F433430

General Info

Members Datasets Scaffolds Average Seq Length
396 162 395 157

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100258601|Ga0070714_1002586011
Length 189
Sequence MCITGTIRPATPMLRRVTHMADRGAGDAVSRWAMRVQRFDVRIAAGPKGHGLIVVPFDPDAEWGVKAVHHVSGTVNGCRVRVTLEPGESGWSFAMNPARMQHAGIAVGALAPAELSPEGPQRGDLADDVAAALEGNPAAGAFFDTLAQFYRKGYLRYIDATKRRPDLRAERIAEVTGLLASGIKERPRS

Samples

Sample ID Description Type Environment
1 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
39 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
45 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
59 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
60 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
61 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
62 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
63 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
64 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
65 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
66 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
67 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
68 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
69 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
70 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
71 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
72 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
73 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
74 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
75 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
76 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
77 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
78 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
79 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
80 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
81 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
82 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
83 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
84 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
85 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
86 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
87 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
88 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
89 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
90 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
91 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
92 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
93 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
94 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
95 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
96 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
97 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
98 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
99 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
100 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
101 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
102 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
103 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
104 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
105 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
106 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
107 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
108 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
109 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
110 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
111 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
112 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
113 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
114 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
115 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
116 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
117 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
118 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
119 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
120 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
121 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
122 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
123 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
124 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
125 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
126 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
127 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
128 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
129 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
130 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
131 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
132 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
133 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
134 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
135 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
136 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
137 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
138 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
139 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
140 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
143 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
144 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
149 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
150 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
151 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
152 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
153 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
154 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
155 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
156 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
157 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
158 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
159 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
160 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
161 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
162 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0
Isolates 0.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.29
Rhizosphere 94.95
Stem 0
Stem Tuber 0
Unclassified 0.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10002959 3300003659 Bacteria 3297
2 Ga0065707_10088987 3300005295 Bacteria 4496
3 Ga0065707_10205196 3300005295 Unclassified 1288
4 Ga0070683_100576668 3300005329 Bacteria 1076
5 Ga0068869_100138719 3300005334 Bacteria 1876
6 Ga0070675_100964595 3300005354 Bacteria 782
7 Ga0070709_11189266 3300005434 Bacteria 612
8 Ga0070714_100046862 3300005435 Bacteria 3669
9 Ga0070714_100258601 3300005435 Bacteria 1612
10 Ga0070714_100260293 3300005435 Bacteria 1606
11 Ga0070714_100331169 3300005435 Bacteria 1426
12 Ga0070714_100426169 3300005435 Unclassified 1257
13 Ga0070714_100711665 3300005435 Bacteria 969
14 Ga0070713_100032292 3300005436 Bacteria 4180
15 Ga0070713_100142658 3300005436 Bacteria 2123
16 Ga0070713_100158392 3300005436 Bacteria 2019
17 Ga0070713_100165900 3300005436 Bacteria 1975
18 Ga0070713_100357656 3300005436 Bacteria 1356
19 Ga0070713_100863058 3300005436 Bacteria 869
20 Ga0070713_101667214 3300005436 Bacteria 619
21 Ga0070713_102078167 3300005436 Bacteria 551
22 Ga0070710_10101574 3300005437 Unclassified 1713
23 Ga0070711_100060583 3300005439 Bacteria 2631
24 Ga0070711_100193160 3300005439 Bacteria 1566
25 Ga0070711_100235466 3300005439 Bacteria 1429
26 Ga0070711_100393252 3300005439 Bacteria 1124
27 Ga0070708_100268297 3300005445 Bacteria 1605
28 Ga0070708_100345554 3300005445 Bacteria 1402
29 Ga0070681_10993130 3300005458 Unclassified 759
30 Ga0070706_100001286 3300005467 Bacteria 26758
31 Ga0070706_100031308 3300005467 Bacteria 4906
32 Ga0070706_100545464 3300005467 Bacteria 1078
33 Ga0070707_100182021 3300005468 Bacteria 2048
34 Ga0070707_101068620 3300005468 Unclassified 773
35 Ga0070698_100000262 3300005471 Bacteria 53087
36 Ga0070698_100012015 3300005471 Bacteria 9180
37 Ga0070698_100025091 3300005471 Bacteria 6213
38 Ga0070698_100142936 3300005471 Bacteria 2343
39 Ga0070698_100662742 3300005471 Bacteria 985
40 Ga0070699_100229763 3300005518 Unclassified 1654
41 Ga0070699_100491845 3300005518 Bacteria 1114
42 Ga0070684_100195022 3300005535 Bacteria 1844
43 Ga0068857_101076398 3300005577 Bacteria 776
44 Ga0070702_100554081 3300005615 Bacteria 854
45 Ga0068859_100042696 3300005617 Bacteria 4555
46 Ga0068863_100002102 3300005841 Bacteria 19738
47 Ga0068863_101297099 3300005841 Bacteria 735
48 Ga0068858_100088763 3300005842 Bacteria 2876
49 Ga0081455_10025310 3300005937 Bacteria 5481
50 Ga0081540_1000520 3300005983 Bacteria 37750
51 Ga0081539_10010790 3300005985 Bacteria 7350
52 Ga0081539_10050161 3300005985 Bacteria 2363
53 Ga0070717_10002692 3300006028 Bacteria 12524
54 Ga0070717_10034347 3300006028 Bacteria 4099
55 Ga0070717_10245096 3300006028 Bacteria 1581
56 Ga0070717_10432588 3300006028 Bacteria 1184
57 Ga0070717_10618843 3300006028 Bacteria 982
58 Ga0070717_10671948 3300006028 Bacteria 940
59 Ga0070717_10872604 3300006028 Bacteria 819
60 Ga0070716_100224776 3300006173 Bacteria 1263
61 Ga0070716_100315915 3300006173 Bacteria 1093
62 Ga0070716_100533958 3300006173 Bacteria 871
63 Ga0070712_100006071 3300006175 Bacteria 7479
64 Ga0070712_100032260 3300006175 Bacteria 3536
65 Ga0070712_100237885 3300006175 Unclassified 1449
66 Ga0070712_100262653 3300006175 Bacteria 1384
67 Ga0068871_100642914 3300006358 Unclassified 968
68 Ga0075428_101034258 3300006844 Unclassified 869
69 Ga0075428_101449968 3300006844 Bacteria 720
70 Ga0075431_100391846 3300006847 Unclassified 1391
71 Ga0075431_100419134 3300006847 Bacteria 1338
72 Ga0075431_100880452 3300006847 Bacteria 866
73 Ga0075431_101121021 3300006847 Unclassified 751
74 Ga0075433_10352527 3300006852 Bacteria 1300
75 Ga0075434_100149998 3300006871 Bacteria 2351
76 Ga0075436_100144779 3300006914 Bacteria 1670
77 Ga0075436_100150266 3300006914 Bacteria 1639
78 Ga0075436_100342627 3300006914 Bacteria 1076
79 Ga0097620_100042699 3300006931 Bacteria 4555
80 Ga0075435_100284672 3300007076 Bacteria 1411
81 Ga0075435_100911575 3300007076 Bacteria 767
82 Ga0099795_10081358 3300007788 Bacteria 1240
83 Ga0105251_10322745 3300009011 Bacteria 702
84 Ga0111539_10014152 3300009094 Bacteria 9961
85 Ga0111539_10689087 3300009094 Unclassified 1189
86 Ga0114129_10003690 3300009147 Bacteria 21560
87 Ga0114129_10126263 3300009147 Bacteria 3517
88 Ga0114129_12251184 3300009147 Unclassified 655
89 Ga0114129_12278875 3300009147 Bacteria 650
90 Ga0105241_10377359 3300009174 Bacteria 1238
91 Ga0157378_10453220 3300013297 Bacteria 1274
92 Ga0224572_1042369 3300024225 Bacteria 856
93 Ga0207685_10005580 3300025905 Bacteria 3338
94 Ga0207699_10030209 3300025906 Bacteria 3030
95 Ga0207699_10086423 3300025906 Bacteria 1958
96 Ga0207699_10229961 3300025906 Bacteria 1270
97 Ga0207684_10001357 3300025910 Bacteria 26760
98 Ga0207684_10240958 3300025910 Bacteria 1560
99 Ga0207693_10107573 3300025915 Bacteria 2188
100 Ga0207693_10224335 3300025915 Bacteria 1476
101 Ga0207693_10320094 3300025915 Bacteria 1214
102 Ga0207693_10478664 3300025915 Bacteria 972
103 Ga0207693_10624900 3300025915 Bacteria 838
104 Ga0207693_10725680 3300025915 Unclassified 769
105 Ga0207663_10520305 3300025916 Bacteria 926
106 Ga0207700_10010060 3300025928 Bacteria 5945
107 Ga0207700_10013861 3300025928 Bacteria 5263
108 Ga0207700_10017163 3300025928 Bacteria 4829
109 Ga0207700_10285990 3300025928 Bacteria 1420
110 Ga0207700_11234664 3300025928 Bacteria 667
111 Ga0207664_10030487 3300025929 Bacteria 4118
112 Ga0207664_10089118 3300025929 Bacteria 2526
113 Ga0207664_10144604 3300025929 Bacteria 2015
114 Ga0207664_10210545 3300025929 Bacteria 1682
115 Ga0207664_10533441 3300025929 Bacteria 1052
116 Ga0207664_10799768 3300025929 Bacteria 848
117 Ga0207644_10614102 3300025931 Bacteria 904
118 Ga0207665_10014715 3300025939 Bacteria 5146
119 Ga0207665_10826966 3300025939 Bacteria 732
120 Ga0207665_10959498 3300025939 Unclassified 679
121 Ga0207661_10524159 3300025944 Bacteria 1084
122 Ga0207679_11553723 3300025945 Unclassified 607
123 Ga0207641_10004622 3300026088 Bacteria 11889
124 Ga0207641_10383410 3300026088 Bacteria 1347
125 Ga0207683_10055167 3300026121 Bacteria 3485
126 Ga0207428_10014089 3300027907 Bacteria 6962
127 Ga0265314_10046218 3300031711 Bacteria 3073
128 Ga0307409_100419249 3300031995 Bacteria 1284
129 Ga0307415_100058211 3300032126 Bacteria 2660
130 Ga0307415_100256547 3300032126 Bacteria 1424
131 Ga0307507_10028674 3300033179 Bacteria 5924
132 Ga0373959_0053355 3300034820 Unclassified 878
133 Ga0373926_0005817 3300035083 Bacteria 4074
134 Ga0373926_0027720 3300035083 Bacteria 1986
135 Ga0373926_0126524 3300035083 Bacteria 966
136 Ga0373934_0068077 3300035086 Unclassified 1422
137 Ga0373934_0068265 3300035086 Bacteria 1420
138 Ga0373940_0185875 3300035088 Bacteria 677
139 Ga0373944_0007635 3300035089 Bacteria 2903
140 Ga0373944_0038205 3300035089 Bacteria 1474
141 Ga0373951_0001693 3300035091 Bacteria 5758
142 Ga0373923_0029026 3300035111 Bacteria 2216
143 Ga0373923_0063376 3300035111 Bacteria 1574
144 Ga0373923_0236035 3300035111 Bacteria 853
145 Ga0373923_0322072 3300035111 Bacteria 734
146 Ga0373932_0150199 3300035112 Unclassified 799
147 Ga0373936_0012015 3300035113 Bacteria 3286
148 Ga0373936_0012827 3300035113 Bacteria 3194
149 Ga0373936_0016867 3300035113 Bacteria 2809
150 Ga0373939_0008063 3300035114 Bacteria 2575
151 Ga0373945_0001429 3300035116 Bacteria 7267
152 Ga0373945_0095802 3300035116 Bacteria 1155
153 Ga0373945_0101483 3300035116 Bacteria 1126
154 Ga0373953_0084556 3300035117 Bacteria 1323
155 Ga0373953_0116649 3300035117 Unclassified 1132
156 Ga0373953_0157249 3300035117 Bacteria 976
157 Ga0373953_0170317 3300035117 Bacteria 937
158 Ga0373956_0014344 3300035119 Bacteria 3310
159 Ga0373956_0184658 3300035119 Bacteria 986
160 Ga0373957_0005848 3300035120 Bacteria 3840
161 Ga0373957_0222401 3300035120 Bacteria 790
162 Ga0373960_0428540 3300035121 Unclassified 515
163 Ga0373943_0001094 3300035170 Bacteria 12075
164 Ga0373943_0022893 3300035170 Bacteria 2900
165 Ga0373946_0001116 3300035171 Bacteria 9277
166 Ga0373946_0106716 3300035171 Bacteria 1262
167 Ga0373946_0161877 3300035171 Bacteria 1051
168 Ga0373955_0012732 3300035172 Bacteria 4051
169 Ga0373955_0065708 3300035172 Bacteria 2014
170 Ga0373962_0006596 3300035242 Bacteria 2813
171 Ga0373924_0000725 3300035410 Bacteria 10257
172 Ga0373924_0029046 3300035410 Bacteria 2208
173 Ga0373924_0077141 3300035410 Bacteria 1413
174 Ga0373924_0161549 3300035410 Unclassified 982
175 Ga0373935_0037239 3300035692 Bacteria 3043
176 Ga0373935_0039989 3300035692 Bacteria 2941
177 Ga0373935_0071805 3300035692 Bacteria 2234
178 Ga0373935_0256920 3300035692 Bacteria 1224
179 Ga0373935_0616257 3300035692 Bacteria 794
180 Ga0373927_0003183 3300035695 Bacteria 11837
181 Ga0373927_0188864 3300035695 Bacteria 1352
182 Ga0373927_0345716 3300035695 Bacteria 980
183 Ga0373927_0534672 3300035695 Bacteria 775
184 Ga0373933_0003939 3300035724 Bacteria 8196
185 Ga0373933_0006039 3300035724 Bacteria 6588
186 Ga0373933_0040562 3300035724 Bacteria 2743
187 Ga0373933_0206006 3300035724 Bacteria 1259
188 Ga0373933_0889811 3300035724 Unclassified 586
189 Ga0373933_0915031 3300035724 Bacteria 577
190 Ga0373933_1163446 3300035724 Bacteria 508
191 Ga0373947_0000022 3300035725 Bacteria 89489
192 Ga0373947_0034816 3300035725 Bacteria 2979
193 Ga0373947_0140700 3300035725 Bacteria 1547
194 Ga0373947_0543426 3300035725 Bacteria 791
195 Ga0373937_0000837 3300036401 Bacteria 26356
196 Ga0373937_0008854 3300036401 Bacteria 8735
197 Ga0373937_0009820 3300036401 Bacteria 8345
198 Ga0373937_0017115 3300036401 Bacteria 6448
199 Ga0373937_0274828 3300036401 Bacteria 1590
200 Ga0373925_0002946 3300037068 Bacteria 13432
201 Ga0373925_0036225 3300037068 Bacteria 3641
202 Ga0436362_0356214 3300039453 Bacteria 733
203 Ga0466965_0133430 3300044683 Bacteria 1289
204 Ga0466963_0177767 3300044694 Bacteria 1485
205 Ga0466957_0112094 3300044842 Unclassified 1731
206 Ga0466960_0232792 3300044901 Bacteria 1017
207 Ga0495592_0015045 3300046454 Bacteria 5875
208 Ga0495592_0253830 3300046454 Bacteria 1161
209 Ga0495592_0319542 3300046454 Unclassified 1004
210 Ga0495592_0441580 3300046454 Bacteria 817
211 Ga0495603_0087035 3300046455 Bacteria 1828
212 Ga0495629_0219841 3300046459 Bacteria 1310
213 Ga0495641_0015373 3300046461 Bacteria 4091
214 Ga0495641_0021198 3300046461 Bacteria 3274
215 Ga0495651_0004991 3300046462 Bacteria 10139
216 Ga0495651_0014018 3300046462 Bacteria 6200
217 Ga0495651_0017796 3300046462 Bacteria 5503
218 Ga0495651_0026367 3300046462 Bacteria 4527
219 Ga0495651_0251346 3300046462 Bacteria 1207
220 Ga0495653_0005346 3300046463 Bacteria 10452
221 Ga0495653_0010030 3300046463 Bacteria 7749
222 Ga0495653_0012805 3300046463 Bacteria 6847
223 Ga0495653_0037353 3300046463 Bacteria 3817
224 Ga0495650_0006143 3300046471 Bacteria 7555
225 Ga0495580_0149108 3300046472 Bacteria 1620
226 Ga0495580_0166914 3300046472 Bacteria 1522
227 Ga0495582_0012144 3300046473 Bacteria 4745
228 Ga0495582_0269855 3300046473 Bacteria 976
229 Ga0495639_0030499 3300046475 Bacteria 2397
230 Ga0495639_0156810 3300046475 Bacteria 1100
231 Ga0495662_0007790 3300046476 Bacteria 5273
232 Ga0495662_0012867 3300046476 Bacteria 4078
233 Ga0495662_0210887 3300046476 Bacteria 957
234 Ga0495664_0041643 3300046477 Bacteria 2718
235 Ga0495664_0105192 3300046477 Bacteria 1701
236 Ga0495664_0193422 3300046477 Bacteria 1233
237 Ga0495664_0247779 3300046477 Bacteria 1077
238 Ga0495664_0416842 3300046477 Bacteria 806
239 Ga0495594_0385159 3300046499 Bacteria 798
240 Ga0495608_0010737 3300046511 Bacteria 6385
241 Ga0495608_0097206 3300046511 Bacteria 1901
242 Ga0495608_0113666 3300046511 Bacteria 1739
243 Ga0495608_0141959 3300046511 Bacteria 1533
244 Ga0495618_0014590 3300046514 Bacteria 4789
245 Ga0495618_0050291 3300046514 Bacteria 2632
246 Ga0495618_0057241 3300046514 Bacteria 2468
247 Ga0495618_0236479 3300046514 Unclassified 1149
248 Ga0495628_0080552 3300046516 Bacteria 2530
249 Ga0495628_0081708 3300046516 Bacteria 2510
250 Ga0495628_0148830 3300046516 Bacteria 1784
251 Ga0495628_0172857 3300046516 Bacteria 1638
252 Ga0495628_0497312 3300046516 Bacteria 881
253 Ga0495630_0025092 3300046517 Bacteria 4406
254 Ga0495630_0066788 3300046517 Bacteria 2703
255 Ga0495630_0133460 3300046517 Bacteria 1886
256 Ga0495666_0123365 3300046526 Bacteria 1212
257 Ga0495652_0058211 3300046529 Bacteria 3273
258 Ga0495652_0284488 3300046529 Bacteria 1209
259 Ga0495652_0747585 3300046529 Bacteria 654
260 Ga0495665_0001527 3300046531 Bacteria 12335
261 Ga0495665_0016376 3300046531 Bacteria 3995
262 Ga0495665_0073214 3300046531 Bacteria 1804
263 Ga0495640_0012900 3300046533 Bacteria 6371
264 Ga0495640_0036250 3300046533 Bacteria 3485
265 Ga0495587_0007315 3300046536 Bacteria 7155
266 Ga0495587_0043345 3300046536 Bacteria 2680
267 Ga0495587_0055801 3300046536 Bacteria 2326
268 Ga0495587_0061747 3300046536 Bacteria 2195
269 Ga0495587_0137488 3300046536 Bacteria 1395
270 Ga0495587_0178172 3300046536 Bacteria 1206
271 Ga0495645_0132997 3300046543 Bacteria 1741
272 Ga0495645_0780476 3300046543 Unclassified 575
273 Ga0495667_0004442 3300046559 Bacteria 9459
274 Ga0495667_0005834 3300046559 Bacteria 8346
275 Ga0495667_0010216 3300046559 Bacteria 6353
276 Ga0495667_0044956 3300046559 Bacteria 2924
277 Ga0495667_0192528 3300046559 Bacteria 1306
278 Ga0495634_0037802 3300046642 Bacteria 3296
279 Ga0495634_0099767 3300046642 Bacteria 1877
280 Ga0495634_0160502 3300046642 Unclassified 1418
281 Ga0495635_0000530 3300046663 Bacteria 24241
282 Ga0495635_0004082 3300046663 Bacteria 10130
283 Ga0495635_0013919 3300046663 Bacteria 5628
284 Ga0495635_0106573 3300046663 Bacteria 1914
285 Ga0495635_0335932 3300046663 Bacteria 1009
286 Ga0495657_0017416 3300046675 Bacteria 5217
287 Ga0495657_0020858 3300046675 Bacteria 4709
288 Ga0495657_0110651 3300046675 Bacteria 1740
289 Ga0495657_0124735 3300046675 Bacteria 1619
290 Ga0495657_0164547 3300046675 Bacteria 1370
291 Ga0495657_0205449 3300046675 Bacteria 1199
292 Ga0495599_0012195 3300046678 Bacteria 5293
293 Ga0495599_0097014 3300046678 Bacteria 1838
294 Ga0495599_0113108 3300046678 Bacteria 1690
295 Ga0495599_0129372 3300046678 Bacteria 1568
296 Ga0495623_0010089 3300046679 Bacteria 6113
297 Ga0495623_0283326 3300046679 Bacteria 921
298 Ga0495623_0379945 3300046679 Bacteria 764
299 Ga0495646_0013799 3300046680 Bacteria 5138
300 Ga0495646_0130452 3300046680 Bacteria 1415
301 Ga0495647_0014849 3300046681 Bacteria 2719
302 Ga0495658_0037023 3300046683 Bacteria 2695
303 Ga0495658_0062459 3300046683 Bacteria 2141
304 Ga0495613_0020379 3300046689 Bacteria 4943
305 Ga0495613_0181267 3300046689 Bacteria 1491
306 Ga0495613_0351212 3300046689 Bacteria 1013
307 Ga0495624_0011782 3300046690 Bacteria 6003
308 Ga0495624_0032771 3300046690 Bacteria 3367
309 Ga0495624_0064443 3300046690 Bacteria 2290
310 Ga0495600_0022400 3300046809 Bacteria 4055
311 Ga0495600_0034394 3300046809 Bacteria 3289
312 Ga0495600_0129876 3300046809 Bacteria 1638
313 Ga0495600_0149951 3300046809 Bacteria 1510
314 Ga0495581_0023401 3300047315 Bacteria 3579
315 Ga0495581_0042589 3300047315 Bacteria 2627
316 Ga0495581_0134442 3300047315 Bacteria 1441
317 Ga0495604_0031787 3300047317 Bacteria 4186
318 Ga0495604_0046646 3300047317 Bacteria 3378
319 Ga0495604_0065575 3300047317 Bacteria 2764
320 Ga0495674_0000369 3300047319 Bacteria 40089
321 Ga0495674_0030045 3300047319 Bacteria 4943
322 Ga0495674_0056561 3300047319 Bacteria 3434
323 Ga0495674_0087778 3300047319 Bacteria 2661
324 Ga0495674_0112960 3300047319 Bacteria 2301
325 Ga0495674_0128856 3300047319 Bacteria 2133
326 Ga0495674_0612838 3300047319 Unclassified 861
327 Ga0495676_0003347 3300047321 Bacteria 14488
328 Ga0495676_0096719 3300047321 Bacteria 2194
329 Ga0495676_0099348 3300047321 Bacteria 2157
330 Ga0495680_0004912 3300047322 Bacteria 12663
331 Ga0495680_0009759 3300047322 Bacteria 8612
332 Ga0495680_0022584 3300047322 Bacteria 5240
333 Ga0495680_0023832 3300047322 Bacteria 5085
334 Ga0495680_0165028 3300047322 Bacteria 1606
335 Ga0495680_0191852 3300047322 Bacteria 1469
336 Ga0495680_0771471 3300047322 Bacteria 630
337 Ga0495675_0181149 3300047444 Bacteria 1290
338 Ga0495684_0001889 3300047471 Bacteria 16793
339 Ga0495684_0003891 3300047471 Bacteria 11631
340 Ga0495684_0046993 3300047471 Bacteria 3302
341 Ga0495684_0055845 3300047471 Bacteria 3011
342 Ga0495684_0226857 3300047471 Bacteria 1367
343 Ga0495593_0030002 3300047673 Bacteria 2978
344 Ga0495593_0061471 3300047673 Bacteria 1964
345 Ga0495602_0031489 3300048088 Bacteria 5014
346 Ga0495602_0058938 3300048088 Bacteria 3356
347 Ga0495602_0063739 3300048088 Bacteria 3192
348 Ga0495602_0116512 3300048088 Bacteria 2158
349 Ga0495602_0366718 3300048088 Bacteria 1035
350 Ga0495602_0412160 3300048088 Bacteria 961
351 Ga0495614_0041778 3300048089 Bacteria 1967
352 Ga0496100_0181008 3300048903 Bacteria 1524
353 Ga0496100_0569470 3300048903 Bacteria 878
354 Ga0496100_0674261 3300048903 Bacteria 806
355 Ga0496101_0489513 3300048904 Bacteria 971
356 Ga0496104_0245623 3300048907 Bacteria 1702
357 Ga0496104_1712606 3300048907 Unclassified 531
358 Ga0496105_0077650 3300048908 Bacteria 2742
359 Ga0496106_0947570 3300048909 Bacteria 678
360 Ga0496111_0889021 3300048914 Bacteria 642
361 Ga0496112_0095107 3300048915 Bacteria 2950
362 Ga0496112_1247565 3300048915 Bacteria 659
363 Ga0496113_0425131 3300048916 Bacteria 1067
364 Ga0496114_0318299 3300048917 Bacteria 1374
365 Ga0496114_0742698 3300048917 Bacteria 858
366 Ga0496115_0052299 3300048918 Bacteria 3276
367 Ga0496115_0075950 3300048918 Bacteria 2730
368 Ga0496115_0188846 3300048918 Bacteria 1702
369 Ga0496117_0095990 3300048920 Bacteria 1893
370 Ga0496119_0018457 3300048922 Bacteria 5190
371 nmdc:mga05p37_2317_c1 3300050507 Bacteria 22168
372 nmdc:mga05p37_271038_c1 3300050507 Bacteria 2028
373 nmdc:mga09592_191307_c1 3300050508 Bacteria 1771
374 nmdc:mga0qj67_45938_c1 3300050509 Bacteria 3446
375 nmdc:mga06r32_185538_c1 3300050510 Bacteria 2067
376 nmdc:mga06r32_412292_c1 3300050510 Bacteria 1332
377 nmdc:mga06r32_445815_c1 3300050510 Bacteria 1274
378 nmdc:mga08y16_32921_c1 3300050511 Bacteria 5448
379 nmdc:mga0n895_918595_c1 3300050512 Bacteria 860
380 nmdc:mga0rr50_754024_c1 3300050513 Bacteria 831
381 nmdc:mga08x19_123543_c1 3300050514 Bacteria 1737
382 nmdc:mga08x19_328707_c1 3300050514 Bacteria 1065
383 nmdc:mga08x19_334382_c1 3300050514 Bacteria 1056
384 nmdc:mga0a205_396500_c1 3300050515 Bacteria 1244
385 nmdc:mga0a205_575574_c1 3300050515 Bacteria 980
386 Ga0495601_0061375 3300053077 Bacteria 2386
387 Ga0495601_0068451 3300053077 Bacteria 2263
388 Ga0495601_0269648 3300053077 Bacteria 1110
389 Ga0495612_0128804 3300053078 Bacteria 1092
390 Ga0495612_0179178 3300053078 Bacteria 930
391 Ga0495619_0028837 3300053085 Bacteria 3581
392 Ga0495619_0059338 3300053085 Bacteria 2542
393 Ga0495619_0510999 3300053085 Bacteria 826
394 Ga0495619_0984572 3300053085 Bacteria 565
395 Ga0495619_1026296 3300053085 Bacteria 551

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050508 nmdc:mga09592_191307_c1 nmdc:mga09592_191307_c1_790_1308 136
2 3300050510 nmdc:mga06r32_412292_c1 nmdc:mga06r32_412292_c1_877_1293 138
3 3300009094 Ga0111539_10014152 Ga0111539_1001415210 146
4 3300050511 nmdc:mga08y16_32921_c1 nmdc:mga08y16_32921_c1_1399_1839 146
5 3300005937 Ga0081455_10025310 Ga0081455_100253102 148
6 3300050509 nmdc:mga0qj67_45938_c1 nmdc:mga0qj67_45938_c1_140_586 148
7 3300005435 Ga0070714_100426169 Ga0070714_1004261692 152
8 3300005467 Ga0070706_100031308 Ga0070706_1000313084 152
9 3300005471 Ga0070698_100000262 Ga0070698_10000026244 152
10 3300025910 Ga0207684_10240958 Ga0207684_102409581 152
11 iso_pu_bacteria 2887478801 2887485011 152
12 3300006847 Ga0075431_100880452 Ga0075431_1008804522 153
13 3300031711 Ga0265314_10046218 Ga0265314_100462184 153
14 3300005295 Ga0065707_10088987 Ga0065707_100889872 154
15 3300005295 Ga0065707_10205196 Ga0065707_102051962 154
16 3300005329 Ga0070683_100576668 Ga0070683_1005766682 154
17 3300005535 Ga0070684_100195022 Ga0070684_1001950223 154
18 3300009147 Ga0114129_10003690 Ga0114129_1000369021 154
19 3300025944 Ga0207661_10524159 Ga0207661_105241592 154
20 3300025945 Ga0207679_11553723 Ga0207679_115537231 154
21 3300027907 Ga0207428_10014089 Ga0207428_100140892 154
22 3300035091 Ga0373951_0001693 Ga0373951_0001693_2662_3126 154
23 3300035724 Ga0373933_1163446 Ga0373933_1163446_17_481 154
24 3300050507 nmdc:mga05p37_2317_c1 nmdc:mga05p37_2317_c1_21138_21671 154
25 3300050515 nmdc:mga0a205_575574_c1 nmdc:mga0a205_575574_c1_36_569 154
26 3300005435 Ga0070714_100260293 Ga0070714_1002602932 155
27 3300005435 Ga0070714_100331169 Ga0070714_1003311692 155
28 3300006847 Ga0075431_100419134 Ga0075431_1004191343 155
29 3300035111 Ga0373923_0322072 Ga0373923_0322072_77_544 155
30 3300044683 Ga0466965_0133430 Ga0466965_0133430_682_1149 155
31 3300044694 Ga0466963_0177767 Ga0466963_0177767_961_1428 155
32 3300044842 Ga0466957_0112094 Ga0466957_0112094_22_489 155
33 3300044901 Ga0466960_0232792 Ga0466960_0232792_426_893 155
34 3300046471 Ga0495650_0006143 Ga0495650_0006143_5866_6333 155
35 3300050510 nmdc:mga06r32_445815_c1 nmdc:mga06r32_445815_c1_510_977 155
36 3300005334 Ga0068869_100138719 Ga0068869_1001387192 156
37 3300005354 Ga0070675_100964595 Ga0070675_1009645951 156
38 3300005434 Ga0070709_11189266 Ga0070709_111892661 156
39 3300005435 Ga0070714_100046862 Ga0070714_1000468622 156
40 3300005435 Ga0070714_100258601 Ga0070714_1002586011 156
41 3300005435 Ga0070714_100711665 Ga0070714_1007116652 156
42 3300005436 Ga0070713_100032292 Ga0070713_1000322924 156
43 3300005436 Ga0070713_100142658 Ga0070713_1001426583 156
44 3300005436 Ga0070713_100158392 Ga0070713_1001583923 156
45 3300005436 Ga0070713_100165900 Ga0070713_1001659002 156
46 3300005436 Ga0070713_100357656 Ga0070713_1003576561 156
47 3300005436 Ga0070713_100863058 Ga0070713_1008630581 156
48 3300005436 Ga0070713_101667214 Ga0070713_1016672141 156
49 3300005437 Ga0070710_10101574 Ga0070710_101015741 156
50 3300005439 Ga0070711_100060583 Ga0070711_1000605832 156
51 3300005439 Ga0070711_100193160 Ga0070711_1001931601 156
52 3300005439 Ga0070711_100235466 Ga0070711_1002354663 156
53 3300005439 Ga0070711_100393252 Ga0070711_1003932522 156
54 3300005445 Ga0070708_100268297 Ga0070708_1002682972 156
55 3300005445 Ga0070708_100345554 Ga0070708_1003455542 156
56 3300005458 Ga0070681_10993130 Ga0070681_109931301 156
57 3300005467 Ga0070706_100001286 Ga0070706_1000012867 156
58 3300005467 Ga0070706_100545464 Ga0070706_1005454641 156
59 3300005468 Ga0070707_100182021 Ga0070707_1001820212 156
60 3300005468 Ga0070707_101068620 Ga0070707_1010686201 156
61 3300005471 Ga0070698_100012015 Ga0070698_1000120155 156
62 3300005471 Ga0070698_100025091 Ga0070698_1000250917 156
63 3300005471 Ga0070698_100142936 Ga0070698_1001429362 156
64 3300005471 Ga0070698_100662742 Ga0070698_1006627422 156
65 3300005518 Ga0070699_100229763 Ga0070699_1002297631 156
66 3300005518 Ga0070699_100491845 Ga0070699_1004918453 156
67 3300005577 Ga0068857_101076398 Ga0068857_1010763981 156
68 3300005615 Ga0070702_100554081 Ga0070702_1005540811 156
69 3300005617 Ga0068859_100042696 Ga0068859_1000426963 156
70 3300005841 Ga0068863_100002102 Ga0068863_10000210217 156
71 3300005841 Ga0068863_101297099 Ga0068863_1012970991 156
72 3300005842 Ga0068858_100088763 Ga0068858_1000887634 156
73 3300005985 Ga0081539_10010790 Ga0081539_100107902 156
74 3300005985 Ga0081539_10050161 Ga0081539_100501612 156
75 3300006028 Ga0070717_10002692 Ga0070717_1000269211 156
76 3300006028 Ga0070717_10034347 Ga0070717_100343473 156
77 3300006028 Ga0070717_10245096 Ga0070717_102450962 156
78 3300006028 Ga0070717_10432588 Ga0070717_104325882 156
79 3300006028 Ga0070717_10618843 Ga0070717_106188432 156
80 3300006028 Ga0070717_10671948 Ga0070717_106719482 156
81 3300006028 Ga0070717_10872604 Ga0070717_108726041 156
82 3300006173 Ga0070716_100224776 Ga0070716_1002247762 156
83 3300006173 Ga0070716_100315915 Ga0070716_1003159152 156
84 3300006173 Ga0070716_100533958 Ga0070716_1005339581 156
85 3300006175 Ga0070712_100006071 Ga0070712_1000060712 156
86 3300006175 Ga0070712_100032260 Ga0070712_1000322604 156
87 3300006175 Ga0070712_100237885 Ga0070712_1002378851 156
88 3300006358 Ga0068871_100642914 Ga0068871_1006429141 156
89 3300006844 Ga0075428_101034258 Ga0075428_1010342581 156
90 3300006844 Ga0075428_101449968 Ga0075428_1014499681 156
91 3300006847 Ga0075431_100391846 Ga0075431_1003918462 156
92 3300006847 Ga0075431_101121021 Ga0075431_1011210211 156
93 3300006852 Ga0075433_10352527 Ga0075433_103525272 156
94 3300006871 Ga0075434_100149998 Ga0075434_1001499982 156
95 3300006914 Ga0075436_100144779 Ga0075436_1001447792 156
96 3300006914 Ga0075436_100150266 Ga0075436_1001502662 156
97 3300006914 Ga0075436_100342627 Ga0075436_1003426272 156
98 3300006931 Ga0097620_100042699 Ga0097620_1000426994 156
99 3300007076 Ga0075435_100284672 Ga0075435_1002846721 156
100 3300007076 Ga0075435_100911575 Ga0075435_1009115751 156
101 3300007788 Ga0099795_10081358 Ga0099795_100813582 156
102 3300009011 Ga0105251_10322745 Ga0105251_103227451 156
103 3300009094 Ga0111539_10689087 Ga0111539_106890872 156
104 3300009147 Ga0114129_10126263 Ga0114129_101262632 156
105 3300009147 Ga0114129_12251184 Ga0114129_122511841 156
106 3300009147 Ga0114129_12278875 Ga0114129_122788751 156
107 3300009174 Ga0105241_10377359 Ga0105241_103773592 156
108 3300013297 Ga0157378_10453220 Ga0157378_104532201 156
109 3300024225 Ga0224572_1042369 Ga0224572_10423691 156
110 3300025905 Ga0207685_10005580 Ga0207685_100055802 156
111 3300025906 Ga0207699_10030209 Ga0207699_100302092 156
112 3300025906 Ga0207699_10086423 Ga0207699_100864232 156
113 3300025906 Ga0207699_10229961 Ga0207699_102299612 156
114 3300025910 Ga0207684_10001357 Ga0207684_100013577 156
115 3300025915 Ga0207693_10107573 Ga0207693_101075734 156
116 3300025915 Ga0207693_10224335 Ga0207693_102243353 156
117 3300025915 Ga0207693_10478664 Ga0207693_104786642 156
118 3300025915 Ga0207693_10624900 Ga0207693_106249001 156
119 3300025915 Ga0207693_10725680 Ga0207693_107256801 156
120 3300025916 Ga0207663_10520305 Ga0207663_105203052 156
121 3300025928 Ga0207700_10010060 Ga0207700_100100605 156
122 3300025928 Ga0207700_10013861 Ga0207700_100138611 156
123 3300025928 Ga0207700_10017163 Ga0207700_100171634 156
124 3300025928 Ga0207700_11234664 Ga0207700_112346641 156
125 3300025929 Ga0207664_10030487 Ga0207664_100304875 156
126 3300025929 Ga0207664_10089118 Ga0207664_100891182 156
127 3300025929 Ga0207664_10144604 Ga0207664_101446043 156
128 3300025929 Ga0207664_10210545 Ga0207664_102105452 156
129 3300025929 Ga0207664_10533441 Ga0207664_105334412 156
130 3300025929 Ga0207664_10799768 Ga0207664_107997682 156
131 3300025931 Ga0207644_10614102 Ga0207644_106141021 156
132 3300025939 Ga0207665_10014715 Ga0207665_100147153 156
133 3300025939 Ga0207665_10826966 Ga0207665_108269662 156
134 3300025939 Ga0207665_10959498 Ga0207665_109594982 156
135 3300026088 Ga0207641_10004622 Ga0207641_100046228 156
136 3300026088 Ga0207641_10383410 Ga0207641_103834102 156
137 3300026121 Ga0207683_10055167 Ga0207683_100551673 156
138 3300031995 Ga0307409_100419249 Ga0307409_1004192492 156
139 3300032126 Ga0307415_100058211 Ga0307415_1000582115 156
140 3300032126 Ga0307415_100256547 Ga0307415_1002565472 156
141 3300033179 Ga0307507_10028674 Ga0307507_100286743 156
142 3300034820 Ga0373959_0053355 Ga0373959_0053355_160_630 156
143 3300035083 Ga0373926_0005817 Ga0373926_0005817_3348_3818 156
144 3300035083 Ga0373926_0027720 Ga0373926_0027720_134_604 156
145 3300035083 Ga0373926_0126524 Ga0373926_0126524_273_743 156
146 3300035086 Ga0373934_0068077 Ga0373934_0068077_648_1118 156
147 3300035086 Ga0373934_0068265 Ga0373934_0068265_636_1106 156
148 3300035088 Ga0373940_0185875 Ga0373940_0185875_173_646 156
149 3300035089 Ga0373944_0007635 Ga0373944_0007635_1495_1965 156
150 3300035089 Ga0373944_0038205 Ga0373944_0038205_947_1417 156
151 3300035111 Ga0373923_0029026 Ga0373923_0029026_273_743 156
152 3300035111 Ga0373923_0063376 Ga0373923_0063376_584_1054 156
153 3300035111 Ga0373923_0236035 Ga0373923_0236035_221_691 156
154 3300035112 Ga0373932_0150199 Ga0373932_0150199_137_607 156
155 3300035113 Ga0373936_0012015 Ga0373936_0012015_1667_2137 156
156 3300035113 Ga0373936_0012827 Ga0373936_0012827_321_791 156
157 3300035113 Ga0373936_0016867 Ga0373936_0016867_1718_2188 156
158 3300035114 Ga0373939_0008063 Ga0373939_0008063_1946_2416 156
159 3300035116 Ga0373945_0001429 Ga0373945_0001429_6630_7100 156
160 3300035116 Ga0373945_0095802 Ga0373945_0095802_335_805 156
161 3300035116 Ga0373945_0101483 Ga0373945_0101483_384_854 156
162 3300035117 Ga0373953_0084556 Ga0373953_0084556_461_931 156
163 3300035117 Ga0373953_0116649 Ga0373953_0116649_207_677 156
164 3300035117 Ga0373953_0170317 Ga0373953_0170317_296_766 156
165 3300035119 Ga0373956_0014344 Ga0373956_0014344_131_601 156
166 3300035119 Ga0373956_0184658 Ga0373956_0184658_332_802 156
167 3300035120 Ga0373957_0005848 Ga0373957_0005848_1769_2239 156
168 3300035120 Ga0373957_0222401 Ga0373957_0222401_233_703 156
169 3300035121 Ga0373960_0428540 Ga0373960_0428540_12_482 156
170 3300035170 Ga0373943_0001094 Ga0373943_0001094_3521_3991 156
171 3300035170 Ga0373943_0022893 Ga0373943_0022893_2352_2822 156
172 3300035171 Ga0373946_0001116 Ga0373946_0001116_97_567 156
173 3300035171 Ga0373946_0106716 Ga0373946_0106716_516_986 156
174 3300035171 Ga0373946_0161877 Ga0373946_0161877_77_547 156
175 3300035172 Ga0373955_0012732 Ga0373955_0012732_1471_1941 156
176 3300035172 Ga0373955_0065708 Ga0373955_0065708_72_542 156
177 3300035242 Ga0373962_0006596 Ga0373962_0006596_1161_1631 156
178 3300035410 Ga0373924_0000725 Ga0373924_0000725_863_1333 156
179 3300035410 Ga0373924_0029046 Ga0373924_0029046_484_954 156
180 3300035410 Ga0373924_0077141 Ga0373924_0077141_462_932 156
181 3300035410 Ga0373924_0161549 Ga0373924_0161549_156_626 156
182 3300035692 Ga0373935_0037239 Ga0373935_0037239_1549_2019 156
183 3300035692 Ga0373935_0039989 Ga0373935_0039989_1681_2151 156
184 3300035692 Ga0373935_0071805 Ga0373935_0071805_1667_2137 156
185 3300035692 Ga0373935_0256920 Ga0373935_0256920_467_937 156
186 3300035692 Ga0373935_0616257 Ga0373935_0616257_255_725 156
187 3300035695 Ga0373927_0003183 Ga0373927_0003183_9819_10289 156
188 3300035695 Ga0373927_0188864 Ga0373927_0188864_673_1143 156
189 3300035695 Ga0373927_0345716 Ga0373927_0345716_296_766 156
190 3300035695 Ga0373927_0534672 Ga0373927_0534672_140_610 156
191 3300035724 Ga0373933_0003939 Ga0373933_0003939_6698_7168 156
192 3300035724 Ga0373933_0006039 Ga0373933_0006039_5627_6097 156
193 3300035724 Ga0373933_0040562 Ga0373933_0040562_658_1128 156
194 3300035724 Ga0373933_0889811 Ga0373933_0889811_76_546 156
195 3300035724 Ga0373933_0915031 Ga0373933_0915031_40_510 156
196 3300035725 Ga0373947_0000022 Ga0373947_0000022_82863_83333 156
197 3300035725 Ga0373947_0034816 Ga0373947_0034816_2257_2727 156
198 3300035725 Ga0373947_0140700 Ga0373947_0140700_415_885 156
199 3300035725 Ga0373947_0543426 Ga0373947_0543426_203_673 156
200 3300036401 Ga0373937_0000837 Ga0373937_0000837_5566_6036 156
201 3300036401 Ga0373937_0008854 Ga0373937_0008854_55_525 156
202 3300036401 Ga0373937_0009820 Ga0373937_0009820_6586_7056 156
203 3300036401 Ga0373937_0017115 Ga0373937_0017115_870_1340 156
204 3300037068 Ga0373925_0002946 Ga0373925_0002946_11805_12275 156
205 3300037068 Ga0373925_0036225 Ga0373925_0036225_2985_3455 156
206 3300039453 Ga0436362_0356214 Ga0436362_0356214_228_707 156
207 3300046454 Ga0495592_0015045 Ga0495592_0015045_5135_5605 156
208 3300046454 Ga0495592_0253830 Ga0495592_0253830_163_633 156
209 3300046454 Ga0495592_0319542 Ga0495592_0319542_406_876 156
210 3300046454 Ga0495592_0441580 Ga0495592_0441580_77_547 156
211 3300046455 Ga0495603_0087035 Ga0495603_0087035_78_548 156
212 3300046459 Ga0495629_0219841 Ga0495629_0219841_376_846 156
213 3300046461 Ga0495641_0015373 Ga0495641_0015373_2585_3055 156
214 3300046461 Ga0495641_0021198 Ga0495641_0021198_2020_2490 156
215 3300046462 Ga0495651_0004991 Ga0495651_0004991_5241_5711 156
216 3300046462 Ga0495651_0014018 Ga0495651_0014018_342_812 156
217 3300046462 Ga0495651_0017796 Ga0495651_0017796_1065_1535 156
218 3300046462 Ga0495651_0026367 Ga0495651_0026367_490_960 156
219 3300046462 Ga0495651_0251346 Ga0495651_0251346_490_987 156
220 3300046463 Ga0495653_0005346 Ga0495653_0005346_7356_7826 156
221 3300046463 Ga0495653_0010030 Ga0495653_0010030_2131_2601 156
222 3300046463 Ga0495653_0012805 Ga0495653_0012805_362_832 156
223 3300046463 Ga0495653_0037353 Ga0495653_0037353_3179_3649 156
224 3300046472 Ga0495580_0149108 Ga0495580_0149108_571_1041 156
225 3300046472 Ga0495580_0166914 Ga0495580_0166914_527_997 156
226 3300046473 Ga0495582_0012144 Ga0495582_0012144_3524_3994 156
227 3300046473 Ga0495582_0269855 Ga0495582_0269855_162_632 156
228 3300046475 Ga0495639_0030499 Ga0495639_0030499_490_960 156
229 3300046475 Ga0495639_0156810 Ga0495639_0156810_344_814 156
230 3300046476 Ga0495662_0007790 Ga0495662_0007790_2775_3245 156
231 3300046476 Ga0495662_0012867 Ga0495662_0012867_2835_3305 156
232 3300046476 Ga0495662_0210887 Ga0495662_0210887_134_604 156
233 3300046477 Ga0495664_0041643 Ga0495664_0041643_2163_2633 156
234 3300046477 Ga0495664_0105192 Ga0495664_0105192_696_1166 156
235 3300046477 Ga0495664_0193422 Ga0495664_0193422_718_1188 156
236 3300046477 Ga0495664_0247779 Ga0495664_0247779_430_906 156
237 3300046477 Ga0495664_0416842 Ga0495664_0416842_287_757 156
238 3300046499 Ga0495594_0385159 Ga0495594_0385159_256_726 156
239 3300046511 Ga0495608_0010737 Ga0495608_0010737_378_848 156
240 3300046511 Ga0495608_0097206 Ga0495608_0097206_814_1284 156
241 3300046511 Ga0495608_0113666 Ga0495608_0113666_415_885 156
242 3300046511 Ga0495608_0141959 Ga0495608_0141959_631_1128 156
243 3300046514 Ga0495618_0014590 Ga0495618_0014590_3782_4252 156
244 3300046514 Ga0495618_0050291 Ga0495618_0050291_15_485 156
245 3300046514 Ga0495618_0057241 Ga0495618_0057241_463_933 156
246 3300046514 Ga0495618_0236479 Ga0495618_0236479_516_986 156
247 3300046516 Ga0495628_0080552 Ga0495628_0080552_1039_1509 156
248 3300046516 Ga0495628_0081708 Ga0495628_0081708_1255_1725 156
249 3300046516 Ga0495628_0148830 Ga0495628_0148830_197_667 156
250 3300046516 Ga0495628_0497312 Ga0495628_0497312_324_794 156
251 3300046517 Ga0495630_0025092 Ga0495630_0025092_1054_1524 156
252 3300046517 Ga0495630_0066788 Ga0495630_0066788_1149_1619 156
253 3300046517 Ga0495630_0133460 Ga0495630_0133460_972_1442 156
254 3300046526 Ga0495666_0123365 Ga0495666_0123365_357_827 156
255 3300046529 Ga0495652_0058211 Ga0495652_0058211_225_695 156
256 3300046529 Ga0495652_0284488 Ga0495652_0284488_276_746 156
257 3300046529 Ga0495652_0747585 Ga0495652_0747585_125_595 156
258 3300046531 Ga0495665_0001527 Ga0495665_0001527_11256_11726 156
259 3300046531 Ga0495665_0016376 Ga0495665_0016376_3271_3741 156
260 3300046531 Ga0495665_0073214 Ga0495665_0073214_28_498 156
261 3300046533 Ga0495640_0012900 Ga0495640_0012900_1016_1486 156
262 3300046533 Ga0495640_0036250 Ga0495640_0036250_2570_3040 156
263 3300046536 Ga0495587_0007315 Ga0495587_0007315_2122_2592 156
264 3300046536 Ga0495587_0043345 Ga0495587_0043345_271_741 156
265 3300046536 Ga0495587_0055801 Ga0495587_0055801_857_1327 156
266 3300046536 Ga0495587_0061747 Ga0495587_0061747_1601_2071 156
267 3300046536 Ga0495587_0137488 Ga0495587_0137488_623_1093 156
268 3300046536 Ga0495587_0178172 Ga0495587_0178172_616_1086 156
269 3300046543 Ga0495645_0132997 Ga0495645_0132997_628_1098 156
270 3300046543 Ga0495645_0780476 Ga0495645_0780476_58_528 156
271 3300046559 Ga0495667_0004442 Ga0495667_0004442_1614_2084 156
272 3300046559 Ga0495667_0005834 Ga0495667_0005834_2543_3013 156
273 3300046559 Ga0495667_0010216 Ga0495667_0010216_5363_5833 156
274 3300046559 Ga0495667_0044956 Ga0495667_0044956_306_776 156
275 3300046559 Ga0495667_0192528 Ga0495667_0192528_449_919 156
276 3300046642 Ga0495634_0037802 Ga0495634_0037802_1621_2091 156
277 3300046642 Ga0495634_0099767 Ga0495634_0099767_767_1237 156
278 3300046642 Ga0495634_0160502 Ga0495634_0160502_223_693 156
279 3300046663 Ga0495635_0000530 Ga0495635_0000530_11669_12139 156
280 3300046663 Ga0495635_0004082 Ga0495635_0004082_1883_2353 156
281 3300046663 Ga0495635_0013919 Ga0495635_0013919_4831_5301 156
282 3300046663 Ga0495635_0106573 Ga0495635_0106573_1149_1619 156
283 3300046663 Ga0495635_0335932 Ga0495635_0335932_497_967 156
284 3300046675 Ga0495657_0017416 Ga0495657_0017416_373_843 156
285 3300046675 Ga0495657_0020858 Ga0495657_0020858_3628_4098 156
286 3300046675 Ga0495657_0110651 Ga0495657_0110651_330_800 156
287 3300046675 Ga0495657_0124735 Ga0495657_0124735_152_622 156
288 3300046675 Ga0495657_0164547 Ga0495657_0164547_404_874 156
289 3300046678 Ga0495599_0012195 Ga0495599_0012195_3210_3680 156
290 3300046678 Ga0495599_0097014 Ga0495599_0097014_86_556 156
291 3300046678 Ga0495599_0113108 Ga0495599_0113108_257_727 156
292 3300046678 Ga0495599_0129372 Ga0495599_0129372_13_483 156
293 3300046679 Ga0495623_0010089 Ga0495623_0010089_4776_5246 156
294 3300046679 Ga0495623_0283326 Ga0495623_0283326_259_729 156
295 3300046680 Ga0495646_0013799 Ga0495646_0013799_528_998 156
296 3300046680 Ga0495646_0130452 Ga0495646_0130452_400_870 156
297 3300046681 Ga0495647_0014849 Ga0495647_0014849_1596_2066 156
298 3300046683 Ga0495658_0037023 Ga0495658_0037023_466_936 156
299 3300046683 Ga0495658_0062459 Ga0495658_0062459_44_514 156
300 3300046689 Ga0495613_0020379 Ga0495613_0020379_4057_4527 156
301 3300046689 Ga0495613_0181267 Ga0495613_0181267_685_1155 156
302 3300046689 Ga0495613_0351212 Ga0495613_0351212_421_891 156
303 3300046690 Ga0495624_0011782 Ga0495624_0011782_1152_1622 156
304 3300046690 Ga0495624_0032771 Ga0495624_0032771_535_1005 156
305 3300046690 Ga0495624_0064443 Ga0495624_0064443_1144_1614 156
306 3300046809 Ga0495600_0022400 Ga0495600_0022400_2308_2778 156
307 3300046809 Ga0495600_0034394 Ga0495600_0034394_2747_3217 156
308 3300046809 Ga0495600_0129876 Ga0495600_0129876_381_851 156
309 3300046809 Ga0495600_0149951 Ga0495600_0149951_145_615 156
310 3300047315 Ga0495581_0023401 Ga0495581_0023401_290_760 156
311 3300047315 Ga0495581_0042589 Ga0495581_0042589_1788_2258 156
312 3300047315 Ga0495581_0134442 Ga0495581_0134442_908_1378 156
313 3300047317 Ga0495604_0031787 Ga0495604_0031787_3163_3633 156
314 3300047317 Ga0495604_0046646 Ga0495604_0046646_888_1358 156
315 3300047317 Ga0495604_0065575 Ga0495604_0065575_934_1404 156
316 3300047319 Ga0495674_0000369 Ga0495674_0000369_27591_28061 156
317 3300047319 Ga0495674_0030045 Ga0495674_0030045_15_485 156
318 3300047319 Ga0495674_0056561 Ga0495674_0056561_626_1096 156
319 3300047319 Ga0495674_0087778 Ga0495674_0087778_418_888 156
320 3300047319 Ga0495674_0112960 Ga0495674_0112960_50_520 156
321 3300047319 Ga0495674_0128856 Ga0495674_0128856_322_798 156
322 3300047319 Ga0495674_0612838 Ga0495674_0612838_242_712 156
323 3300047321 Ga0495676_0003347 Ga0495676_0003347_11345_11815 156
324 3300047321 Ga0495676_0096719 Ga0495676_0096719_1400_1870 156
325 3300047321 Ga0495676_0099348 Ga0495676_0099348_88_558 156
326 3300047322 Ga0495680_0004912 Ga0495680_0004912_11859_12329 156
327 3300047322 Ga0495680_0009759 Ga0495680_0009759_2962_3432 156
328 3300047322 Ga0495680_0022584 Ga0495680_0022584_522_992 156
329 3300047322 Ga0495680_0023832 Ga0495680_0023832_268_738 156
330 3300047322 Ga0495680_0165028 Ga0495680_0165028_424_894 156
331 3300047322 Ga0495680_0191852 Ga0495680_0191852_965_1435 156
332 3300047322 Ga0495680_0771471 Ga0495680_0771471_66_536 156
333 3300047444 Ga0495675_0181149 Ga0495675_0181149_597_1067 156
334 3300047471 Ga0495684_0001889 Ga0495684_0001889_6899_7369 156
335 3300047471 Ga0495684_0003891 Ga0495684_0003891_4072_4542 156
336 3300047471 Ga0495684_0046993 Ga0495684_0046993_1536_2006 156
337 3300047471 Ga0495684_0055845 Ga0495684_0055845_2090_2560 156
338 3300047471 Ga0495684_0226857 Ga0495684_0226857_800_1270 156
339 3300047673 Ga0495593_0030002 Ga0495593_0030002_795_1265 156
340 3300047673 Ga0495593_0061471 Ga0495593_0061471_623_1093 156
341 3300048088 Ga0495602_0031489 Ga0495602_0031489_514_984 156
342 3300048088 Ga0495602_0058938 Ga0495602_0058938_727_1197 156
343 3300048088 Ga0495602_0063739 Ga0495602_0063739_766_1236 156
344 3300048088 Ga0495602_0116512 Ga0495602_0116512_1567_2037 156
345 3300048088 Ga0495602_0366718 Ga0495602_0366718_481_951 156
346 3300048088 Ga0495602_0412160 Ga0495602_0412160_304_774 156
347 3300048089 Ga0495614_0041778 Ga0495614_0041778_623_1093 156
348 3300048903 Ga0496100_0181008 Ga0496100_0181008_834_1304 156
349 3300048903 Ga0496100_0569470 Ga0496100_0569470_174_644 156
350 3300048903 Ga0496100_0674261 Ga0496100_0674261_127_597 156
351 3300048904 Ga0496101_0489513 Ga0496101_0489513_439_909 156
352 3300048907 Ga0496104_0245623 Ga0496104_0245623_1148_1618 156
353 3300048907 Ga0496104_1712606 Ga0496104_1712606_48_518 156
354 3300048908 Ga0496105_0077650 Ga0496105_0077650_180_650 156
355 3300048909 Ga0496106_0947570 Ga0496106_0947570_138_608 156
356 3300048914 Ga0496111_0889021 Ga0496111_0889021_33_503 156
357 3300048915 Ga0496112_0095107 Ga0496112_0095107_1737_2207 156
358 3300048915 Ga0496112_1247565 Ga0496112_1247565_43_513 156
359 3300048916 Ga0496113_0425131 Ga0496113_0425131_403_873 156
360 3300048917 Ga0496114_0318299 Ga0496114_0318299_799_1269 156
361 3300048917 Ga0496114_0742698 Ga0496114_0742698_120_590 156
362 3300048918 Ga0496115_0075950 Ga0496115_0075950_1219_1689 156
363 3300048918 Ga0496115_0188846 Ga0496115_0188846_329_799 156
364 3300048920 Ga0496117_0095990 Ga0496117_0095990_1077_1550 156
365 3300048922 Ga0496119_0018457 Ga0496119_0018457_2717_3190 156
366 3300050507 nmdc:mga05p37_271038_c1 nmdc:mga05p37_271038_c1_299_802 156
367 3300050510 nmdc:mga06r32_185538_c1 nmdc:mga06r32_185538_c1_1388_1864 156
368 3300050512 nmdc:mga0n895_918595_c1 nmdc:mga0n895_918595_c1_109_579 156
369 3300050513 nmdc:mga0rr50_754024_c1 nmdc:mga0rr50_754024_c1_220_690 156
370 3300050514 nmdc:mga08x19_123543_c1 nmdc:mga08x19_123543_c1_615_1085 156
371 3300050514 nmdc:mga08x19_328707_c1 nmdc:mga08x19_328707_c1_17_487 156
372 3300050514 nmdc:mga08x19_334382_c1 nmdc:mga08x19_334382_c1_310_780 156
373 3300050515 nmdc:mga0a205_396500_c1 nmdc:mga0a205_396500_c1_538_1008 156
374 3300053077 Ga0495601_0061375 Ga0495601_0061375_1397_1867 156
375 3300053077 Ga0495601_0068451 Ga0495601_0068451_355_825 156
376 3300053077 Ga0495601_0269648 Ga0495601_0269648_510_980 156
377 3300053078 Ga0495612_0128804 Ga0495612_0128804_561_1031 156
378 3300053078 Ga0495612_0179178 Ga0495612_0179178_292_762 156
379 3300053085 Ga0495619_0028837 Ga0495619_0028837_370_840 156
380 3300053085 Ga0495619_0059338 Ga0495619_0059338_2032_2502 156
381 3300053085 Ga0495619_0510999 Ga0495619_0510999_217_711 156
382 3300053085 Ga0495619_0984572 Ga0495619_0984572_28_498 156
383 3300053085 Ga0495619_1026296 Ga0495619_1026296_37_507 156
384 3300003659 JGI25404J52841_10002959 JGI25404J52841_100029592 157
385 3300005436 Ga0070713_102078167 Ga0070713_1020781671 157
386 3300005983 Ga0081540_1000520 Ga0081540_100052028 157
387 3300006175 Ga0070712_100262653 Ga0070712_1002626532 157
388 3300025915 Ga0207693_10320094 Ga0207693_103200942 157
389 3300025928 Ga0207700_10285990 Ga0207700_102859901 157
390 3300035117 Ga0373953_0157249 Ga0373953_0157249_421_900 157
391 3300035724 Ga0373933_0206006 Ga0373933_0206006_421_900 157
392 3300036401 Ga0373937_0274828 Ga0373937_0274828_146_625 157
393 3300046516 Ga0495628_0172857 Ga0495628_0172857_55_540 157
394 3300046675 Ga0495657_0205449 Ga0495657_0205449_538_1017 157
395 3300046679 Ga0495623_0379945 Ga0495623_0379945_162_641 157
396 3300048918 Ga0496115_0052299 Ga0496115_0052299_1154_1633 157

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13376

OmdA

Bacteriocin-protection, YdeI or OmpD-Associated

124

182

0.94

PF08922

DUF1905

Domain of unknown function (DUF1905)

39

115

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d9r-assembly1.cif.gz_A structure of conserved protein of unknown function pg0164 from porphyromonas gingivalis [w83] 0.8764 2 84
2d9r-assembly1.cif.gz_A structure of conserved protein of unknown function pg0164 from porphyromonas gingivalis [w83] 0.8484 2 84
5b6i-assembly1.cif.gz_B-3 structure of fluorinase from streptomyces sp. ma37 0.6545 3 84
5lmz-assembly1.cif.gz_A fluorinase from streptomyces sp. ma37 0.6521 1 83
2vbv-assembly2.cif.gz_B riboflavin kinase mj0056 from methanocaldococcus jannaschii in complex with cdp and fmn 0.6447 2 84
ID Description Score Start End Superfamily
2d9rA00 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;AF2212/PG0164-like 0.8796 2 84 2.40.30.100
2d9rA00 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;AF2212/PG0164-like 0.8605 2 84 2.40.30.100
af_A0A0R0IAC5_4_96_2.40.330.10 Mainly Beta;Beta Barrel;At1g16640 B3 domain;DNA-binding pseudobarrel domain 0.6591 2 82 2.40.330.10
3lnnA02 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Efflux pump adaptor protein, beta barrel domain 0.6414 4 84 2.40.30.170
5b6iA02 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Bacterial fluorinating enzyme like 0.6387 3 83 2.40.30.90
ID Description Score Start End GO Terms
AF-A0A2N2NGX6-F1-model_v4 DUF1905 domain-containing protein 0.9402 4 83
AF-A0A0K3AWX2-F1-model_v4 DUF1905 domain-containing protein 0.9347 2 87
AF-A0A359EIT3-F1-model_v4 DUF1905 domain-containing protein 0.9335 3 84
AF-A0A2N2MJU7-F1-model_v4 DUF1905 domain-containing protein 0.9226 3 82
AF-A0A1Q8BDT0-F1-model_v4 DUF1905 domain-containing protein 0.9177 1 84

Feature Viewer

pLDDT pTM Quality
91.42 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map