0496121_0051069 Ga0496121_0051069_1194_1808 191
29 3300005353 Ga0070669_100452815 Ga0070669_1004528151 192
30 3300006944 Ga0099823_1001409 Ga0099823_100140922 192
31 3300009036 Ga0105244_10038938 Ga0105244_100389383 192
32 3300009092 Ga0105250_10024225 Ga0105250_100242253 192
33 3300009092 Ga0105250_10118011 Ga0105250_101180111 192
34 3300025711 Ga0207696_1025937 Ga0207696_10259373 192
35 3300025711 Ga0207696_1045012 Ga0207696_10450122 192
36 3300025728 Ga0207655_1000445 Ga0207655_100044511 192
37 3300025735 Ga0207713_1014064 Ga0207713_10140643 192
38 3300027296 Ga0209389_1000125 Ga0209389_100012534 192
39 3300046522 Ga0495643_0006497 Ga0495643_0006497_209_823 192
40 3300048917 Ga0496114_0041244 Ga0496114_0041244_578_1192 192
41 3300048920 Ga0496117_0004685 Ga0496117_0004685_3130_3744 192
42 3300048921 Ga0496118_0000752 Ga0496118_0000752_7876_8490 192
43 3300048925 Ga0496122_0005493 Ga0496122_0005493_5404_6018 192
44 3300048926 Ga0496123_0000567 Ga0496123_0000567_51675_52289 192
45 3300048927 Ga0496124_0044576 Ga0496124_0044576_1304_1918 192
46 3300048928 Ga0496125_0031043 Ga0496125_0031043_1837_2451 192
47 3300048929 Ga0496126_0504806 Ga0496126_0504806_171_785 192
48 3300053135 Ga0500659_0005131 Ga0500659_0005131_1772_2386 192
49 3300042016 Ga0439463_000047 Ga0439463_000047_22570_23187 197
50 3300042993 Ga0439440_0013058 Ga0439440_0013058_447_1064 197
51 3300048928 Ga0496125_0096839 Ga0496125_0096839_1558_2157 197
52 iso_pu_bacteria 8003400568 8003401480 197
53 3300046452 Ga0495617_002350 Ga0495617_002350_5791_6393 199
54 3300046530 Ga0495654_0001187 Ga0495654_0001187_12506_13108 199
55 iso_pu_bacteria 2511231024 2511375666 199
56 iso_pu_bacteria 2765235841 2765581900 199
57 iso_pu_bacteria 2919155634 2919159395 199
58 iso_pu_bacteria 8054929484 8054933365 199
59 iso_pu_bacteria 2511231006 2511265195 200
60 iso_pu_bacteria 2512047018 2512329030 200
61 iso_pu_bacteria 2545555834 2545676047 200
62 iso_pu_bacteria 2554235231 2555245694 200
63 iso_pu_bacteria 2554235341 2555671597 200
64 iso_pu_bacteria 2582580891 2583794078 200
65 iso_pu_bacteria 2597489887 2597859671 200
66 iso_pu_bacteria 2599185160 2599354246 200
67 iso_pu_bacteria 2599185161 2599360040 200
68 iso_pu_bacteria 2599185162 2599366362 200
69 iso_pu_bacteria 2599185163 2599373152 200
70 iso_pu_bacteria 2599185164 2599379354 200
71 iso_pu_bacteria 2599185165 2599385668 200
72 iso_pu_bacteria 2599185166 2599392011 200
73 iso_pu_bacteria 2599185168 2599403777 200
74 iso_pu_bacteria 2599185181 2599461080 200
75 iso_pu_bacteria 2599185182 2599469622 200
76 iso_pu_bacteria 2599185185 2599482500 200
77 iso_pu_bacteria 2599185186 2599490100 200
78 iso_pu_bacteria 2599185257 2599803779 200
79 iso_pu_bacteria 2599185356 2600213695 200
80 iso_pu_bacteria 2600255313 2601773863 200
81 iso_pu_bacteria 2667528171 2671096827 200
82 iso_pu_bacteria 2671180172 2671770652 200
83 iso_pu_bacteria 2740892503 2743739209 200
84 iso_pu_bacteria 2806310737 2807406554 200
85 iso_pu_bacteria 2806310745 2807454886 200
86 iso_pu_bacteria 2818991464 2819701920 200
87 iso_pu_bacteria 2912963787 2912964522 200
88 iso_pu_bacteria 2917070673 2917075468 200
89 iso_pu_bacteria 2923153595 2923158291 200
90 iso_pu_bacteria 2935353572 2935356455 200
91 iso_pu_bacteria 2939651529 2939652029 200
92 iso_pu_bacteria 3007395558 3007397583 200
93 iso_pu_bacteria 3007803356 3007804853 200
94 iso_pu_bacteria 3007872151 3007873354 200
95 iso_pu_bacteria 637000220 637321919 200
96 iso_pu_bacteria 641522639 641645482 200
97 iso_pu_bacteria 8015687852 8015692379 200
98 iso_pu_bacteria 8019769354 8019773945 200
99 iso_pu_bacteria 8052494512 8052499248 200
100 iso_pu_bacteria 8056115690 8056120591 200
101 iso_pu_bacteria 8056120720 8056121583 200
102 iso_pu_bacteria 8056137416 8056142233 200
103 iso_pu_bacteria 2511231011 2511293167 201
104 iso_pu_bacteria 2511231012 2511300782 201
105 iso_pu_bacteria 2511231021 2511357114 201
106 iso_pu_bacteria 2511231031 2511413065 201
107 iso_pu_bacteria 2537561728 2538426957 201
108 iso_pu_bacteria 2600254954 2600445364 201
109 iso_pu_bacteria 2600255389 2602009764 201
110 iso_pu_bacteria 2643221594 2643981016 201
111 iso_pu_bacteria 2706794495 2707102113 201
112 iso_pu_bacteria 2721755523 2722883479 201
113 iso_pu_bacteria 2773857673 2774134197 201
114 iso_pu_bacteria 2784132063 2784264024 201
115 iso_pu_bacteria 2808606395 2809036061 201
116 iso_pu_bacteria 2818991456 2819657919 201
117 iso_pu_bacteria 2823421272 2823424385 201
118 iso_pu_bacteria 2839138175 2839140836 201
119 iso_pu_bacteria 2852657418 2852657896 201
120 iso_pu_bacteria 2855195626 2855200027 201
121 iso_pu_bacteria 2858466076 2858469477 201
122 iso_pu_bacteria 2871272651 2871273985 201
123 iso_pu_bacteria 2880230671 2880233911 201
124 iso_pu_bacteria 2900051742 2900053817 201
125 iso_pu_bacteria 2904434214 2904436891 201
126 iso_pu_bacteria 2904518522 2904523230 201
127 iso_pu_bacteria 2939636861 2939641431 201
128 iso_pu_bacteria 3007718800 3007720614 201
129 iso_pu_bacteria 8002392321 8002395507 201
130 iso_pu_bacteria 8057798959 8057804459 201
131 3300005437 Ga0070710_10615877 Ga0070710_106158771 203
132 3300006058 Ga0075432_10014416 Ga0075432_100144164 203
133 3300009011 Ga0105251_10000666 Ga0105251_1000066623 203
134 3300009011 Ga0105251_10041053 Ga0105251_100410533 203
135 3300009036 Ga0105244_10022084 Ga0105244_100220844 203
136 3300025735 Ga0207713_1007332 Ga0207713_10073323 203
137 3300025735 Ga0207713_1015213 Ga0207713_10152134 203
138 3300027907 Ga0207428_10202528 Ga0207428_102025282 203
139 3300031730 Ga0307516_10350382 Ga0307516_103503822 203
140 3300031903 Ga0307407_10327748 Ga0307407_103277482 203
141 3300031911 Ga0307412_10479823 Ga0307412_104798232 203
142 3300032004 Ga0307414_10180938 Ga0307414_101809382 203
143 3300032004 Ga0307414_10355495 Ga0307414_103554952 203
144 3300032004 Ga0307414_10581700 Ga0307414_105817002 203
145 3300039437 Ga0436365_0097220 Ga0436365_0097220_541_1152 203
146 3300041451 Ga0451791_0751728 Ga0451791_0751728_176_808 203
147 3300044693 Ga0466961_0112028 Ga0466961_0112028_929_1579 203
148 3300048914 Ga0496111_0074786 Ga0496111_0074786_1404_2015 203
149 3300048926 Ga0496123_0023486 Ga0496123_0023486_2150_2761 203
150 3300048927 Ga0496124_0003048 Ga0496124_0003048_14023_14634 203
151 3300048927 Ga0496124_0373888 Ga0496124_0373888_185_817 203
152 3300048928 Ga0496125_0000191 Ga0496125_0000191_17799_18431 203
153 3300048928 Ga0496125_0012112 Ga0496125_0012112_2952_3563 203
154 3300048929 Ga0496126_0116662 Ga0496126_0116662_274_906 203
155 3300053117 Ga0500593_157485 Ga0500593_157485_199_831 203
156 3300053151 Ga0500604_0002462 Ga0500604_0002462_1797_2429 203
157 3300053157 Ga0500624_002614 Ga0500624_002614_419_1051 203
158 3300053161 Ga0500634_0000461 Ga0500634_0000461_5325_5957 203
159 iso_pu_bacteria 2643221580 2643910345 203
160 iso_pu_bacteria 2643221591 2643964708 203
161 iso_pu_bacteria 2643221674 2644411768 203
162 2162886007 SwRhRL2b_contig_1412887 SwRhRL2b_0925.00005250 204
163 2162886007 SwRhRL2b_contig_1576138 SwRhRL2b_0044.00005720 204
164 3300002737 JGI25162J39368_1000073 JGI25162J39368_100007355 204
165 3300002771 JGI25163J39215_1000344 JGI25163J39215_10003445 204
166 3300002772 JGI25164J39214_1000052 JGI25164J39214_100005255 204
167 3300003214 JGI25165J46597_1000137 JGI25165J46597_100013755 204
168 3300005289 Ga0065704_10019726 Ga0065704_100197262 204
169 3300005289 Ga0065704_10082445 Ga0065704_100824453 204
170 3300009011 Ga0105251_10315674 Ga0105251_103156741 204
171 3300009036 Ga0105244_10009666 Ga0105244_100096662 204
172 3300009036 Ga0105244_10015110 Ga0105244_100151106 204
173 3300009036 Ga0105244_10111220 Ga0105244_101112202 204
174 3300009148 Ga0105243_10000469 Ga0105243_100004695 204
175 3300009148 Ga0105243_10021356 Ga0105243_100213567 204
176 3300013102 Ga0157371_10001034 Ga0157371_100010345 204
177 3300014497 Ga0182008_10000356 Ga0182008_1000035634 204
178 3300025207 Ga0209760_100068 Ga0209760_10006818 204
179 3300025231 Ga0207427_100007 Ga0207427_100007180 204
180 3300025233 Ga0209437_100006 Ga0209437_100006446 204
181 3300025261 Ga0209233_1000086 Ga0209233_1000086180 204
182 3300025292 Ga0209676_1006898 Ga0209676_10068981 204
183 3300025711 Ga0207696_1000172 Ga0207696_100017278 204
184 3300025711 Ga0207696_1005413 Ga0207696_10054135 204
185 3300025728 Ga0207655_1007560 Ga0207655_10075609 204
186 3300025728 Ga0207655_1042293 Ga0207655_10422932 204
187 3300025735 Ga0207713_1031138 Ga0207713_10311384 204
188 3300025735 Ga0207713_1094132 Ga0207713_10941322 204
189 3300025935 Ga0207709_10000413 Ga0207709_1000041339 204
190 3300025935 Ga0207709_10005415 Ga0207709_100054158 204
191 3300025935 Ga0207709_10008803 Ga0207709_100088033 204
192 3300039062 Ga0400483_097404 Ga0400483_097404_3976_4590 204
193 3300041411 Ga0439466_0000953 Ga0439466_0000953_2370_2987 204
194 3300042142 Ga0450905_004957 Ga0450905_004957_1100_1714 204
195 3300046515 Ga0495620_0000124 Ga0495620_0000124_30229_30846 204
196 3300046519 Ga0495632_0000466 Ga0495632_0000466_7771_8388 204
197 3300046522 Ga0495643_0000810 Ga0495643_0000810_32877_33494 204
198 3300046524 Ga0495648_0000606 Ga0495648_0000606_30039_30656 204
199 3300046558 Ga0495633_0194862 Ga0495633_0194862_135_755 204
200 3300047320 Ga0495672_0009871 Ga0495672_0009871_637_1257 204
201 3300048917 Ga0496114_0172720 Ga0496114_0172720_1148_1762 204
202 3300048919 Ga0496116_0000399 Ga0496116_0000399_58595_59215 204
203 3300048919 Ga0496116_0020546 Ga0496116_0020546_1384_2001 204
204 3300048920 Ga0496117_0001129 Ga0496117_0001129_26899_27516 204
205 3300048920 Ga0496117_0053283 Ga0496117_0053283_2017_2634 204
206 3300048921 Ga0496118_0003476 Ga0496118_0003476_208_825 204
207 3300048922 Ga0496119_0068557 Ga0496119_0068557_1073_1690 204
208 3300048922 Ga0496119_0268682 Ga0496119_0268682_133_753 204
209 3300048924 Ga0496121_0000691 Ga0496121_0000691_58456_59076 204
210 3300048924 Ga0496121_0245769 Ga0496121_0245769_71_688 204
211 3300048925 Ga0496122_0005114 Ga0496122_0005114_11397_12017 204
212 3300048925 Ga0496122_0038001 Ga0496122_0038001_2655_3269 204
213 3300048926 Ga0496123_0003087 Ga0496123_0003087_15456_16076 204
214 3300048927 Ga0496124_0002720 Ga0496124_0002720_17247_17861 204
215 3300048927 Ga0496124_0006599 Ga0496124_0006599_7705_8322 204
216 3300048927 Ga0496124_0022517 Ga0496124_0022517_878_1495 204
217 3300048927 Ga0496124_0039598 Ga0496124_0039598_1769_2386 204
218 3300048928 Ga0496125_0002428 Ga0496125_0002428_1964_2581 204
219 3300048928 Ga0496125_0040250 Ga0496125_0040250_1383_2000 204
220 3300048928 Ga0496125_0399002 Ga0496125_0399002_145_765 204
221 3300048929 Ga0496126_0326544 Ga0496126_0326544_16_633 204
222 3300049571 Ga0501034_0000131 Ga0501034_0000131_115220_115834 204
223 3300053149 Ga0500600_0235318 Ga0500600_0235318_113_727 204
224 2162886007 SwRhRL2b_contig_1239518 SwRhRL2b_0179.00004010 205
225 3300003322 rootL2_10034844 rootL2_100348441 205
226 3300003322 rootL2_10061469 rootL2_100614692 205
227 3300005288 Ga0065714_10005176 Ga0065714_100051764 205
228 3300005288 Ga0065714_10007326 Ga0065714_100073264 205
229 3300005289 Ga0065704_10018605 Ga0065704_100186052 205
230 3300005289 Ga0065704_10213646 Ga0065704_102136462 205
231 3300005293 Ga0065715_10110412 Ga0065715_101104122 205
232 3300006051 Ga0075364_10018607 Ga0075364_100186072 205
233 3300006051 Ga0075364_10103398 Ga0075364_101033982 205
234 3300006058 Ga0075432_10000283 Ga0075432_100002832 205
235 3300006058 Ga0075432_10006283 Ga0075432_100062834 205
236 3300006177 Ga0075362_10208040 Ga0075362_102080402 205
237 3300006914 Ga0075436_100167993 Ga0075436_1001679931 205
238 3300006946 Ga0079104_1000096 Ga0079104_10000965 205
239 3300009011 Ga0105251_10000003 Ga0105251_10000003236 205
240 3300009011 Ga0105251_10004069 Ga0105251_100040697 205
241 3300009011 Ga0105251_10023139 Ga0105251_100231392 205
242 3300009011 Ga0105251_10050437 Ga0105251_100504372 205
243 3300009036 Ga0105244_10013142 Ga0105244_100131425 205
244 3300009092 Ga0105250_10000160 Ga0105250_1000016039 205
245 3300009092 Ga0105250_10000207 Ga0105250_1000020710 205
246 3300009092 Ga0105250_10025257 Ga0105250_100252572 205
247 3300009092 Ga0105250_10043853 Ga0105250_100438532 205
248 3300009148 Ga0105243_10239901 Ga0105243_102399012 205
249 3300013100 Ga0157373_10164731 Ga0157373_101647312 205
250 3300013104 Ga0157370_10290325 Ga0157370_102903252 205
251 3300013306 Ga0163162_10000137 Ga0163162_100001376 205
252 3300013306 Ga0163162_10197112 Ga0163162_101971122 205
253 3300013307 Ga0157372_10107160 Ga0157372_101071602 205
254 3300013308 Ga0157375_10105830 Ga0157375_101058302 205
255 3300014497 Ga0182008_10002102 Ga0182008_1000210210 205
256 3300015261 Ga0182006_1005569 Ga0182006_10055692 205
257 3300015265 Ga0182005_1066346 Ga0182005_10663461 205
258 3300017792 Ga0163161_10000054 Ga0163161_10000054135 205
259 3300017792 Ga0163161_10020632 Ga0163161_100206325 205
260 3300017792 Ga0163161_10114034 Ga0163161_101140343 205
261 3300025230 Ga0209563_100671 Ga0209563_1006719 205
262 3300025292 Ga0209676_1004835 Ga0209676_10048355 205
263 3300025298 Ga0209050_1000229 Ga0209050_100022926 205
264 3300025303 Ga0209051_1003454 Ga0209051_10034542 205
265 3300025711 Ga0207696_1000002 Ga0207696_1000002348 205
266 3300025711 Ga0207696_1000075 Ga0207696_100007540 205
267 3300025711 Ga0207696_1030104 Ga0207696_10301042 205
268 3300025728 Ga0207655_1000019 Ga0207655_1000019416 205
269 3300025728 Ga0207655_1002113 Ga0207655_10021133 205
270 3300025728 Ga0207655_1024013 Ga0207655_10240133 205
271 3300025728 Ga0207655_1088078 Ga0207655_10880781 205
272 3300025735 Ga0207713_1000009 Ga0207713_100000953 205
273 3300025735 Ga0207713_1028956 Ga0207713_10289563 205
274 3300025735 Ga0207713_1056410 Ga0207713_10564102 205
275 3300025735 Ga0207713_1058945 Ga0207713_10589452 205
276 3300025735 Ga0207713_1153740 Ga0207713_11537401 205
277 3300025933 Ga0207706_10063173 Ga0207706_100631733 205
278 3300025935 Ga0207709_10000439 Ga0207709_1000043920 205
279 3300027111 Ga0209281_1000020 Ga0209281_1000020121 205
280 3300027907 Ga0207428_10003937 Ga0207428_100039373 205
281 3300027907 Ga0207428_10028258 Ga0207428_100282585 205
282 3300033180 Ga0307510_10005552 Ga0307510_100055526 205
283 3300038705 Ga0237819_00713 Ga0237819_00713_1743_2396 205
284 3300039447 Ga0436361_1040516 Ga0436361_1040516_17_634 205
285 3300041405 Ga0439438_001397 Ga0439438_001397_7190_7807 205
286 3300041405 Ga0439438_002347 Ga0439438_002347_5352_5975 205
287 3300041407 Ga0439447_006392 Ga0439447_006392_2602_3219 205
288 3300041411 Ga0439466_0074771 Ga0439466_0074771_388_1011 205
289 3300042009 Ga0439451_000933 Ga0439451_000933_1883_2500 205
290 3300042013 Ga0439456_009462 Ga0439456_009462_506_1123 205
291 3300042115 Ga0450911_019095 Ga0450911_019095_40_657 205
292 3300042121 Ga0450919_007258 Ga0450919_007258_380_1003 205
293 3300042122 Ga0450920_000989 Ga0450920_000989_1345_1962 205
294 3300042124 Ga0450922_003400 Ga0450922_003400_292_909 205
295 3300042138 Ga0450903_003590 Ga0450903_003590_938_1555 205
296 3300042138 Ga0450903_010503 Ga0450903_010503_505_1125 205
297 3300042145 Ga0450906_010731 Ga0450906_010731_1066_1683 205
298 3300042146 Ga0450907_003059 Ga0450907_003059_1875_2498 205
299 3300042147 Ga0450910_008317 Ga0450910_008317_544_1161 205
300 3300042184 Ga0450908_006096 Ga0450908_006096_950_1573 205
301 3300042439 Ga0439464_0015962 Ga0439464_0015962_582_1199 205
302 3300042461 Ga0439460_0000975 Ga0439460_0000975_1509_2126 205
303 3300042461 Ga0439460_0001906 Ga0439460_0001906_3894_4511 205
304 3300042531 Ga0450918_010238 Ga0450918_010238_870_1487 205
305 3300042876 Ga0451577_0005424 Ga0451577_0005424_3380_4087 205
306 3300042993 Ga0439440_0067613 Ga0439440_0067613_61_678 205
307 3300046452 Ga0495617_000415 Ga0495617_000415_21363_21980 205
308 3300046452 Ga0495617_001567 Ga0495617_001567_1358_1984 205
309 3300046452 Ga0495617_008457 Ga0495617_008457_545_1198 205
310 3300046453 Ga0495627_000497 Ga0495627_000497_20062_20688 205
311 3300046454 Ga0495592_0001251 Ga0495592_0001251_7295_7945 205
312 3300046457 Ga0495590_0000491 Ga0495590_0000491_2603_3256 205
313 3300046458 Ga0495591_018413 Ga0495591_018413_1185_1811 205
314 3300046460 Ga0495638_0005389 Ga0495638_0005389_5697_6350 205
315 3300046460 Ga0495638_0131044 Ga0495638_0131044_370_996 205
316 3300046463 Ga0495653_0000250 Ga0495653_0000250_7310_7960 205
317 3300046491 Ga0495584_0001284 Ga0495584_0001284_5565_6191 205
318 3300046492 Ga0495585_0184598 Ga0495585_0184598_297_923 205
319 3300046501 Ga0495607_0005029 Ga0495607_0005029_3370_3996 205
320 3300046501 Ga0495607_0010875 Ga0495607_0010875_514_1140 205
321 3300046501 Ga0495607_0038668 Ga0495607_0038668_1251_1868 205
322 3300046501 Ga0495607_0217262 Ga0495607_0217262_270_893 205
323 3300046506 Ga0495583_0002309 Ga0495583_0002309_5794_6420 205
324 3300046512 Ga0495610_0003412 Ga0495610_0003412_1257_1883 205
325 3300046513 Ga0495616_0003859 Ga0495616_0003859_5843_6469 205
326 3300046515 Ga0495620_0121380 Ga0495620_0121380_212_832 205
327 3300046519 Ga0495632_0000277 Ga0495632_0000277_41718_42344 205
328 3300046519 Ga0495632_0002099 Ga0495632_0002099_13745_14362 205
329 3300046520 Ga0495637_0000275 Ga0495637_0000275_29286_29912 205
330 3300046522 Ga0495643_0000783 Ga0495643_0000783_24397_25023 205
331 3300046524 Ga0495648_0000318 Ga0495648_0000318_14400_15026 205
332 3300046529 Ga0495652_0239890 Ga0495652_0239890_362_979 205
333 3300046530 Ga0495654_0001645 Ga0495654_0001645_13256_13873 205
334 3300046538 Ga0495609_0001884 Ga0495609_0001884_5790_6416 205
335 3300046542 Ga0495597_0033649 Ga0495597_0033649_424_1050 205
336 3300046543 Ga0495645_0048549 Ga0495645_0048549_1891_2541 205
337 3300046615 Ga0495656_0107424 Ga0495656_0107424_384_1010 205
338 3300046616 Ga0495668_0016020 Ga0495668_0016020_1441_2067 205
339 3300046648 Ga0495611_0000067 Ga0495611_0000067_28931_29557 205
340 3300046660 Ga0495625_0001947 Ga0495625_0001947_21342_21959 205
341 3300046660 Ga0495625_0006625 Ga0495625_0006625_8297_8923 205
342 3300046665 Ga0495661_0002810 Ga0495661_0002810_5566_6192 205
343 3300046665 Ga0495661_0082226 Ga0495661_0082226_299_916 205
344 3300046680 Ga0495646_0002463 Ga0495646_0002463_9358_10008 205
345 3300046689 Ga0495613_0000743 Ga0495613_0000743_14123_14773 205
346 3300046689 Ga0495613_0000978 Ga0495613_0000978_19889_20542 205
347 3300046690 Ga0495624_0000034 Ga0495624_0000034_50202_50852 205
348 3300046691 Ga0495670_0000061 Ga0495670_0000061_37610_38236 205
349 3300046692 Ga0495671_0003987 Ga0495671_0003987_7195_7812 205
350 3300046692 Ga0495671_0007360 Ga0495671_0007360_1156_1782 205
351 3300046692 Ga0495671_0027672 Ga0495671_0027672_1582_2205 205
352 3300046692 Ga0495671_0032666 Ga0495671_0032666_441_1064 205
353 3300046694 Ga0495649_0000735 Ga0495649_0000735_24686_25303 205
354 3300046794 Ga0495589_0103748 Ga0495589_0103748_459_1085 205
355 3300046810 Ga0495660_0006651 Ga0495660_0006651_3225_3851 205
356 3300046810 Ga0495660_0031886 Ga0495660_0031886_2012_2638 205
357 3300047317 Ga0495604_0024755 Ga0495604_0024755_2679_3329 205
358 3300047320 Ga0495672_0000151 Ga0495672_0000151_50505_51155 205
359 3300047320 Ga0495672_0038295 Ga0495672_0038295_854_1480 205
360 3300047321 Ga0495676_0006569 Ga0495676_0006569_347_997 205
361 3300047322 Ga0495680_0006176 Ga0495680_0006176_7304_7954 205
362 3300047323 Ga0495683_0001526 Ga0495683_0001526_1245_1862 205
363 3300047323 Ga0495683_0006336 Ga0495683_0006336_1759_2385 205
364 3300047446 Ga0495679_018701 Ga0495679_018701_262_888 205
365 3300047469 Ga0495673_0005971 Ga0495673_0005971_1677_2303 205
366 3300047469 Ga0495673_0021835 Ga0495673_0021835_223_840 205
367 3300047470 Ga0495681_0000240 Ga0495681_0000240_24777_25403 205
368 3300047471 Ga0495684_0069646 Ga0495684_0069646_114_764 205
369 3300047472 Ga0495686_0002037 Ga0495686_0002037_5825_6451 205
370 3300047673 Ga0495593_0009438 Ga0495593_0009438_3951_4601 205
371 3300048088 Ga0495602_0000429 Ga0495602_0000429_4443_5093 205
372 3300048909 Ga0496106_0350101 Ga0496106_0350101_198_818 205
373 3300048913 Ga0496110_0116482 Ga0496110_0116482_1364_1981 205
374 3300048919 Ga0496116_0000827 Ga0496116_0000827_4627_5247 205
375 3300048919 Ga0496116_0005079 Ga0496116_0005079_6269_6889 205
376 3300048919 Ga0496116_0180478 Ga0496116_0180478_212_829 205
377 3300048920 Ga0496117_0000133 Ga0496117_0000133_69812_70429 205
378 3300048920 Ga0496117_0002629 Ga0496117_0002629_6370_6990 205
379 3300048920 Ga0496117_0004196 Ga0496117_0004196_4643_5263 205
380 3300048921 Ga0496118_0000966 Ga0496118_0000966_6327_6947 205
381 3300048921 Ga0496118_0003371 Ga0496118_0003371_3947_4567 205
382 3300048921 Ga0496118_0031423 Ga0496118_0031423_863_1480 205
383 3300048921 Ga0496118_0033228 Ga0496118_0033228_3143_3760 205
384 3300048924 Ga0496121_0001424 Ga0496121_0001424_32192_32812 205
385 3300048925 Ga0496122_0015460 Ga0496122_0015460_641_1261 205
386 3300048926 Ga0496123_0003948 Ga0496123_0003948_9068_9688 205
387 3300048926 Ga0496123_0062703 Ga0496123_0062703_871_1491 205
388 3300048927 Ga0496124_0003771 Ga0496124_0003771_16400_17020 205
389 3300048927 Ga0496124_0031391 Ga0496124_0031391_2681_3301 205
390 3300048927 Ga0496124_0044708 Ga0496124_0044708_1709_2326 205
391 3300048927 Ga0496124_0046841 Ga0496124_0046841_384_1001 205
392 3300048928 Ga0496125_0012244 Ga0496125_0012244_4227_4847 205
393 3300048929 Ga0496126_0189995 Ga0496126_0189995_121_738 205
394 3300050491 nmdc:mga00v17_17312_c1 nmdc:mga00v17_17312_c1_1365_1982 205
395 3300050491 nmdc:mga00v17_324438_c1 nmdc:mga00v17_324438_c1_259_876 205
396 3300053125 Ga0500618_003827 Ga0500618_003827_2856_3479 205

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01810

LysE

LysE type translocator

42

231

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ex4-assembly1.cif.gz_A human s1p transporter spns2 in an inward-facing open conformation (state 1) 0.4546 1 198
6ob6-assembly1.cif.gz_A human equilibrative nucleoside transporter-1, s-(4-nitrobenzyl)-6-thioinosine bound, merohedrally twinned 0.451 1 205
6e9n-assembly2.cif.gz_B e. coli d-galactonate:proton symporter in the inward open form 0.4428 1 202
6ob6-assembly1.cif.gz_A human equilibrative nucleoside transporter-1, s-(4-nitrobenzyl)-6-thioinosine bound, merohedrally twinned 0.4313 1 205
7xzi-assembly1.cif.gz_A cryo-em structure of toc-tic supercomplex from chlamydomonas reinhardtii 0.4306 2 203
ID Description Score Start End Superfamily
af_P76264_30_182_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6954 22 198 1.20.1250.20
af_P76264_30_182_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6766 22 198 1.20.1250.20
af_Q2FZP3_16_220_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5891 6 198 1.20.1250.20
af_Q2R4J1_1_279_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.553 2 202 1.20.1250.20
af_Q2R4J1_1_279_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5435 2 202 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A021X3G6-F1-model_v4 Putative threonine efflux protein 0.9199 2 203 GO:0005886
GO:0015171
AF-A0A5D3WLB5-F1-model_v4 Threonine/homoserine/homoserine lactone efflux protein 0.909 2 199 GO:0005886
GO:0015171
AF-A0A5P6NW10-F1-model_v4 deleted 0.909 2 202
AF-A0A231GPC9-F1-model_v4 Threonine/homoserine/homoserine lactone efflux protein 0.9089 2 202 GO:0005886
GO:0015171
AF-A0A543QTM5-F1-model_v4 deleted 0.9074 2 202

Feature Viewer

pLDDT pTM Quality
79.42 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map