F433406

General Info

Members Datasets Scaffolds Average Seq Length
396 226 372 316

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100069107|Ga0070670_1000691072
Length 340
Sequence MTLHQCMIIYMAPSDDTWHLLVMSLPTASATARMRIWRALKASGCCALRDGVYLLPSGGDREQVLRQLADECDKEGGNAWLMTVLAQSPDEAATYRQLFDRSVDYAALRKSWKVEQRGLASREPADLARLRRRLQREFDAVRTIDFFAGDAAIEADAAWLEFTRRVDGLLAPDEPHETRGGVPRLDVAQYQGRVWATRRRLWIDRVASAWLIRRFIDPGARFRWLARPADCPKRALGFDFDGATFTHVGDLVTFETLMASFGLGKDPGLRRLAAIVHALDIGGEPVAEARGLEAVMAGARERIDDDDLLLAEMSNVLDSLHAHFLAEAQRGADTRQKDSP

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2511231007 Pseudomonas sp. GM18 Isolate Nodule
3 2511231015 Pseudomonas sp. GM49 Isolate Nodule
4 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
5 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
6 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
7 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
8 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
9 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
10 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
11 2773857670 Pseudomonas sp. 478 Isolate Unclassified
12 2784132072 Pseudomonas sp. 460 Isolate Unclassified
13 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
14 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
15 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
16 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
17 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
18 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
19 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
20 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
21 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
22 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
23 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
24 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
25 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
26 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
27 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
28 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
29 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
30 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
31 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
32 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
33 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
34 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
35 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
36 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
37 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
38 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
56 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
67 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
68 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
69 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
72 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
73 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
74 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
75 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
76 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
80 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
102 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
103 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
104 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
105 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
106 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
108 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
109 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
110 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
111 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
112 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
113 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
114 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
115 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
116 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
117 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
118 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
119 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
120 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
121 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
122 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
123 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
124 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
125 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
126 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
127 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
128 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
129 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
130 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
131 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
132 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
133 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
134 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
135 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
136 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
137 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
138 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
139 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
140 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
141 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
142 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
143 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
144 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
145 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
146 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
147 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
148 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
149 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
150 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
151 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
152 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
153 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
154 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
155 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
156 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
157 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
158 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
159 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
160 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
161 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
162 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
163 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
164 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
165 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
166 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
167 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
168 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
169 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
170 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
171 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
172 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
173 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
174 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
175 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
176 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
177 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
178 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
179 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
180 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
181 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
182 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
183 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
184 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
185 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
186 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
187 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
188 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
189 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
190 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
191 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
192 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
193 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
194 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
195 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
196 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
197 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
208 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
209 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
210 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
211 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
212 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
213 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
214 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
215 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
216 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
217 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
218 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
219 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
220 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
222 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
223 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
224 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
225 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
226 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.94
Metatranscriptomes 0
Isolates 6.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.57
Nodule 0.51
Rhizoplane 3.54
Rhizosphere 82.32
Stem 0
Stem Tuber 0
Unclassified 7.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_18 2124908027 Bacteria 64424
2 MRS2a_Contig_6947 2124908027 Bacteria 5595
3 JGI25162J39368_1000053 3300002737 Bacteria 148653
4 JGI25163J39215_1000199 3300002771 Bacteria 23396
5 JGI25164J39214_1000042 3300002772 Bacteria 126523
6 JGI25164J39214_1000080 3300002772 Bacteria 94261
7 JGI25164J39214_1000081 3300002772 Bacteria 93862
8 JGI25165J46597_1000060 3300003214 Bacteria 208907
9 JGI25160J50197_1000234 3300003354 Bacteria 43200
10 Ga0055536_1000051 3300003781 Bacteria 111831
11 Ga0055530_10000042 3300003791 Bacteria 111831
12 Ga0055540_1000699 3300003792 Bacteria 23145
13 Ga0055531_10000002 3300003794 Bacteria 421971
14 Ga0065165_1002260 3300005262 Bacteria 17011
15 Ga0065714_10004647 3300005288 Bacteria 5159
16 Ga0065714_10129711 3300005288 Bacteria 1262
17 Ga0065712_10007659 3300005290 Bacteria 3871
18 Ga0065715_10096055 3300005293 Bacteria 3951
19 Ga0070670_100025554 3300005331 Bacteria 5080
20 Ga0070670_100069107 3300005331 Bacteria 3032
21 Ga0070670_100203302 3300005331 Bacteria 1721
22 Ga0070666_10085982 3300005335 Bacteria 2154
23 Ga0068868_100106191 3300005338 Bacteria 2278
24 Ga0070669_100158601 3300005353 Bacteria 1756
25 Ga0070673_100232414 3300005364 Bacteria 1600
26 Ga0070678_100040882 3300005456 Bacteria 3283
27 Ga0070662_100010925 3300005457 Bacteria 5984
28 Ga0068867_100026161 3300005459 Bacteria 4188
29 Ga0070672_100025261 3300005543 Bacteria 4403
30 Ga0070686_100162743 3300005544 Bacteria 1573
31 Ga0070664_100276853 3300005564 Bacteria 1513
32 Ga0068864_100025924 3300005618 Bacteria 4940
33 Ga0068861_100101945 3300005719 Bacteria 2284
34 Ga0068863_100099413 3300005841 Bacteria 2764
35 Ga0068858_100076995 3300005842 Bacteria 3098
36 Ga0068862_100020902 3300005844 Bacteria 5469
37 Ga0068862_100068285 3300005844 Bacteria 3066
38 Ga0075366_10009560 3300006195 Bacteria 5416
39 Ga0068865_100015782 3300006881 Bacteria 4819
40 Ga0075436_100179381 3300006914 Bacteria 1497
41 Ga0105244_10003446 3300009036 Bacteria 11278
42 Ga0105244_10044580 3300009036 Bacteria 2284
43 Ga0105250_10020398 3300009092 Bacteria 2680
44 Ga0111539_10281870 3300009094 Bacteria 1934
45 Ga0105243_10023298 3300009148 Bacteria 4713
46 Ga0157373_10005614 3300013100 Bacteria 9406
47 Ga0157371_10002772 3300013102 Bacteria 16457
48 Ga0157370_10039630 3300013104 Bacteria 4553
49 Ga0157370_10186042 3300013104 Bacteria 1928
50 Ga0157378_10192156 3300013297 Bacteria 1926
51 Ga0163162_10082634 3300013306 Bacteria 3284
52 Ga0163162_10554435 3300013306 Bacteria 1277
53 Ga0157375_10342621 3300013308 Bacteria 1660
54 Ga0157380_10018691 3300014326 Bacteria 5149
55 Ga0182008_10009225 3300014497 Bacteria 5333
56 Ga0182006_1001385 3300015261 Bacteria 14738
57 Ga0182006_1079928 3300015261 Bacteria 1195
58 Ga0182007_10000303 3300015262 Bacteria 31833
59 Ga0182007_10056200 3300015262 Bacteria 1293
60 Ga0182005_1000877 3300015265 Bacteria 13338
61 Ga0163161_10010417 3300017792 Bacteria 6437
62 Ga0163161_10031478 3300017792 Bacteria 3780
63 Ga0163161_10235147 3300017792 Bacteria 1423
64 Ga0213872_10000110 3300021361 Bacteria 75510
65 Ga0209760_100013 3300025207 Bacteria 181451
66 Ga0207427_100011 3300025231 Bacteria 640076
67 Ga0209437_100025 3300025233 Bacteria 561333
68 Ga0209233_1000012 3300025261 Bacteria 1019519
69 Ga0209676_1000147 3300025292 Bacteria 172386
70 Ga0209564_1005300 3300025295 Bacteria 7429
71 Ga0209050_1000220 3300025298 Bacteria 128144
72 Ga0209050_1005843 3300025298 Bacteria 7540
73 Ga0207426_1000110 3300025302 Bacteria 235630
74 Ga0209051_1000157 3300025303 Bacteria 128123
75 Ga0209051_1011899 3300025303 Bacteria 4253
76 Ga0209257_1000049 3300025304 Bacteria 441224
77 Ga0207696_1007250 3300025711 Bacteria 4357
78 Ga0207655_1001872 3300025728 Bacteria 18118
79 Ga0207713_1010252 3300025735 Bacteria 5201
80 Ga0207682_10010851 3300025893 Bacteria 3567
81 Ga0207645_10007267 3300025907 Bacteria 7837
82 Ga0207645_10016806 3300025907 Bacteria 4838
83 Ga0207650_10039509 3300025925 Bacteria 3448
84 Ga0207659_10039853 3300025926 Bacteria 3280
85 Ga0207706_10043920 3300025933 Bacteria 3960
86 Ga0207669_10028121 3300025937 Bacteria 3089
87 Ga0207691_10016054 3300025940 Bacteria 7113
88 Ga0207689_10007651 3300025942 Bacteria 9461
89 Ga0207679_10117624 3300025945 Bacteria 2109
90 Ga0207712_10246868 3300025961 Bacteria 1441
91 Ga0207668_10014495 3300025972 Bacteria 4880
92 Ga0207678_10197878 3300026067 Bacteria 1718
93 Ga0207648_10017115 3300026089 Bacteria 6605
94 Ga0207675_100006473 3300026118 Bacteria 11083
95 Ga0207428_10021135 3300027907 Bacteria 5513
96 Ga0207428_10038259 3300027907 Bacteria 3901
97 Ga0207428_10100601 3300027907 Bacteria 2234
98 Ga0268265_10044379 3300028380 Bacteria 3310
99 Ga0268265_10075298 3300028380 Bacteria 2643
100 Ga0307408_100000004 3300031548 Bacteria 572889
101 Ga0307408_100004664 3300031548 Bacteria 9264
102 Ga0307408_100008789 3300031548 Bacteria 6669
103 Ga0307408_100017471 3300031548 Bacteria 4801
104 Ga0307408_100022914 3300031548 Bacteria 4249
105 Ga0307405_10000033 3300031731 Bacteria 96827
106 Ga0307412_10000442 3300031911 Bacteria 25120
107 Ga0307412_10002628 3300031911 Bacteria 9977
108 Ga0307412_10037879 3300031911 Bacteria 3100
109 Ga0307414_10048891 3300032004 Bacteria 2921
110 Ga0307414_10053535 3300032004 Bacteria 2815
111 Ga0373927_0015860 3300035695 Bacteria 4971
112 Ga0373925_0009075 3300037068 Bacteria 7240
113 Ga0395899_0168171 3300037312 Bacteria 1545
114 Ga0395901_0010262 3300038443 Bacteria 9487
115 Ga0436361_0814417 3300039447 Bacteria 15822
116 Ga0439436_0028770 3300041404 Bacteria 1620
117 Ga0439447_000816 3300041407 Bacteria 11409
118 Ga0439447_015381 3300041407 Bacteria 2124
119 Ga0439466_0009812 3300041411 Bacteria 3566
120 Ga0439452_032882 3300042010 Bacteria 1263
121 Ga0450922_000633 3300042124 Bacteria 3666
122 Ga0450904_000005 3300042139 Bacteria 60724
123 Ga0450907_000297 3300042146 Bacteria 16814
124 Ga0450910_000027 3300042147 Bacteria 18489
125 Ga0450908_003376 3300042184 Bacteria 3099
126 Ga0495617_000302 3300046452 Bacteria 27788
127 Ga0495617_002480 3300046452 Bacteria 7324
128 Ga0495617_012359 3300046452 Bacteria 2909
129 Ga0495603_0000827 3300046455 Bacteria 17785
130 Ga0495603_0010412 3300046455 Bacteria 5632
131 Ga0495603_0254097 3300046455 Bacteria 1012
132 Ga0495590_0001268 3300046457 Bacteria 10988
133 Ga0495590_0003470 3300046457 Bacteria 6430
134 Ga0495591_000702 3300046458 Bacteria 24358
135 Ga0495591_030369 3300046458 Bacteria 1632
136 Ga0495629_0000987 3300046459 Bacteria 22796
137 Ga0495629_0003898 3300046459 Bacteria 11224
138 Ga0495638_0001691 3300046460 Bacteria 19475
139 Ga0495638_0015930 3300046460 Bacteria 5038
140 Ga0495638_0017725 3300046460 Bacteria 4741
141 Ga0495638_0030854 3300046460 Bacteria 3447
142 Ga0495638_0058943 3300046460 Bacteria 2378
143 Ga0495638_0104219 3300046460 Bacteria 1692
144 Ga0495653_0000517 3300046463 Bacteria 29685
145 Ga0495653_0000544 3300046463 Bacteria 28761
146 Ga0495653_0018818 3300046463 Bacteria 5603
147 Ga0495653_0269501 3300046463 Unclassified 1122
148 Ga0495650_0000315 3300046471 Bacteria 86840
149 Ga0495650_0001340 3300046471 Bacteria 24528
150 Ga0495650_0001489 3300046471 Bacteria 22327
151 Ga0495650_0001796 3300046471 Bacteria 19370
152 Ga0495650_0014997 3300046471 Bacteria 3998
153 Ga0495580_0010854 3300046472 Bacteria 7070
154 Ga0495580_0020753 3300046472 Bacteria 4856
155 Ga0495582_0003075 3300046473 Bacteria 9351
156 Ga0495582_0034829 3300046473 Bacteria 2768
157 Ga0495605_0000912 3300046474 Bacteria 20318
158 Ga0495605_0001164 3300046474 Bacteria 17452
159 Ga0495605_0011130 3300046474 Bacteria 5026
160 Ga0495639_0000090 3300046475 Bacteria 44069
161 Ga0495639_0011163 3300046475 Bacteria 3869
162 Ga0495639_0033444 3300046475 Bacteria 2296
163 Ga0495662_0056605 3300046476 Bacteria 1894
164 Ga0495664_0147283 3300046477 Bacteria 1428
165 Ga0495584_0000375 3300046491 Bacteria 30732
166 Ga0495584_0001318 3300046491 Bacteria 15077
167 Ga0495585_0001302 3300046492 Bacteria 19904
168 Ga0495585_0011863 3300046492 Bacteria 5148
169 Ga0495594_0000902 3300046499 Bacteria 15364
170 Ga0495596_0074267 3300046500 Bacteria 1320
171 Ga0495607_0000028 3300046501 Bacteria 155637
172 Ga0495607_0034136 3300046501 Bacteria 3088
173 Ga0495607_0035605 3300046501 Bacteria 3009
174 Ga0495583_0001424 3300046506 Bacteria 24362
175 Ga0495583_0005325 3300046506 Bacteria 8780
176 Ga0495583_0006308 3300046506 Bacteria 7787
177 Ga0495583_0075686 3300046506 Bacteria 1472
178 Ga0495606_0180952 3300046507 Unclassified 1215
179 Ga0495616_0000247 3300046513 Bacteria 43688
180 Ga0495620_0026188 3300046515 Bacteria 2745
181 Ga0495628_0162112 3300046516 Bacteria 1699
182 Ga0495630_0024141 3300046517 Bacteria 4496
183 Ga0495630_0085906 3300046517 Bacteria 2375
184 Ga0495631_0011785 3300046518 Bacteria 4288
185 Ga0495631_0043314 3300046518 Bacteria 1986
186 Ga0495632_0000205 3300046519 Bacteria 60012
187 Ga0495632_0000229 3300046519 Bacteria 56776
188 Ga0495632_0005787 3300046519 Bacteria 8109
189 Ga0495632_0014095 3300046519 Bacteria 4536
190 Ga0495637_0002175 3300046520 Bacteria 10961
191 Ga0495643_0001048 3300046522 Bacteria 27945
192 Ga0495643_0022400 3300046522 Bacteria 3605
193 Ga0495643_0046100 3300046522 Bacteria 2365
194 Ga0495643_0047440 3300046522 Bacteria 2326
195 Ga0495644_0059413 3300046523 Bacteria 1438
196 Ga0495648_0001354 3300046524 Bacteria 24217
197 Ga0495648_0011413 3300046524 Bacteria 6692
198 Ga0495648_0033957 3300046524 Bacteria 3326
199 Ga0495648_0087595 3300046524 Bacteria 1752
200 Ga0495666_0016141 3300046526 Bacteria 3718
201 Ga0495666_0102971 3300046526 Bacteria 1344
202 Ga0495642_0000024 3300046528 Bacteria 92899
203 Ga0495642_0000296 3300046528 Bacteria 28029
204 Ga0495642_0002934 3300046528 Bacteria 6793
205 Ga0495642_0006101 3300046528 Bacteria 4626
206 Ga0495642_0062003 3300046528 Bacteria 1552
207 Ga0495654_0000272 3300046530 Bacteria 47029
208 Ga0495654_0000517 3300046530 Bacteria 31432
209 Ga0495654_0000820 3300046530 Bacteria 23667
210 Ga0495654_0013830 3300046530 Bacteria 4308
211 Ga0495654_0028211 3300046530 Bacteria 2871
212 Ga0495654_0074191 3300046530 Bacteria 1607
213 Ga0495665_0019970 3300046531 Bacteria 3602
214 Ga0495665_0040308 3300046531 Bacteria 2487
215 Ga0495586_0017613 3300046535 Bacteria 3798
216 Ga0495586_0044235 3300046535 Bacteria 2398
217 Ga0495586_0222660 3300046535 Bacteria 1072
218 Ga0495587_0000361 3300046536 Bacteria 32683
219 Ga0495587_0001352 3300046536 Bacteria 16274
220 Ga0495609_0000610 3300046538 Bacteria 27926
221 Ga0495609_0001156 3300046538 Bacteria 18203
222 Ga0495609_0008821 3300046538 Bacteria 4907
223 Ga0495621_0010376 3300046539 Bacteria 2848
224 Ga0495597_0002005 3300046542 Bacteria 13653
225 Ga0495645_0000678 3300046543 Bacteria 23363
226 Ga0495645_0019239 3300046543 Bacteria 4916
227 Ga0495645_0162321 3300046543 Bacteria 1544
228 Ga0495622_0000354 3300046557 Bacteria 32338
229 Ga0495622_0002428 3300046557 Bacteria 9045
230 Ga0495622_0002708 3300046557 Bacteria 8485
231 Ga0495656_0035271 3300046615 Bacteria 2054
232 Ga0495656_0040164 3300046615 Bacteria 1948
233 Ga0495668_0020071 3300046616 Bacteria 3844
234 Ga0495668_0153696 3300046616 Bacteria 1260
235 Ga0495634_0000091 3300046642 Bacteria 72170
236 Ga0495634_0230375 3300046642 Bacteria 1140
237 Ga0495611_0028146 3300046648 Bacteria 2460
238 Ga0495625_0001165 3300046660 Bacteria 33861
239 Ga0495625_0005032 3300046660 Bacteria 12264
240 Ga0495625_0026518 3300046660 Bacteria 4379
241 Ga0495625_0171670 3300046660 Bacteria 1448
242 Ga0495635_0000127 3300046663 Bacteria 46423
243 Ga0495635_0000142 3300046663 Bacteria 43626
244 Ga0495659_0000335 3300046664 Bacteria 18557
245 Ga0495659_0000477 3300046664 Bacteria 14788
246 Ga0495588_0004148 3300046674 Bacteria 6383
247 Ga0495588_0021261 3300046674 Bacteria 3196
248 Ga0495623_0000068 3300046679 Bacteria 63878
249 Ga0495623_0000396 3300046679 Bacteria 28785
250 Ga0495623_0060565 3300046679 Bacteria 2375
251 Ga0495646_0001284 3300046680 Bacteria 14790
252 Ga0495647_0046745 3300046681 Bacteria 1668
253 Ga0495669_0000568 3300046684 Bacteria 16328
254 Ga0495669_0027286 3300046684 Bacteria 2498
255 Ga0495670_0001066 3300046691 Bacteria 13310
256 Ga0495670_0003832 3300046691 Bacteria 7386
257 Ga0495670_0100359 3300046691 Bacteria 1490
258 Ga0495670_0164818 3300046691 Bacteria 1165
259 Ga0495671_0002684 3300046692 Bacteria 11150
260 Ga0495671_0004844 3300046692 Bacteria 7956
261 Ga0495671_0011982 3300046692 Bacteria 4749
262 Ga0495671_0129131 3300046692 Bacteria 1232
263 Ga0495649_0000023 3300046694 Bacteria 178544
264 Ga0495649_0000039 3300046694 Bacteria 126399
265 Ga0495649_0001882 3300046694 Bacteria 15353
266 Ga0495589_0002225 3300046794 Bacteria 10905
267 Ga0495589_0011435 3300046794 Bacteria 4608
268 Ga0495589_0043324 3300046794 Bacteria 2240
269 Ga0495589_0069719 3300046794 Bacteria 1719
270 Ga0495589_0109402 3300046794 Bacteria 1334
271 Ga0495600_0082147 3300046809 Bacteria 2102
272 Ga0495600_0113628 3300046809 Bacteria 1763
273 Ga0495600_0246357 3300046809 Bacteria 1137
274 Ga0495660_0002465 3300046810 Bacteria 11806
275 Ga0495660_0003005 3300046810 Bacteria 10526
276 Ga0495660_0102905 3300046810 Bacteria 1467
277 Ga0495581_0001079 3300047315 Bacteria 14828
278 Ga0495581_0027868 3300047315 Bacteria 3276
279 Ga0495604_0000779 3300047317 Bacteria 26812
280 Ga0495604_0002389 3300047317 Bacteria 15041
281 Ga0495636_0000248 3300047318 Bacteria 21502
282 Ga0495674_0003369 3300047319 Bacteria 15518
283 Ga0495674_0007502 3300047319 Bacteria 10414
284 Ga0495672_0000077 3300047320 Bacteria 165019
285 Ga0495672_0003319 3300047320 Bacteria 13905
286 Ga0495672_0003477 3300047320 Bacteria 13469
287 Ga0495672_0004256 3300047320 Bacteria 11811
288 Ga0495672_0005910 3300047320 Bacteria 9589
289 Ga0495672_0007490 3300047320 Bacteria 8204
290 Ga0495672_0011342 3300047320 Bacteria 6295
291 Ga0495672_0018100 3300047320 Bacteria 4689
292 Ga0495672_0035489 3300047320 Bacteria 3071
293 Ga0495672_0041353 3300047320 Bacteria 2788
294 Ga0495680_0000029 3300047322 Bacteria 112033
295 Ga0495680_0000901 3300047322 Bacteria 32997
296 Ga0495680_0004603 3300047322 Bacteria 13153
297 Ga0495680_0030436 3300047322 Bacteria 4407
298 Ga0495680_0047517 3300047322 Bacteria 3376
299 Ga0495680_0058602 3300047322 Bacteria 2975
300 Ga0495683_0002840 3300047323 Bacteria 10252
301 Ga0495683_0017475 3300047323 Bacteria 3717
302 Ga0495683_0033307 3300047323 Bacteria 2622
303 Ga0495683_0067029 3300047323 Bacteria 1767
304 Ga0495687_000377 3300047443 Bacteria 55506
305 Ga0495687_001417 3300047443 Bacteria 22048
306 Ga0495687_002968 3300047443 Bacteria 12847
307 Ga0495675_0004722 3300047444 Bacteria 8272
308 Ga0495675_0032460 3300047444 Bacteria 3332
309 Ga0495675_0308026 3300047444 Bacteria 939
310 Ga0495677_0000457 3300047445 Bacteria 17422
311 Ga0495679_038646 3300047446 Unclassified 1494
312 Ga0495685_001618 3300047447 Bacteria 6956
313 Ga0495685_017579 3300047447 Bacteria 2450
314 Ga0495673_0001182 3300047469 Bacteria 21988
315 Ga0495673_0030021 3300047469 Bacteria 2559
316 Ga0495673_0030076 3300047469 Bacteria 2556
317 Ga0495681_0003205 3300047470 Bacteria 11422
318 Ga0495686_0110808 3300047472 Bacteria 1646
319 Ga0495593_0012765 3300047673 Bacteria 4796
320 Ga0495593_0032824 3300047673 Bacteria 2829
321 Ga0495593_0041973 3300047673 Bacteria 2457
322 Ga0495593_0044755 3300047673 Bacteria 2366
323 Ga0495602_0000724 3300048088 Bacteria 31157
324 Ga0495602_0260285 3300048088 Bacteria 1287
325 Ga0495614_0061162 3300048089 Bacteria 1618
326 Ga0495626_0000538 3300048091 Bacteria 37687
327 Ga0495626_0000599 3300048091 Bacteria 35323
328 Ga0495626_0002080 3300048091 Bacteria 14580
329 Ga0496100_0092879 3300048903 Bacteria 2063
330 Ga0496100_0358217 3300048903 Bacteria 1103
331 Ga0496101_0016635 3300048904 Bacteria 4974
332 Ga0496102_0000255 3300048905 Bacteria 69498
333 Ga0496102_0077963 3300048905 Bacteria 3050
334 Ga0496103_0000524 3300048906 Bacteria 31460
335 Ga0496104_0357778 3300048907 Bacteria 1372
336 Ga0496105_0091748 3300048908 Bacteria 2508
337 Ga0496105_0097676 3300048908 Bacteria 2426
338 Ga0496107_0390595 3300048910 Bacteria 1035
339 Ga0496110_0021901 3300048913 Bacteria 5419
340 Ga0496110_0420402 3300048913 Bacteria 1219
341 Ga0496114_0019165 3300048917 Bacteria 5544
342 Ga0496115_0159183 3300048918 Bacteria 1866
343 Ga0496116_0006162 3300048919 Bacteria 10965
344 Ga0496116_0025892 3300048919 Bacteria 4302
345 Ga0496117_0001538 3300048920 Bacteria 32785
346 Ga0496117_0034742 3300048920 Bacteria 3794
347 Ga0496117_0039893 3300048920 Bacteria 3460
348 Ga0496118_0019449 3300048921 Bacteria 6069
349 Ga0496118_0023842 3300048921 Bacteria 5302
350 Ga0496119_0224797 3300048922 Bacteria 959
351 Ga0496121_0032491 3300048924 Bacteria 4742
352 Ga0496122_0005168 3300048925 Bacteria 15704
353 Ga0496123_0086581 3300048926 Bacteria 1878
354 Ga0496124_0066716 3300048927 Bacteria 2996
355 Ga0496124_0156362 3300048927 Bacteria 1782
356 Ga0496125_0010299 3300048928 Bacteria 9467
357 Ga0496125_0031232 3300048928 Bacteria 4750
358 Ga0496126_0000274 3300048929 Bacteria 109129
359 Ga0495678_000167 3300049459 Bacteria 76774
360 Ga0495678_000461 3300049459 Bacteria 40447
361 Ga0495678_001847 3300049459 Bacteria 15487
362 Ga0495678_052369 3300049459 Bacteria 1572
363 Ga0495682_0002912 3300049460 Bacteria 7854
364 Ga0495682_0004463 3300049460 Bacteria 5979
365 Ga0495682_0008372 3300049460 Bacteria 4076
366 Ga0495682_0009813 3300049460 Bacteria 3727
367 Ga0495682_0022287 3300049460 Bacteria 2369
368 Ga0495682_0028237 3300049460 Bacteria 2080
369 Ga0501032_0084170 3300049569 Bacteria 2114
370 Ga0501227_000017 3300049665 Bacteria 25575
371 Ga0501269_000062 3300049766 Bacteria 33601
372 nmdc:mga0k408_105233_c1 3300050493 Bacteria 1666

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048907 Ga0496104_0357778 Ga0496104_0357778_66_887 264
2 3300048910 Ga0496107_0390595 Ga0496107_0390595_65_883 264
3 3300037312 Ga0395899_0168171 Ga0395899_0168171_698_1531 273
4 3300046476 Ga0495662_0056605 Ga0495662_0056605_533_1384 274
5 3300046460 Ga0495638_0104219 Ga0495638_0104219_26_853 275
6 3300021361 Ga0213872_10000110 Ga0213872_1000011024 292
7 3300039447 Ga0436361_0814417 Ga0436361_0814417_10179_11159 292
8 3300049459 Ga0495678_000461 Ga0495678_000461_13520_14401 293
9 3300041404 Ga0439436_0028770 Ga0439436_0028770_404_1291 295
10 3300041407 Ga0439447_015381 Ga0439447_015381_304_1191 295
11 3300042010 Ga0439452_032882 Ga0439452_032882_121_1008 295
12 3300046475 Ga0495639_0033444 Ga0495639_0033444_248_1162 295
13 3300046515 Ga0495620_0026188 Ga0495620_0026188_919_1806 295
14 3300046523 Ga0495644_0059413 Ga0495644_0059413_515_1426 295
15 3300046528 Ga0495642_0006101 Ga0495642_0006101_611_1498 295
16 3300046538 Ga0495609_0008821 Ga0495609_0008821_3129_4016 295
17 3300047444 Ga0495675_0308026 Ga0495675_0308026_15_929 295
18 3300048922 Ga0496119_0224797 Ga0496119_0224797_20_931 295
19 3300031548 Ga0307408_100000004 Ga0307408_100000004497 306
20 3300042139 Ga0450904_000005 Ga0450904_000005_14098_15018 306
21 3300006195 Ga0075366_10009560 Ga0075366_100095605 310
22 3300026067 Ga0207678_10197878 Ga0207678_101978782 310
23 3300050493 nmdc:mga0k408_105233_c1 nmdc:mga0k408_105233_c1_408_1340 310
24 iso_pu_bacteria 2511231007 2511269598 310
25 iso_pu_bacteria 2511231015 2511321788 310
26 iso_pu_bacteria 2512047018 2512327704 310
27 iso_pu_bacteria 2582580891 2583791514 310
28 iso_pu_bacteria 2623620446 2624492951 310
29 iso_pu_bacteria 2643221633 2644188468 310
30 iso_pu_bacteria 2738543004 2739201860 310
31 iso_pu_bacteria 2738543015 2739262557 310
32 iso_pu_bacteria 2740892503 2743738172 310
33 iso_pu_bacteria 2773857670 2774118945 310
34 iso_pu_bacteria 2784132072 2784312584 310
35 iso_pu_bacteria 2860339153 2860344093 310
36 iso_pu_bacteria 2919697872 2919699775 310
37 iso_pu_bacteria 2923153595 2923157222 310
38 iso_pu_bacteria 2929144301 2929146736 310
39 iso_pu_bacteria 2931396565 2931402834 310
40 iso_pu_bacteria 2984286254 2984288846 310
41 iso_pu_bacteria 3007419365 3007423591 310
42 iso_pu_bacteria 3007511990 3007513730 310
43 iso_pu_bacteria 3007855910 3007860418 310
44 iso_pu_bacteria 3007861166 3007861748 310
45 iso_pu_bacteria 640427133 640488864 310
46 iso_pu_bacteria 8019775933 8019775954 310
47 iso_pu_bacteria 8055770955 8055774613 310
48 3300005844 Ga0068862_100020902 Ga0068862_1000209023 311
49 3300028380 Ga0268265_10075298 Ga0268265_100752983 311
50 3300035695 Ga0373927_0015860 Ga0373927_0015860_246_1181 311
51 3300037068 Ga0373925_0009075 Ga0373925_0009075_1098_2033 311
52 3300046477 Ga0495664_0147283 Ga0495664_0147283_211_1146 311
53 3300046681 Ga0495647_0046745 Ga0495647_0046745_417_1352 311
54 3300005844 Ga0068862_100068285 Ga0068862_1000682854 312
55 3300028380 Ga0268265_10044379 Ga0268265_100443794 312
56 3300038443 Ga0395901_0010262 Ga0395901_0010262_918_1868 312
57 3300046660 Ga0495625_0005032 Ga0495625_0005032_6942_7883 313
58 3300046694 Ga0495649_0000039 Ga0495649_0000039_13588_14529 313
59 3300047320 Ga0495672_0003477 Ga0495672_0003477_4074_5015 313
60 2124908027 MRS2a_Contig_18 MRS2a_00079240 314
61 2124908027 MRS2a_Contig_6947 MRS2a_00786880 314
62 3300002737 JGI25162J39368_1000053 JGI25162J39368_100005393 314
63 3300002771 JGI25163J39215_1000199 JGI25163J39215_100019916 314
64 3300002772 JGI25164J39214_1000042 JGI25164J39214_100004271 314
65 3300002772 JGI25164J39214_1000080 JGI25164J39214_100008093 314
66 3300002772 JGI25164J39214_1000081 JGI25164J39214_100008179 314
67 3300003214 JGI25165J46597_1000060 JGI25165J46597_100006094 314
68 3300003354 JGI25160J50197_1000234 JGI25160J50197_10002344 314
69 3300003781 Ga0055536_1000051 Ga0055536_100005176 314
70 3300003791 Ga0055530_10000042 Ga0055530_1000004276 314
71 3300003792 Ga0055540_1000699 Ga0055540_10006997 314
72 3300003794 Ga0055531_10000002 Ga0055531_10000002372 314
73 3300005262 Ga0065165_1002260 Ga0065165_100226021 314
74 3300005288 Ga0065714_10004647 Ga0065714_100046473 314
75 3300005288 Ga0065714_10129711 Ga0065714_101297111 314
76 3300005290 Ga0065712_10007659 Ga0065712_100076592 314
77 3300005293 Ga0065715_10096055 Ga0065715_100960553 314
78 3300005331 Ga0070670_100025554 Ga0070670_1000255545 314
79 3300005331 Ga0070670_100069107 Ga0070670_1000691072 314
80 3300005331 Ga0070670_100203302 Ga0070670_1002033022 314
81 3300005335 Ga0070666_10085982 Ga0070666_100859822 314
82 3300005338 Ga0068868_100106191 Ga0068868_1001061912 314
83 3300005353 Ga0070669_100158601 Ga0070669_1001586012 314
84 3300005364 Ga0070673_100232414 Ga0070673_1002324142 314
85 3300005456 Ga0070678_100040882 Ga0070678_1000408821 314
86 3300005457 Ga0070662_100010925 Ga0070662_1000109254 314
87 3300005459 Ga0068867_100026161 Ga0068867_1000261614 314
88 3300005543 Ga0070672_100025261 Ga0070672_1000252612 314
89 3300005544 Ga0070686_100162743 Ga0070686_1001627431 314
90 3300005564 Ga0070664_100276853 Ga0070664_1002768532 314
91 3300005618 Ga0068864_100025924 Ga0068864_1000259244 314
92 3300005719 Ga0068861_100101945 Ga0068861_1001019452 314
93 3300005841 Ga0068863_100099413 Ga0068863_1000994132 314
94 3300005842 Ga0068858_100076995 Ga0068858_1000769953 314
95 3300006881 Ga0068865_100015782 Ga0068865_1000157824 314
96 3300006914 Ga0075436_100179381 Ga0075436_1001793812 314
97 3300009036 Ga0105244_10003446 Ga0105244_100034466 314
98 3300009036 Ga0105244_10044580 Ga0105244_100445802 314
99 3300009092 Ga0105250_10020398 Ga0105250_100203982 314
100 3300009094 Ga0111539_10281870 Ga0111539_102818702 314
101 3300009148 Ga0105243_10023298 Ga0105243_100232983 314
102 3300013100 Ga0157373_10005614 Ga0157373_100056148 314
103 3300013102 Ga0157371_10002772 Ga0157371_100027725 314
104 3300013104 Ga0157370_10039630 Ga0157370_100396303 314
105 3300013104 Ga0157370_10186042 Ga0157370_101860421 314
106 3300013297 Ga0157378_10192156 Ga0157378_101921562 314
107 3300013306 Ga0163162_10082634 Ga0163162_100826344 314
108 3300013306 Ga0163162_10554435 Ga0163162_105544352 314
109 3300013308 Ga0157375_10342621 Ga0157375_103426212 314
110 3300014326 Ga0157380_10018691 Ga0157380_100186914 314
111 3300014497 Ga0182008_10009225 Ga0182008_100092253 314
112 3300015261 Ga0182006_1001385 Ga0182006_100138510 314
113 3300015261 Ga0182006_1079928 Ga0182006_10799281 314
114 3300015262 Ga0182007_10000303 Ga0182007_1000030310 314
115 3300015262 Ga0182007_10056200 Ga0182007_100562002 314
116 3300015265 Ga0182005_1000877 Ga0182005_100087711 314
117 3300017792 Ga0163161_10010417 Ga0163161_100104174 314
118 3300017792 Ga0163161_10031478 Ga0163161_100314783 314
119 3300017792 Ga0163161_10235147 Ga0163161_102351471 314
120 3300025207 Ga0209760_100013 Ga0209760_10001371 314
121 3300025231 Ga0207427_100011 Ga0207427_100011460 314
122 3300025233 Ga0209437_100025 Ga0209437_100025110 314
123 3300025261 Ga0209233_1000012 Ga0209233_1000012629 314
124 3300025292 Ga0209676_1000147 Ga0209676_100014775 314
125 3300025295 Ga0209564_1005300 Ga0209564_10053002 314
126 3300025298 Ga0209050_1000220 Ga0209050_100022090 314
127 3300025298 Ga0209050_1005843 Ga0209050_10058434 314
128 3300025302 Ga0207426_1000110 Ga0207426_10001105 314
129 3300025303 Ga0209051_1000157 Ga0209051_10001578 314
130 3300025303 Ga0209051_1011899 Ga0209051_10118994 314
131 3300025304 Ga0209257_1000049 Ga0209257_1000049406 314
132 3300025711 Ga0207696_1007250 Ga0207696_10072503 314
133 3300025728 Ga0207655_1001872 Ga0207655_100187210 314
134 3300025735 Ga0207713_1010252 Ga0207713_10102522 314
135 3300025893 Ga0207682_10010851 Ga0207682_100108512 314
136 3300025907 Ga0207645_10007267 Ga0207645_100072676 314
137 3300025907 Ga0207645_10016806 Ga0207645_100168064 314
138 3300025925 Ga0207650_10039509 Ga0207650_100395093 314
139 3300025926 Ga0207659_10039853 Ga0207659_100398535 314
140 3300025933 Ga0207706_10043920 Ga0207706_100439204 314
141 3300025937 Ga0207669_10028121 Ga0207669_100281212 314
142 3300025940 Ga0207691_10016054 Ga0207691_100160544 314
143 3300025942 Ga0207689_10007651 Ga0207689_100076516 314
144 3300025945 Ga0207679_10117624 Ga0207679_101176242 314
145 3300025961 Ga0207712_10246868 Ga0207712_102468682 314
146 3300025972 Ga0207668_10014495 Ga0207668_100144954 314
147 3300026089 Ga0207648_10017115 Ga0207648_100171154 314
148 3300026118 Ga0207675_100006473 Ga0207675_1000064736 314
149 3300027907 Ga0207428_10021135 Ga0207428_100211352 314
150 3300027907 Ga0207428_10038259 Ga0207428_100382593 314
151 3300027907 Ga0207428_10100601 Ga0207428_101006012 314
152 3300031548 Ga0307408_100004664 Ga0307408_1000046645 314
153 3300031548 Ga0307408_100008789 Ga0307408_1000087896 314
154 3300031548 Ga0307408_100017471 Ga0307408_1000174717 314
155 3300031548 Ga0307408_100022914 Ga0307408_1000229143 314
156 3300031731 Ga0307405_10000033 Ga0307405_1000003322 314
157 3300031911 Ga0307412_10000442 Ga0307412_100004425 314
158 3300031911 Ga0307412_10002628 Ga0307412_100026287 314
159 3300031911 Ga0307412_10037879 Ga0307412_100378793 314
160 3300032004 Ga0307414_10048891 Ga0307414_100488912 314
161 3300032004 Ga0307414_10053535 Ga0307414_100535353 314
162 3300041407 Ga0439447_000816 Ga0439447_000816_8432_9376 314
163 3300041411 Ga0439466_0009812 Ga0439466_0009812_2375_3319 314
164 3300042124 Ga0450922_000633 Ga0450922_000633_1947_2891 314
165 3300042146 Ga0450907_000297 Ga0450907_000297_1547_2491 314
166 3300042147 Ga0450910_000027 Ga0450910_000027_3469_4413 314
167 3300042184 Ga0450908_003376 Ga0450908_003376_2085_3029 314
168 3300046452 Ga0495617_000302 Ga0495617_000302_2070_3014 314
169 3300046452 Ga0495617_002480 Ga0495617_002480_6201_7145 314
170 3300046452 Ga0495617_012359 Ga0495617_012359_577_1521 314
171 3300046455 Ga0495603_0000827 Ga0495603_0000827_7815_8759 314
172 3300046455 Ga0495603_0010412 Ga0495603_0010412_506_1486 314
173 3300046455 Ga0495603_0254097 Ga0495603_0254097_48_992 314
174 3300046457 Ga0495590_0001268 Ga0495590_0001268_6189_7133 314
175 3300046457 Ga0495590_0003470 Ga0495590_0003470_627_1571 314
176 3300046458 Ga0495591_000702 Ga0495591_000702_11885_12829 314
177 3300046458 Ga0495591_030369 Ga0495591_030369_425_1405 314
178 3300046459 Ga0495629_0000987 Ga0495629_0000987_3637_4617 314
179 3300046459 Ga0495629_0003898 Ga0495629_0003898_103_1047 314
180 3300046460 Ga0495638_0001691 Ga0495638_0001691_860_1804 314
181 3300046460 Ga0495638_0015930 Ga0495638_0015930_3311_4255 314
182 3300046460 Ga0495638_0017725 Ga0495638_0017725_3238_4182 314
183 3300046460 Ga0495638_0030854 Ga0495638_0030854_1846_2790 314
184 3300046460 Ga0495638_0058943 Ga0495638_0058943_1106_2050 314
185 3300046463 Ga0495653_0000517 Ga0495653_0000517_26569_27513 314
186 3300046463 Ga0495653_0000544 Ga0495653_0000544_15935_16879 314
187 3300046463 Ga0495653_0018818 Ga0495653_0018818_948_1925 314
188 3300046463 Ga0495653_0269501 Ga0495653_0269501_22_999 314
189 3300046471 Ga0495650_0000315 Ga0495650_0000315_73044_73988 314
190 3300046471 Ga0495650_0001340 Ga0495650_0001340_13220_14164 314
191 3300046471 Ga0495650_0001489 Ga0495650_0001489_17445_18425 314
192 3300046471 Ga0495650_0001796 Ga0495650_0001796_17555_18499 314
193 3300046471 Ga0495650_0014997 Ga0495650_0014997_2814_3791 314
194 3300046472 Ga0495580_0010854 Ga0495580_0010854_4217_5197 314
195 3300046472 Ga0495580_0020753 Ga0495580_0020753_2068_3045 314
196 3300046473 Ga0495582_0003075 Ga0495582_0003075_6489_7433 314
197 3300046473 Ga0495582_0034829 Ga0495582_0034829_1769_2746 314
198 3300046474 Ga0495605_0000912 Ga0495605_0000912_17377_18321 314
199 3300046474 Ga0495605_0001164 Ga0495605_0001164_12778_13722 314
200 3300046474 Ga0495605_0011130 Ga0495605_0011130_3629_4573 314
201 3300046475 Ga0495639_0000090 Ga0495639_0000090_8432_9376 314
202 3300046475 Ga0495639_0011163 Ga0495639_0011163_2266_3210 314
203 3300046491 Ga0495584_0000375 Ga0495584_0000375_3749_4693 314
204 3300046491 Ga0495584_0001318 Ga0495584_0001318_2290_3234 314
205 3300046492 Ga0495585_0001302 Ga0495585_0001302_13464_14408 314
206 3300046492 Ga0495585_0011863 Ga0495585_0011863_2353_3297 314
207 3300046499 Ga0495594_0000902 Ga0495594_0000902_5591_6535 314
208 3300046500 Ga0495596_0074267 Ga0495596_0074267_298_1275 314
209 3300046501 Ga0495607_0000028 Ga0495607_0000028_48314_49258 314
210 3300046501 Ga0495607_0034136 Ga0495607_0034136_75_1019 314
211 3300046501 Ga0495607_0035605 Ga0495607_0035605_312_1256 314
212 3300046506 Ga0495583_0001424 Ga0495583_0001424_17610_18554 314
213 3300046506 Ga0495583_0005325 Ga0495583_0005325_4729_5673 314
214 3300046506 Ga0495583_0006308 Ga0495583_0006308_3146_4090 314
215 3300046506 Ga0495583_0075686 Ga0495583_0075686_242_1219 314
216 3300046507 Ga0495606_0180952 Ga0495606_0180952_55_1032 314
217 3300046513 Ga0495616_0000247 Ga0495616_0000247_3462_4406 314
218 3300046516 Ga0495628_0162112 Ga0495628_0162112_295_1239 314
219 3300046517 Ga0495630_0024141 Ga0495630_0024141_3289_4233 314
220 3300046517 Ga0495630_0085906 Ga0495630_0085906_1067_2011 314
221 3300046518 Ga0495631_0011785 Ga0495631_0011785_1644_2588 314
222 3300046518 Ga0495631_0043314 Ga0495631_0043314_954_1898 314
223 3300046519 Ga0495632_0000205 Ga0495632_0000205_1096_2040 314
224 3300046519 Ga0495632_0000229 Ga0495632_0000229_42514_43458 314
225 3300046519 Ga0495632_0005787 Ga0495632_0005787_5576_6520 314
226 3300046519 Ga0495632_0014095 Ga0495632_0014095_680_1624 314
227 3300046520 Ga0495637_0002175 Ga0495637_0002175_6381_7325 314
228 3300046522 Ga0495643_0001048 Ga0495643_0001048_26025_26969 314
229 3300046522 Ga0495643_0022400 Ga0495643_0022400_2001_2945 314
230 3300046522 Ga0495643_0046100 Ga0495643_0046100_192_1136 314
231 3300046522 Ga0495643_0047440 Ga0495643_0047440_1304_2248 314
232 3300046524 Ga0495648_0001354 Ga0495648_0001354_12024_12968 314
233 3300046524 Ga0495648_0011413 Ga0495648_0011413_3791_4735 314
234 3300046524 Ga0495648_0033957 Ga0495648_0033957_421_1365 314
235 3300046524 Ga0495648_0087595 Ga0495648_0087595_541_1485 314
236 3300046526 Ga0495666_0016141 Ga0495666_0016141_250_1194 314
237 3300046526 Ga0495666_0102971 Ga0495666_0102971_12_956 314
238 3300046528 Ga0495642_0000024 Ga0495642_0000024_17538_18482 314
239 3300046528 Ga0495642_0000296 Ga0495642_0000296_1039_1983 314
240 3300046528 Ga0495642_0002934 Ga0495642_0002934_1643_2623 314
241 3300046528 Ga0495642_0062003 Ga0495642_0062003_266_1243 314
242 3300046530 Ga0495654_0000272 Ga0495654_0000272_37643_38587 314
243 3300046530 Ga0495654_0000517 Ga0495654_0000517_21787_22731 314
244 3300046530 Ga0495654_0000820 Ga0495654_0000820_21549_22493 314
245 3300046530 Ga0495654_0013830 Ga0495654_0013830_348_1292 314
246 3300046530 Ga0495654_0028211 Ga0495654_0028211_892_1836 314
247 3300046530 Ga0495654_0074191 Ga0495654_0074191_102_1046 314
248 3300046531 Ga0495665_0019970 Ga0495665_0019970_1638_2615 314
249 3300046531 Ga0495665_0040308 Ga0495665_0040308_1071_2051 314
250 3300046535 Ga0495586_0017613 Ga0495586_0017613_2429_3409 314
251 3300046535 Ga0495586_0044235 Ga0495586_0044235_829_1773 314
252 3300046535 Ga0495586_0222660 Ga0495586_0222660_78_1055 314
253 3300046536 Ga0495587_0000361 Ga0495587_0000361_7808_8752 314
254 3300046536 Ga0495587_0001352 Ga0495587_0001352_13316_14260 314
255 3300046538 Ga0495609_0000610 Ga0495609_0000610_17348_18292 314
256 3300046538 Ga0495609_0001156 Ga0495609_0001156_2039_2983 314
257 3300046539 Ga0495621_0010376 Ga0495621_0010376_1006_1998 314
258 3300046542 Ga0495597_0002005 Ga0495597_0002005_11759_12703 314
259 3300046543 Ga0495645_0000678 Ga0495645_0000678_18181_19161 314
260 3300046543 Ga0495645_0019239 Ga0495645_0019239_692_1636 314
261 3300046543 Ga0495645_0162321 Ga0495645_0162321_456_1400 314
262 3300046557 Ga0495622_0000354 Ga0495622_0000354_23069_24013 314
263 3300046557 Ga0495622_0002428 Ga0495622_0002428_25_969 314
264 3300046557 Ga0495622_0002708 Ga0495622_0002708_6538_7494 314
265 3300046615 Ga0495656_0035271 Ga0495656_0035271_75_1019 314
266 3300046615 Ga0495656_0040164 Ga0495656_0040164_930_1874 314
267 3300046616 Ga0495668_0020071 Ga0495668_0020071_2468_3412 314
268 3300046616 Ga0495668_0153696 Ga0495668_0153696_70_1014 314
269 3300046642 Ga0495634_0000091 Ga0495634_0000091_12135_13079 314
270 3300046642 Ga0495634_0230375 Ga0495634_0230375_56_1000 314
271 3300046648 Ga0495611_0028146 Ga0495611_0028146_515_1459 314
272 3300046660 Ga0495625_0001165 Ga0495625_0001165_19799_20743 314
273 3300046660 Ga0495625_0026518 Ga0495625_0026518_2659_3603 314
274 3300046660 Ga0495625_0171670 Ga0495625_0171670_104_1048 314
275 3300046663 Ga0495635_0000127 Ga0495635_0000127_44360_45304 314
276 3300046663 Ga0495635_0000142 Ga0495635_0000142_18987_19931 314
277 3300046664 Ga0495659_0000335 Ga0495659_0000335_9299_10243 314
278 3300046664 Ga0495659_0000477 Ga0495659_0000477_11706_12650 314
279 3300046674 Ga0495588_0004148 Ga0495588_0004148_3263_4207 314
280 3300046674 Ga0495588_0021261 Ga0495588_0021261_1295_2251 314
281 3300046679 Ga0495623_0000068 Ga0495623_0000068_36316_37260 314
282 3300046679 Ga0495623_0000396 Ga0495623_0000396_240_1184 314
283 3300046679 Ga0495623_0060565 Ga0495623_0060565_487_1464 314
284 3300046680 Ga0495646_0001284 Ga0495646_0001284_2181_3125 314
285 3300046684 Ga0495669_0000568 Ga0495669_0000568_4567_5511 314
286 3300046684 Ga0495669_0027286 Ga0495669_0027286_967_1947 314
287 3300046691 Ga0495670_0001066 Ga0495670_0001066_10209_11153 314
288 3300046691 Ga0495670_0003832 Ga0495670_0003832_227_1171 314
289 3300046691 Ga0495670_0100359 Ga0495670_0100359_392_1336 314
290 3300046691 Ga0495670_0164818 Ga0495670_0164818_54_998 314
291 3300046692 Ga0495671_0002684 Ga0495671_0002684_3442_4386 314
292 3300046692 Ga0495671_0004844 Ga0495671_0004844_5418_6362 314
293 3300046692 Ga0495671_0011982 Ga0495671_0011982_2661_3605 314
294 3300046692 Ga0495671_0129131 Ga0495671_0129131_43_1023 314
295 3300046694 Ga0495649_0000023 Ga0495649_0000023_107374_108318 314
296 3300046694 Ga0495649_0001882 Ga0495649_0001882_5070_6014 314
297 3300046794 Ga0495589_0002225 Ga0495589_0002225_8387_9331 314
298 3300046794 Ga0495589_0011435 Ga0495589_0011435_2387_3331 314
299 3300046794 Ga0495589_0043324 Ga0495589_0043324_364_1308 314
300 3300046794 Ga0495589_0069719 Ga0495589_0069719_257_1237 314
301 3300046794 Ga0495589_0109402 Ga0495589_0109402_215_1192 314
302 3300046809 Ga0495600_0082147 Ga0495600_0082147_322_1266 314
303 3300046809 Ga0495600_0113628 Ga0495600_0113628_387_1364 314
304 3300046809 Ga0495600_0246357 Ga0495600_0246357_142_1122 314
305 3300046810 Ga0495660_0002465 Ga0495660_0002465_4224_5168 314
306 3300046810 Ga0495660_0003005 Ga0495660_0003005_8675_9619 314
307 3300046810 Ga0495660_0102905 Ga0495660_0102905_79_1023 314
308 3300047315 Ga0495581_0001079 Ga0495581_0001079_12380_13324 314
309 3300047315 Ga0495581_0027868 Ga0495581_0027868_575_1552 314
310 3300047317 Ga0495604_0000779 Ga0495604_0000779_1336_2280 314
311 3300047317 Ga0495604_0002389 Ga0495604_0002389_389_1333 314
312 3300047318 Ga0495636_0000248 Ga0495636_0000248_371_1315 314
313 3300047319 Ga0495674_0003369 Ga0495674_0003369_3603_4547 314
314 3300047319 Ga0495674_0007502 Ga0495674_0007502_7151_8128 314
315 3300047320 Ga0495672_0000077 Ga0495672_0000077_64094_65038 314
316 3300047320 Ga0495672_0003319 Ga0495672_0003319_1907_2851 314
317 3300047320 Ga0495672_0004256 Ga0495672_0004256_4506_5450 314
318 3300047320 Ga0495672_0005910 Ga0495672_0005910_2013_2957 314
319 3300047320 Ga0495672_0007490 Ga0495672_0007490_6216_7160 314
320 3300047320 Ga0495672_0011342 Ga0495672_0011342_753_1697 314
321 3300047320 Ga0495672_0018100 Ga0495672_0018100_1880_2824 314
322 3300047320 Ga0495672_0035489 Ga0495672_0035489_1564_2508 314
323 3300047320 Ga0495672_0041353 Ga0495672_0041353_613_1557 314
324 3300047322 Ga0495680_0000029 Ga0495680_0000029_46618_47562 314
325 3300047322 Ga0495680_0000901 Ga0495680_0000901_28232_29176 314
326 3300047322 Ga0495680_0004603 Ga0495680_0004603_7404_8348 314
327 3300047322 Ga0495680_0030436 Ga0495680_0030436_1122_2099 314
328 3300047322 Ga0495680_0047517 Ga0495680_0047517_2072_3016 314
329 3300047322 Ga0495680_0058602 Ga0495680_0058602_988_1932 314
330 3300047323 Ga0495683_0002840 Ga0495683_0002840_1817_2794 314
331 3300047323 Ga0495683_0017475 Ga0495683_0017475_1197_2174 314
332 3300047323 Ga0495683_0033307 Ga0495683_0033307_556_1500 314
333 3300047323 Ga0495683_0067029 Ga0495683_0067029_268_1212 314
334 3300047443 Ga0495687_000377 Ga0495687_000377_13201_14145 314
335 3300047443 Ga0495687_001417 Ga0495687_001417_8893_9837 314
336 3300047443 Ga0495687_002968 Ga0495687_002968_10851_11795 314
337 3300047444 Ga0495675_0004722 Ga0495675_0004722_837_1781 314
338 3300047444 Ga0495675_0032460 Ga0495675_0032460_1729_2673 314
339 3300047445 Ga0495677_0000457 Ga0495677_0000457_10619_11563 314
340 3300047446 Ga0495679_038646 Ga0495679_038646_165_1145 314
341 3300047447 Ga0495685_001618 Ga0495685_001618_4216_5160 314
342 3300047447 Ga0495685_017579 Ga0495685_017579_888_1832 314
343 3300047469 Ga0495673_0001182 Ga0495673_0001182_9759_10703 314
344 3300047469 Ga0495673_0030021 Ga0495673_0030021_1109_2053 314
345 3300047469 Ga0495673_0030076 Ga0495673_0030076_531_1475 314
346 3300047470 Ga0495681_0003205 Ga0495681_0003205_5434_6378 314
347 3300047472 Ga0495686_0110808 Ga0495686_0110808_138_1082 314
348 3300047673 Ga0495593_0012765 Ga0495593_0012765_2429_3373 314
349 3300047673 Ga0495593_0032824 Ga0495593_0032824_658_1635 314
350 3300047673 Ga0495593_0041973 Ga0495593_0041973_447_1403 314
351 3300047673 Ga0495593_0044755 Ga0495593_0044755_362_1342 314
352 3300048088 Ga0495602_0000724 Ga0495602_0000724_19957_20934 314
353 3300048088 Ga0495602_0260285 Ga0495602_0260285_160_1104 314
354 3300048089 Ga0495614_0061162 Ga0495614_0061162_416_1393 314
355 3300048091 Ga0495626_0000538 Ga0495626_0000538_8414_9358 314
356 3300048091 Ga0495626_0000599 Ga0495626_0000599_848_1792 314
357 3300048091 Ga0495626_0002080 Ga0495626_0002080_6809_7753 314
358 3300048903 Ga0496100_0092879 Ga0496100_0092879_146_1123 314
359 3300048903 Ga0496100_0358217 Ga0496100_0358217_72_1049 314
360 3300048904 Ga0496101_0016635 Ga0496101_0016635_3770_4747 314
361 3300048905 Ga0496102_0000255 Ga0496102_0000255_57134_58078 314
362 3300048905 Ga0496102_0077963 Ga0496102_0077963_1503_2480 314
363 3300048906 Ga0496103_0000524 Ga0496103_0000524_11420_12364 314
364 3300048908 Ga0496105_0091748 Ga0496105_0091748_1290_2234 314
365 3300048908 Ga0496105_0097676 Ga0496105_0097676_437_1414 314
366 3300048913 Ga0496110_0021901 Ga0496110_0021901_1686_2630 314
367 3300048913 Ga0496110_0420402 Ga0496110_0420402_101_1078 314
368 3300048917 Ga0496114_0019165 Ga0496114_0019165_2003_2983 314
369 3300048918 Ga0496115_0159183 Ga0496115_0159183_851_1828 314
370 3300048919 Ga0496116_0006162 Ga0496116_0006162_9538_10482 314
371 3300048919 Ga0496116_0025892 Ga0496116_0025892_1006_1950 314
372 3300048920 Ga0496117_0001538 Ga0496117_0001538_22957_23934 314
373 3300048920 Ga0496117_0034742 Ga0496117_0034742_1370_2347 314
374 3300048920 Ga0496117_0039893 Ga0496117_0039893_1043_1987 314
375 3300048921 Ga0496118_0019449 Ga0496118_0019449_2194_3138 314
376 3300048921 Ga0496118_0023842 Ga0496118_0023842_912_1856 314
377 3300048924 Ga0496121_0032491 Ga0496121_0032491_858_1835 314
378 3300048925 Ga0496122_0005168 Ga0496122_0005168_9115_10059 314
379 3300048926 Ga0496123_0086581 Ga0496123_0086581_779_1723 314
380 3300048927 Ga0496124_0066716 Ga0496124_0066716_131_1075 314
381 3300048927 Ga0496124_0156362 Ga0496124_0156362_120_1064 314
382 3300048928 Ga0496125_0010299 Ga0496125_0010299_1198_2142 314
383 3300048928 Ga0496125_0031232 Ga0496125_0031232_1763_2707 314
384 3300048929 Ga0496126_0000274 Ga0496126_0000274_88451_89428 314
385 3300049459 Ga0495678_000167 Ga0495678_000167_990_1934 314
386 3300049459 Ga0495678_001847 Ga0495678_001847_5383_6327 314
387 3300049459 Ga0495678_052369 Ga0495678_052369_517_1461 314
388 3300049460 Ga0495682_0002912 Ga0495682_0002912_6057_7001 314
389 3300049460 Ga0495682_0004463 Ga0495682_0004463_4044_4988 314
390 3300049460 Ga0495682_0008372 Ga0495682_0008372_422_1366 314
391 3300049460 Ga0495682_0009813 Ga0495682_0009813_2658_3602 314
392 3300049460 Ga0495682_0022287 Ga0495682_0022287_1398_2342 314
393 3300049460 Ga0495682_0028237 Ga0495682_0028237_158_1102 314
394 3300049569 Ga0501032_0084170 Ga0501032_0084170_393_1346 314
395 3300049665 Ga0501227_000017 Ga0501227_000017_18019_18963 314
396 3300049766 Ga0501269_000062 Ga0501269_000062_13749_14693 314

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09828

ChrB_C

ChrB, C-terminal domain

195

324

0.99

PF20229

ChrB_N

Protein ChrB, N-terminal

33

170

0.94

PF20803

PaaX_M

PaaX protein central Cas2-like domain

11

96

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nzp-assembly2.cif.gz_A-2 crystal structure of the biosynthetic arginine decarboxylase spea from campylobacter jejuni, northeast structural genomics consortium target br53 0.8297 90 153
1zpw-assembly1.cif.gz_X crystal structure of a hypothetical protein tt1823 from thermus thermophilus 0.7883 1 71
3exc-assembly1.cif.gz_X-2 structure of the rna'se sso8090 from sulfolobus solfataricus 0.7781 4 77
8d3q-assembly1.cif.gz_F type i-c cas4-cas1-cas2 complex bound to a pam/nopam prespacer 0.7777 1 75
7mi5-assembly1.cif.gz_F asymmetrical pam-non pam prespacer bound cas4/cas1/cas2 complex 0.7673 1 75
ID Description Score Start End Superfamily
3nzpA03 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.8297 90 153 1.20.58.930
3nzpB03 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.8286 90 153 1.20.58.930
3excX01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8064 5 70 3.30.70.240
af_P9WPJ3_23_112_3.30.70.240 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7986 2 70 3.30.70.240
1zpwX00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7883 1 71 3.30.70.240
ID Description Score Start End GO Terms
AF-A0A7U6M2Q7-F1-model_v4 ChrB C-terminal domain-containing protein 0.9965 190 310
AF-A0A7V7WW84-F1-model_v4 Chromate resistance protein 0.9913 169 312
AF-A0A7V7WW84-F1-model_v4 Chromate resistance protein 0.9845 169 312
AF-A0A377TWD5-F1-model_v4 Chromate resistance protein 0.9843 178 310
AF-V0ACJ7-F1-model_v4 deleted 0.9765 154 310

Feature Viewer

pLDDT pTM Quality
89.01 0.52 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map