F433360

General Info

Members Datasets Scaffolds Average Seq Length
395 231 332 296

Family's Representative Sequence

Representative Sequence 3300059424|Ga0590075_019387|Ga0590075_019387_686_1534
Length 282
Sequence MSAEYVLTLSCPDRPGVVAAVSGLLARHGCNITESQQFGDLGANRFFMRVQFSGEPSIDELRAVFAALSPEFGMDAQLFDRSVKPRVLVLVSKFDHCLNDLLYRVRSGLLAIDIVGVASNHPDLRPLTQSYGIDYHHLPVTRETKQRQEAEILTLVDHYQADLVVLARYMQVLSEDFCAKLAGRVINIHHSFLPSFKGAKPYHQAYARGVKLIGATAHYVTQDLDEGPIIEQEVARVNHTHLPDDLAAIGRDLECQALARAVRWHAEHRILLDGHKTVIFPR

Samples

Sample ID Description Type Environment
1 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
2 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
3 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
4 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
5 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
6 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
7 2739367653 Kocuria sp. OV113 Isolate Unclassified
8 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
9 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
10 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
11 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
12 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
13 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
14 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
15 2816332305 Kocuria rhizophila FDAARGOS_302 Isolate Rhizosphere
16 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
17 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
18 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
19 2857710386 Brevibacterium sp. R-73093 Isolate Unclassified
20 2857727296 Kocuria sp. R-72562 Isolate Unclassified
21 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
22 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
23 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
24 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
25 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
26 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
27 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
28 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
29 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
30 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
31 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
32 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
33 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
34 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
35 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
36 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
37 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
38 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
39 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
40 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
41 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
42 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
43 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
44 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
45 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
46 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
47 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
48 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
49 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
50 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
51 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
52 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
53 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
54 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
55 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
56 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
57 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
58 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
59 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
60 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
61 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
62 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
63 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
64 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
65 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
66 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
67 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
73 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
85 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
109 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
110 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
111 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
112 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
113 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
114 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
115 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
116 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
119 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
120 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
121 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
122 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
123 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
124 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
127 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
130 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
131 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
132 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
133 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
134 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
135 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
136 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
137 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
138 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
139 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
140 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
141 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
142 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
143 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
144 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
145 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
146 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
147 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
148 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
149 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
150 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
151 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
152 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
153 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
154 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
155 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
156 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
157 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
158 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
159 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
160 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
161 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
162 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
163 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
164 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
165 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
166 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
167 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
168 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
169 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
170 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
171 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
172 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
173 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
174 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
175 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
176 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
177 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
178 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
179 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
180 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
181 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
182 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
183 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
194 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
195 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
196 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
197 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
198 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
199 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
200 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
201 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
216 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
217 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
219 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
220 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
221 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
222 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
223 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
224 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
225 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
227 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
228 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
229 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
230 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
231 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 82.03
Metatranscriptomes 2.03
Isolates 15.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.77
Nodule 0
Rhizoplane 5.06
Rhizosphere 83.54
Stem 0
Stem Tuber 0
Unclassified 9.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000441 3300002773 Bacteria 24773
2 rootL2_10070411 3300003322 Bacteria 8152
3 Ga0065714_10017927 3300005288 Bacteria 1513
4 Ga0065714_10108060 3300005288 Bacteria 1517
5 Ga0065714_10136324 3300005288 Bacteria 1206
6 Ga0065704_10198586 3300005289 Bacteria 1142
7 Ga0070670_100069773 3300005331 Bacteria 3017
8 Ga0070670_100073693 3300005331 Bacteria 2932
9 Ga0070670_100109602 3300005331 Bacteria 2379
10 Ga0070677_10003871 3300005333 Bacteria 4852
11 Ga0070666_10038432 3300005335 Bacteria 3185
12 Ga0070675_100038977 3300005354 Bacteria 3875
13 Ga0070675_100139434 3300005354 Bacteria 2072
14 Ga0070675_100487465 3300005354 Bacteria 1109
15 Ga0070671_100101311 3300005355 Bacteria 2416
16 Ga0070709_10029444 3300005434 Bacteria 3284
17 Ga0070714_100122201 3300005435 Bacteria 2317
18 Ga0070713_100045770 3300005436 Bacteria 3587
19 Ga0070710_10006272 3300005437 Bacteria 5698
20 Ga0070711_100075106 3300005439 Bacteria 2392
21 Ga0070708_100008108 3300005445 Bacteria 8423
22 Ga0070678_100074779 3300005456 Bacteria 2547
23 Ga0070706_100046753 3300005467 Bacteria 3995
24 Ga0070706_100238222 3300005467 Bacteria 1699
25 Ga0070707_100415566 3300005468 Bacteria 1305
26 Ga0070707_100651792 3300005468 Bacteria 1016
27 Ga0070698_100000877 3300005471 Bacteria 33070
28 Ga0070698_100075746 3300005471 Bacteria 3369
29 Ga0070717_10179417 3300006028 Bacteria 1845
30 Ga0075364_10352484 3300006051 Bacteria 1003
31 Ga0075432_10001191 3300006058 Bacteria 8344
32 Ga0075367_10133408 3300006178 Bacteria 1536
33 Ga0099795_10035403 3300007788 Bacteria 1746
34 Ga0105244_10018969 3300009036 Bacteria 3850
35 Ga0105244_10021131 3300009036 Bacteria 3605
36 Ga0105244_10022417 3300009036 Bacteria 3476
37 Ga0105245_10465230 3300009098 Bacteria 1275
38 Ga0114129_10644162 3300009147 Bacteria 1368
39 Ga0105243_10016444 3300009148 Bacteria 5594
40 Ga0105243_10052494 3300009148 Bacteria 3229
41 Ga0105243_10097248 3300009148 Bacteria 2436
42 Ga0105248_10048315 3300009177 Bacteria 4773
43 Ga0099796_10008698 3300010159 Bacteria 2715
44 Ga0105246_10002744 3300011119 Bacteria 10653
45 Ga0105246_10020984 3300011119 Bacteria 4196
46 Ga0105246_10028574 3300011119 Bacteria 3665
47 Ga0105246_10064654 3300011119 Bacteria 2556
48 Ga0105246_10100258 3300011119 Bacteria 2107
49 Ga0157370_10001739 3300013104 Bacteria 26816
50 Ga0157369_10071949 3300013105 Bacteria 3711
51 Ga0157369_10105825 3300013105 Bacteria 2995
52 Ga0157369_10131763 3300013105 Bacteria 2649
53 Ga0157369_10236208 3300013105 Bacteria 1910
54 Ga0157369_10442176 3300013105 Bacteria 1347
55 Ga0163162_10475382 3300013306 Bacteria 1381
56 Ga0157375_10055240 3300013308 Bacteria 3915
57 Ga0157375_10105244 3300013308 Bacteria 2911
58 Ga0157375_10231808 3300013308 Bacteria 2005
59 Ga0209129_1000238 3300025258 Bacteria 59892
60 Ga0209025_1000458 3300025294 Bacteria 79809
61 Ga0207697_10002431 3300025315 Bacteria 9652
62 Ga0207697_10034765 3300025315 Bacteria 2063
63 Ga0207655_1004657 3300025728 Bacteria 9622
64 Ga0207655_1007221 3300025728 Bacteria 7242
65 Ga0207655_1009866 3300025728 Bacteria 5875
66 Ga0207682_10002951 3300025893 Bacteria 7477
67 Ga0207692_10011024 3300025898 Bacteria 3827
68 Ga0207688_10056282 3300025901 Bacteria 2209
69 Ga0207688_10065704 3300025901 Bacteria 2051
70 Ga0207699_10003488 3300025906 Bacteria 7507
71 Ga0207699_10028068 3300025906 Bacteria 3123
72 Ga0207699_10108556 3300025906 Bacteria 1774
73 Ga0207645_10005617 3300025907 Bacteria 9067
74 Ga0207643_10240644 3300025908 Bacteria 1112
75 Ga0207684_10114401 3300025910 Bacteria 2310
76 Ga0207693_10042559 3300025915 Bacteria 3575
77 Ga0207693_10054042 3300025915 Bacteria 3151
78 Ga0207681_10052190 3300025923 Bacteria 2772
79 Ga0207650_10033629 3300025925 Bacteria 3714
80 Ga0207650_10492808 3300025925 Bacteria 1023
81 Ga0207659_10464008 3300025926 Bacteria 1068
82 Ga0207700_10016587 3300025928 Bacteria 4898
83 Ga0207700_10027728 3300025928 Bacteria 3971
84 Ga0207664_10002274 3300025929 Bacteria 12660
85 Ga0207664_10047359 3300025929 Bacteria 3376
86 Ga0207664_10065965 3300025929 Bacteria 2900
87 Ga0207644_10406612 3300025931 Bacteria 1113
88 Ga0207669_10080212 3300025937 Bacteria 2086
89 Ga0207691_10006009 3300025940 Bacteria 11722
90 Ga0207711_10073879 3300025941 Bacteria 2964
91 Ga0207668_10167355 3300025972 Bacteria 1720
92 Ga0207683_10018458 3300026121 Bacteria 5953
93 Ga0207683_10256933 3300026121 Bacteria 1595
94 Ga0209179_1007102 3300027512 Bacteria 1835
95 Ga0207428_10221903 3300027907 Bacteria 1417
96 Ga0307408_100003883 3300031548 Bacteria 10175
97 Ga0307408_100017140 3300031548 Bacteria 4846
98 Ga0307408_100022800 3300031548 Bacteria 4258
99 Ga0307408_100031388 3300031548 Bacteria 3699
100 Ga0307408_100033950 3300031548 Bacteria 3568
101 Ga0307408_100048506 3300031548 Bacteria 3047
102 Ga0307408_100150363 3300031548 Bacteria 1837
103 Ga0307408_100159840 3300031548 Bacteria 1788
104 Ga0307408_100279603 3300031548 Bacteria 1389
105 Ga0307408_100301409 3300031548 Bacteria 1342
106 Ga0307408_100366287 3300031548 Bacteria 1227
107 Ga0307405_10002480 3300031731 Bacteria 8146
108 Ga0307405_10022584 3300031731 Bacteria 3559
109 Ga0307405_10032600 3300031731 Bacteria 3081
110 Ga0307405_10148184 3300031731 Bacteria 1646
111 Ga0307405_10209228 3300031731 Bacteria 1422
112 Ga0307405_10230491 3300031731 Bacteria 1365
113 Ga0307405_10245588 3300031731 Bacteria 1328
114 Ga0307405_10446778 3300031731 Bacteria 1024
115 Ga0307413_10001131 3300031824 Bacteria 9779
116 Ga0307413_10003052 3300031824 Bacteria 6959
117 Ga0307413_10014538 3300031824 Bacteria 4002
118 Ga0307413_10041402 3300031824 Bacteria 2697
119 Ga0307413_10042634 3300031824 Bacteria 2668
120 Ga0307413_10080799 3300031824 Bacteria 2082
121 Ga0307413_10222617 3300031824 Bacteria 1379
122 Ga0307410_10001562 3300031852 Bacteria 10460
123 Ga0307410_10002247 3300031852 Bacteria 9228
124 Ga0307410_10014207 3300031852 Bacteria 4676
125 Ga0307410_10016487 3300031852 Bacteria 4408
126 Ga0307410_10019929 3300031852 Bacteria 4092
127 Ga0307410_10097216 3300031852 Bacteria 2103
128 Ga0307410_10195336 3300031852 Bacteria 1541
129 Ga0307410_10203014 3300031852 Bacteria 1514
130 Ga0307410_10353250 3300031852 Bacteria 1175
131 Ga0307410_10365688 3300031852 Bacteria 1156
132 Ga0307406_10021629 3300031901 Bacteria 3807
133 Ga0307406_10135756 3300031901 Bacteria 1734
134 Ga0307406_10158045 3300031901 Bacteria 1626
135 Ga0307406_10391012 3300031901 Bacteria 1099
136 Ga0307407_10044047 3300031903 Bacteria 2512
137 Ga0307407_10068672 3300031903 Bacteria 2100
138 Ga0307407_10203817 3300031903 Bacteria 1327
139 Ga0307407_10266052 3300031903 Bacteria 1181
140 Ga0307412_10002118 3300031911 Bacteria 11013
141 Ga0307412_10009948 3300031911 Bacteria 5471
142 Ga0307412_10009990 3300031911 Bacteria 5459
143 Ga0307412_10012278 3300031911 Bacteria 4987
144 Ga0307412_10015523 3300031911 Bacteria 4519
145 Ga0307412_10046526 3300031911 Bacteria 2843
146 Ga0307412_10053039 3300031911 Bacteria 2687
147 Ga0307412_10269407 3300031911 Bacteria 1332
148 Ga0307409_100000879 3300031995 Bacteria 13895
149 Ga0307409_100003559 3300031995 Bacteria 8495
150 Ga0307409_100133995 3300031995 Bacteria 2122
151 Ga0307409_100134135 3300031995 Bacteria 2121
152 Ga0307409_100313747 3300031995 Bacteria 1464
153 Ga0307409_100358522 3300031995 Bacteria 1378
154 Ga0307416_100002853 3300032002 Bacteria 10056
155 Ga0307416_100003075 3300032002 Bacteria 9760
156 Ga0307416_100026112 3300032002 Bacteria 4297
157 Ga0307416_100064206 3300032002 Bacteria 3011
158 Ga0307416_100099397 3300032002 Bacteria 2526
159 Ga0307416_100189753 3300032002 Bacteria 1936
160 Ga0307416_100275083 3300032002 Bacteria 1656
161 Ga0307416_100289789 3300032002 Bacteria 1620
162 Ga0307416_100450456 3300032002 Bacteria 1339
163 Ga0307416_100468663 3300032002 Bacteria 1316
164 Ga0307414_10002404 3300032004 Bacteria 9797
165 Ga0307414_10003629 3300032004 Bacteria 8268
166 Ga0307414_10104894 3300032004 Bacteria 2136
167 Ga0307414_10178196 3300032004 Bacteria 1707
168 Ga0307411_10272488 3300032005 Bacteria 1343
169 Ga0307415_100006583 3300032126 Bacteria 6279
170 Ga0307415_100016627 3300032126 Bacteria 4390
171 Ga0307415_100128408 3300032126 Bacteria 1914
172 Ga0307415_100177814 3300032126 Bacteria 1666
173 Ga0307415_100404646 3300032126 Bacteria 1166
174 Ga0307415_100590793 3300032126 Bacteria 986
175 Ga0307507_10080301 3300033179 Bacteria 2877
176 Ga0373927_0035235 3300035695 Bacteria 3255
177 Ga0373933_0128042 3300035724 Bacteria 1594
178 Ga0395899_0009109 3300037312 Bacteria 7625
179 Ga0395899_0009279 3300037312 Bacteria 7554
180 Ga0395899_0035911 3300037312 Bacteria 3719
181 Ga0395899_0039124 3300037312 Bacteria 3551
182 Ga0395900_0003930 3300037418 Bacteria 15863
183 Ga0395900_0049658 3300037418 Bacteria 4322
184 Ga0395900_0324385 3300037418 Bacteria 1519
185 Ga0395898_0033280 3300037466 Bacteria 5145
186 Ga0395898_0034092 3300037466 Bacteria 5076
187 Ga0395898_0067226 3300037466 Bacteria 3470
188 Ga0395905_0495128 3300037471 Bacteria 1122
189 Ga0395901_0010281 3300038443 Bacteria 9479
190 Ga0395901_0062700 3300038443 Bacteria 3868
191 Ga0439436_0030658 3300041404 Bacteria 1562
192 Ga0439439_0023433 3300041406 Bacteria 1546
193 Ga0439466_0016512 3300041411 Bacteria 2667
194 Ga0451797_0576400 3300041453 Bacteria 3357
195 Ga0439433_0005118 3300041999 Bacteria 2817
196 Ga0439449_0040851 3300042007 Bacteria 1724
197 Ga0439449_0045108 3300042007 Bacteria 1634
198 Ga0439457_056487 3300042014 Bacteria 885
199 Ga0439434_0043133 3300042435 Bacteria 1387
200 Ga0466966_0059452 3300044684 Bacteria 2414
201 Ga0466971_0009628 3300044719 Bacteria 4218
202 Ga0466970_0132131 3300044765 Bacteria 1372
203 Ga0466960_0000072 3300044901 Bacteria 32828
204 Ga0495603_0002657 3300046455 Bacteria 10539
205 Ga0495629_0055978 3300046459 Bacteria 2758
206 Ga0495629_0132693 3300046459 Bacteria 1735
207 Ga0495638_0157551 3300046460 Bacteria 1312
208 Ga0495651_0051344 3300046462 Bacteria 3179
209 Ga0495653_0152310 3300046463 Bacteria 1614
210 Ga0495580_0007446 3300046472 Bacteria 8799
211 Ga0495580_0036425 3300046472 Bacteria 3532
212 Ga0495580_0067542 3300046472 Bacteria 2501
213 Ga0495580_0142723 3300046472 Bacteria 1660
214 Ga0495582_0011917 3300046473 Bacteria 4788
215 Ga0495582_0027646 3300046473 Bacteria 3110
216 Ga0495639_0010246 3300046475 Bacteria 4033
217 Ga0495639_0023097 3300046475 Bacteria 2732
218 Ga0495662_0006333 3300046476 Bacteria 5915
219 Ga0495664_0018629 3300046477 Bacteria 3982
220 Ga0495594_0003933 3300046499 Bacteria 7644
221 Ga0495608_0195908 3300046511 Bacteria 1274
222 Ga0495618_0010702 3300046514 Bacteria 5554
223 Ga0495628_0068139 3300046516 Bacteria 2777
224 Ga0495630_0022680 3300046517 Bacteria 4637
225 Ga0495631_0017237 3300046518 Bacteria 3422
226 Ga0495643_0050383 3300046522 Bacteria 2243
227 Ga0495663_0058053 3300046525 Bacteria 1212
228 Ga0495642_0013726 3300046528 Bacteria 3137
229 Ga0495665_0001157 3300046531 Bacteria 14008
230 Ga0495586_0003835 3300046535 Bacteria 8057
231 Ga0495586_0004376 3300046535 Bacteria 7553
232 Ga0495587_0001861 3300046536 Bacteria 14047
233 Ga0495587_0016246 3300046536 Bacteria 4634
234 Ga0495587_0216934 3300046536 Bacteria 1080
235 Ga0495645_0004408 3300046543 Bacteria 9618
236 Ga0495645_0076466 3300046543 Bacteria 2409
237 Ga0495667_0001733 3300046559 Bacteria 14494
238 Ga0495667_0058820 3300046559 Bacteria 2523
239 Ga0495656_0000619 3300046615 Bacteria 11337
240 Ga0495656_0003731 3300046615 Bacteria 5171
241 Ga0495656_0037505 3300046615 Bacteria 2003
242 Ga0495656_0044217 3300046615 Bacteria 1874
243 Ga0495625_0238691 3300046660 Bacteria 1184
244 Ga0495659_0005398 3300046664 Bacteria 4020
245 Ga0495588_0004051 3300046674 Bacteria 6446
246 Ga0495588_0004689 3300046674 Bacteria 6037
247 Ga0495588_0006632 3300046674 Bacteria 5224
248 Ga0495657_0040696 3300046675 Bacteria 3185
249 Ga0495623_0046043 3300046679 Bacteria 2769
250 Ga0495670_0000191 3300046691 Bacteria 27207
251 Ga0495670_0016816 3300046691 Bacteria 3596
252 Ga0495589_0028959 3300046794 Bacteria 2792
253 Ga0495600_0030189 3300046809 Bacteria 3510
254 Ga0495600_0101777 3300046809 Bacteria 1872
255 Ga0495600_0125940 3300046809 Bacteria 1666
256 Ga0495600_0226600 3300046809 Bacteria 1194
257 Ga0495581_0029732 3300047315 Bacteria 3166
258 Ga0495581_0037066 3300047315 Bacteria 2821
259 Ga0495581_0286701 3300047315 Bacteria 962
260 Ga0495604_0052396 3300047317 Bacteria 3160
261 Ga0495636_0030062 3300047318 Bacteria 2219
262 Ga0495676_0036927 3300047321 Bacteria 4073
263 Ga0495680_0037007 3300047322 Bacteria 3911
264 Ga0495675_0012037 3300047444 Bacteria 5437
265 Ga0495675_0055308 3300047444 Bacteria 2517
266 Ga0495677_0012402 3300047445 Bacteria 3109
267 Ga0495684_0102171 3300047471 Bacteria 2167
268 Ga0495593_0014073 3300047673 Bacteria 4553
269 Ga0496100_0129333 3300048903 Bacteria 1777
270 Ga0496101_0329538 3300048904 Bacteria 1198
271 Ga0496102_0100088 3300048905 Bacteria 2691
272 Ga0496102_0114816 3300048905 Bacteria 2512
273 Ga0496102_0266757 3300048905 Bacteria 1614
274 Ga0496103_0057660 3300048906 Bacteria 2411
275 Ga0496104_0185987 3300048907 Bacteria 1988
276 Ga0496105_0110005 3300048908 Bacteria 2274
277 Ga0496105_0112249 3300048908 Bacteria 2249
278 Ga0496106_0038634 3300048909 Bacteria 3573
279 Ga0496107_0098839 3300048910 Bacteria 2138
280 Ga0496107_0267109 3300048910 Bacteria 1273
281 Ga0496109_0082041 3300048912 Bacteria 2971
282 Ga0496109_0083392 3300048912 Bacteria 2947
283 Ga0496110_0094857 3300048913 Bacteria 2671
284 Ga0496110_0332726 3300048913 Bacteria 1384
285 Ga0496112_0028496 3300048915 Bacteria 5391
286 Ga0496113_0116777 3300048916 Bacteria 2082
287 Ga0496114_0284020 3300048917 Bacteria 1459
288 Ga0496119_0095607 3300048922 Bacteria 1678
289 Ga0496121_0285175 3300048924 Bacteria 1128
290 Ga0496122_0024570 3300048925 Bacteria 5269
291 Ga0496124_0221309 3300048927 Bacteria 1423
292 Ga0496126_0478479 3300048929 Bacteria 998
293 Ga0501309_012299 3300049129 Bacteria 1126
294 Ga0501316_006895 3300049532 Bacteria 1221
295 Ga0501317_006900 3300049533 Bacteria 1266
296 Ga0501318_004895 3300049534 Bacteria 1305
297 Ga0501323_014506 3300049539 Bacteria 986
298 Ga0501324_004681 3300049540 Bacteria 1098
299 Ga0501325_002779 3300049541 Bacteria 1225
300 Ga0501031_0145779 3300049568 Bacteria 1547
301 Ga0501032_0001828 3300049569 Bacteria 16819
302 Ga0501032_0039774 3300049569 Bacteria 3197
303 Ga0501032_0113919 3300049569 Bacteria 1789
304 Ga0501034_0000038 3300049571 Bacteria 237795
305 Ga0501034_0004846 3300049571 Bacteria 14862
306 Ga0501034_0039129 3300049571 Bacteria 4803
307 Ga0501037_0020672 3300049573 Bacteria 4861
308 Ga0501037_0071943 3300049573 Bacteria 2515
309 Ga0501037_0309838 3300049573 Bacteria 1094
310 Ga0501038_0000676 3300049574 Bacteria 30398
311 Ga0501039_0064220 3300049575 Bacteria 2845
312 Ga0501043_0027575 3300049579 Bacteria 4458
313 Ga0501043_0045096 3300049579 Bacteria 3467
314 Ga0501043_0082958 3300049579 Bacteria 2520
315 Ga0501043_0103574 3300049579 Bacteria 2236
316 Ga0501073_0186158 3300049589 Bacteria 1437
317 Ga0501080_0121229 3300049742 Bacteria 2423
318 Ga0501080_0240846 3300049742 Bacteria 1651
319 Ga0501035_0105526 3300049822 Bacteria 2470
320 Ga0501035_0123365 3300049822 Bacteria 2263
321 Ga0501044_0023788 3300049823 Bacteria 6513
322 Ga0501044_0152386 3300049823 Bacteria 2293
323 Ga0501044_0157217 3300049823 Bacteria 2252
324 Ga0501044_0410190 3300049823 Bacteria 1266
325 nmdc:mga00v17_333932_c1 3300050491 Bacteria 985
326 nmdc:mga06z11_114087_c1 3300050494 Bacteria 1499
327 Ga0495601_0000284 3300053077 Bacteria 27115
328 Ga0495655_0009293 3300053083 Bacteria 1901
329 Ga0495595_0087283 3300053084 Bacteria 1493
330 Ga0590075_014050 3300059424 Bacteria 1956
331 Ga0590075_019387 3300059424 Bacteria 1688
332 Ga0587072_001041 3300059643 Bacteria 3242

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049573 Ga0501037_0071943 Ga0501037_0071943_386_1201 267
2 3300044684 Ga0466966_0059452 Ga0466966_0059452_576_1415 271
3 iso_pu_bacteria 2891395885 2891396444 277
4 iso_pu_bacteria 2891554331 2891557880 277
5 iso_pu_bacteria 8055066027 8055073753 277
6 iso_pu_bacteria 2884693830 2884701867 279
7 iso_pu_bacteria 2895427314 2895433325 279
8 iso_pu_bacteria 2895442618 2895444026 279
9 iso_pu_bacteria 2939598168 2939599156 279
10 iso_pu_bacteria 2946024296 2946026112 279
11 3300044719 Ga0466971_0009628 Ga0466971_0009628_2248_3162 280
12 iso_pu_bacteria 8054002106 8054008820 280
13 3300025929 Ga0207664_10065965 Ga0207664_100659652 281
14 3300059424 Ga0590075_019387 Ga0590075_019387_686_1534 281
15 iso_pu_bacteria 2852635781 2852639503 281
16 3300005288 Ga0065714_10136324 Ga0065714_101363241 282
17 3300006058 Ga0075432_10001191 Ga0075432_100011914 282
18 3300011119 Ga0105246_10020984 Ga0105246_100209844 282
19 3300033179 Ga0307507_10080301 Ga0307507_100803013 282
20 3300035695 Ga0373927_0035235 Ga0373927_0035235_915_1766 282
21 3300042014 Ga0439457_056487 Ga0439457_056487_22_870 282
22 3300049569 Ga0501032_0001828 Ga0501032_0001828_7168_8016 282
23 3300049579 Ga0501043_0103574 Ga0501043_0103574_438_1286 282
24 3300049589 Ga0501073_0186158 Ga0501073_0186158_23_871 282
25 iso_pu_bacteria 2857710386 2857711817 282
26 3300003322 rootL2_10070411 rootL2_100704114 283
27 3300011119 Ga0105246_10028574 Ga0105246_100285742 283
28 3300048905 Ga0496102_0114816 Ga0496102_0114816_911_1765 283
29 3300048905 Ga0496102_0266757 Ga0496102_0266757_75_929 283
30 3300048910 Ga0496107_0098839 Ga0496107_0098839_391_1245 283
31 iso_pu_bacteria 2515154155 2515854205 283
32 iso_pu_bacteria 2554235227 2555230546 283
33 iso_pu_bacteria 2654587600 2655034175 283
34 iso_pu_bacteria 2906799679 2906802332 283
35 iso_pu_bacteria 2919051321 2919054941 283
36 3300005289 Ga0065704_10198586 Ga0065704_101985862 284
37 3300031548 Ga0307408_100022800 Ga0307408_1000228005 284
38 3300031824 Ga0307413_10003052 Ga0307413_100030529 284
39 3300031852 Ga0307410_10014207 Ga0307410_100142072 284
40 3300032002 Ga0307416_100002853 Ga0307416_1000028539 284
41 3300032004 Ga0307414_10003629 Ga0307414_1000362911 284
42 3300032126 Ga0307415_100016627 Ga0307415_1000166275 284
43 3300046514 Ga0495618_0010702 Ga0495618_0010702_692_1549 284
44 3300046516 Ga0495628_0068139 Ga0495628_0068139_153_1010 284
45 3300046660 Ga0495625_0238691 Ga0495625_0238691_80_937 284
46 3300048925 Ga0496122_0024570 Ga0496122_0024570_2144_3007 284
47 3300049568 Ga0501031_0145779 Ga0501031_0145779_219_1076 284
48 3300049569 Ga0501032_0113919 Ga0501032_0113919_562_1668 284
49 3300049571 Ga0501034_0039129 Ga0501034_0039129_1373_2230 284
50 3300049574 Ga0501038_0000676 Ga0501038_0000676_10117_10974 284
51 3300049579 Ga0501043_0045096 Ga0501043_0045096_2175_3032 284
52 3300049742 Ga0501080_0121229 Ga0501080_0121229_1511_2368 284
53 3300049742 Ga0501080_0240846 Ga0501080_0240846_291_1148 284
54 3300049822 Ga0501035_0105526 Ga0501035_0105526_1036_1893 284
55 3300049822 Ga0501035_0123365 Ga0501035_0123365_557_1414 284
56 3300049823 Ga0501044_0023788 Ga0501044_0023788_4679_5536 284
57 3300049823 Ga0501044_0152386 Ga0501044_0152386_829_1686 284
58 3300053077 Ga0495601_0000284 Ga0495601_0000284_16880_17737 284
59 iso_pu_bacteria 2827628540 2827629689 284
60 3300007788 Ga0099795_10035403 Ga0099795_100354032 285
61 iso_pu_bacteria 2537561592 2537899154 285
62 3300006051 Ga0075364_10352484 Ga0075364_103524841 286
63 3300047471 Ga0495684_0102171 Ga0495684_0102171_584_1462 286
64 3300050491 nmdc:mga00v17_333932_c1 nmdc:mga00v17_333932_c1_84_947 286
65 3300053083 Ga0495655_0009293 Ga0495655_0009293_422_1285 286
66 iso_pu_bacteria 8053945823 8053949475 286
67 3300031911 Ga0307412_10015523 Ga0307412_100155232 287
68 3300037312 Ga0395899_0039124 Ga0395899_0039124_622_1518 287
69 3300037418 Ga0395900_0003930 Ga0395900_0003930_12492_13388 287
70 3300037466 Ga0395898_0034092 Ga0395898_0034092_3645_4541 287
71 3300037471 Ga0395905_0495128 Ga0395905_0495128_50_946 287
72 3300038443 Ga0395901_0062700 Ga0395901_0062700_2915_3811 287
73 3300041453 Ga0451797_0576400 Ga0451797_0576400_2105_2977 287
74 iso_pu_bacteria 2808606371 2808898141 287
75 iso_pu_bacteria 8004021418 8004024571 287
76 iso_pu_bacteria 8056060235 8056066380 287
77 3300005354 Ga0070675_100487465 Ga0070675_1004874651 288
78 3300044901 Ga0466960_0000072 Ga0466960_0000072_20575_21450 288
79 3300046511 Ga0495608_0195908 Ga0495608_0195908_180_1064 288
80 iso_pu_bacteria 2675903058 2676475380 288
81 iso_pu_bacteria 8004025490 8004026883 288
82 3300005467 Ga0070706_100046753 Ga0070706_1000467535 289
83 3300005471 Ga0070698_100000877 Ga0070698_10000087710 289
84 3300006028 Ga0070717_10179417 Ga0070717_101794171 289
85 3300013105 Ga0157369_10236208 Ga0157369_102362082 289
86 3300025910 Ga0207684_10114401 Ga0207684_101144011 289
87 3300046455 Ga0495603_0002657 Ga0495603_0002657_5560_6435 289
88 3300046459 Ga0495629_0132693 Ga0495629_0132693_512_1387 289
89 3300046460 Ga0495638_0157551 Ga0495638_0157551_12_887 289
90 3300046794 Ga0495589_0028959 Ga0495589_0028959_273_1163 289
91 3300047321 Ga0495676_0036927 Ga0495676_0036927_1031_1906 289
92 3300048907 Ga0496104_0185987 Ga0496104_0185987_240_1118 289
93 3300013104 Ga0157370_10001739 Ga0157370_1000173911 290
94 3300013308 Ga0157375_10055240 Ga0157375_100552402 290
95 3300026121 Ga0207683_10256933 Ga0207683_102569331 290
96 3300044765 Ga0466970_0132131 Ga0466970_0132131_176_1051 290
97 3300046472 Ga0495580_0036425 Ga0495580_0036425_2545_3459 290
98 3300046472 Ga0495580_0067542 Ga0495580_0067542_913_1785 290
99 3300046473 Ga0495582_0011917 Ga0495582_0011917_416_1330 290
100 3300046535 Ga0495586_0004376 Ga0495586_0004376_3758_4672 290
101 3300046536 Ga0495587_0216934 Ga0495587_0216934_120_1004 290
102 3300046674 Ga0495588_0004051 Ga0495588_0004051_694_1566 290
103 3300046809 Ga0495600_0101777 Ga0495600_0101777_254_1138 290
104 3300046809 Ga0495600_0226600 Ga0495600_0226600_286_1158 290
105 3300047315 Ga0495581_0286701 Ga0495581_0286701_13_897 290
106 3300047444 Ga0495675_0055308 Ga0495675_0055308_1027_1911 290
107 3300047673 Ga0495593_0014073 Ga0495593_0014073_2760_3632 290
108 3300005288 Ga0065714_10017927 Ga0065714_100179271 291
109 3300005288 Ga0065714_10108060 Ga0065714_101080602 291
110 3300005331 Ga0070670_100069773 Ga0070670_1000697732 291
111 3300005333 Ga0070677_10003871 Ga0070677_100038714 291
112 3300005335 Ga0070666_10038432 Ga0070666_100384322 291
113 3300005354 Ga0070675_100038977 Ga0070675_1000389773 291
114 3300005355 Ga0070671_100101311 Ga0070671_1001013112 291
115 3300005456 Ga0070678_100074779 Ga0070678_1000747792 291
116 3300006178 Ga0075367_10133408 Ga0075367_101334082 291
117 3300009036 Ga0105244_10021131 Ga0105244_100211313 291
118 3300009036 Ga0105244_10022417 Ga0105244_100224172 291
119 3300009098 Ga0105245_10465230 Ga0105245_104652302 291
120 3300009148 Ga0105243_10052494 Ga0105243_100524942 291
121 3300009177 Ga0105248_10048315 Ga0105248_100483152 291
122 3300011119 Ga0105246_10064654 Ga0105246_100646542 291
123 3300013105 Ga0157369_10105825 Ga0157369_101058252 291
124 3300013306 Ga0163162_10475382 Ga0163162_104753822 291
125 3300013308 Ga0157375_10231808 Ga0157375_102318082 291
126 3300025315 Ga0207697_10002431 Ga0207697_100024317 291
127 3300025728 Ga0207655_1007221 Ga0207655_10072214 291
128 3300025893 Ga0207682_10002951 Ga0207682_100029512 291
129 3300025901 Ga0207688_10056282 Ga0207688_100562822 291
130 3300025907 Ga0207645_10005617 Ga0207645_100056176 291
131 3300025908 Ga0207643_10240644 Ga0207643_102406441 291
132 3300025923 Ga0207681_10052190 Ga0207681_100521902 291
133 3300025925 Ga0207650_10033629 Ga0207650_100336293 291
134 3300025926 Ga0207659_10464008 Ga0207659_104640082 291
135 3300025931 Ga0207644_10406612 Ga0207644_104066121 291
136 3300025937 Ga0207669_10080212 Ga0207669_100802122 291
137 3300025940 Ga0207691_10006009 Ga0207691_100060097 291
138 3300025941 Ga0207711_10073879 Ga0207711_100738793 291
139 3300025972 Ga0207668_10167355 Ga0207668_101673552 291
140 3300026121 Ga0207683_10018458 Ga0207683_100184584 291
141 3300032126 Ga0307415_100177814 Ga0307415_1001778142 291
142 3300046475 Ga0495639_0023097 Ga0495639_0023097_1030_1905 291
143 3300046522 Ga0495643_0050383 Ga0495643_0050383_1345_2220 291
144 3300046528 Ga0495642_0013726 Ga0495642_0013726_572_1447 291
145 3300046615 Ga0495656_0000619 Ga0495656_0000619_2881_3756 291
146 3300046615 Ga0495656_0037505 Ga0495656_0037505_307_1182 291
147 3300046615 Ga0495656_0044217 Ga0495656_0044217_927_1802 291
148 3300046674 Ga0495588_0006632 Ga0495588_0006632_3215_4090 291
149 3300046691 Ga0495670_0000191 Ga0495670_0000191_8113_8988 291
150 3300047315 Ga0495581_0029732 Ga0495581_0029732_299_1174 291
151 3300047315 Ga0495581_0037066 Ga0495581_0037066_1087_1962 291
152 3300048905 Ga0496102_0100088 Ga0496102_0100088_1666_2541 291
153 3300048906 Ga0496103_0057660 Ga0496103_0057660_429_1304 291
154 3300048908 Ga0496105_0110005 Ga0496105_0110005_380_1255 291
155 3300048908 Ga0496105_0112249 Ga0496105_0112249_557_1432 291
156 3300048909 Ga0496106_0038634 Ga0496106_0038634_1704_2579 291
157 3300048912 Ga0496109_0083392 Ga0496109_0083392_1517_2392 291
158 3300048913 Ga0496110_0094857 Ga0496110_0094857_1405_2280 291
159 3300048916 Ga0496113_0116777 Ga0496113_0116777_435_1310 291
160 3300048917 Ga0496114_0284020 Ga0496114_0284020_557_1432 291
161 3300048922 Ga0496119_0095607 Ga0496119_0095607_209_1084 291
162 3300048924 Ga0496121_0285175 Ga0496121_0285175_110_985 291
163 3300048927 Ga0496124_0221309 Ga0496124_0221309_120_1004 291
164 3300048929 Ga0496126_0478479 Ga0496126_0478479_26_901 291
165 3300050494 nmdc:mga06z11_114087_c1 nmdc:mga06z11_114087_c1_97_972 291
166 iso_pu_bacteria 2739367653 2739603802 291
167 iso_pu_bacteria 2816332305 2817510076 291
168 iso_pu_bacteria 2857727296 2857727869 291
169 iso_pu_bacteria 2945916053 2945916382 291
170 3300010159 Ga0099796_10008698 Ga0099796_100086982 292
171 3300013105 Ga0157369_10442176 Ga0157369_104421762 292
172 3300027512 Ga0209179_1007102 Ga0209179_10071022 292
173 3300049129 Ga0501309_012299 Ga0501309_012299_18_911 292
174 3300049532 Ga0501316_006895 Ga0501316_006895_84_977 292
175 3300049533 Ga0501317_006900 Ga0501317_006900_326_1219 292
176 3300049534 Ga0501318_004895 Ga0501318_004895_53_946 292
177 3300049541 Ga0501325_002779 Ga0501325_002779_83_976 292
178 iso_pu_bacteria 2808606360 2808850854 292
179 iso_pu_bacteria 2945956166 2945956555 292
180 3300025906 Ga0207699_10028068 Ga0207699_100280682 293
181 3300035724 Ga0373933_0128042 Ga0373933_0128042_51_989 293
182 3300046462 Ga0495651_0051344 Ga0495651_0051344_1091_2029 293
183 3300046463 Ga0495653_0152310 Ga0495653_0152310_343_1281 293
184 3300046536 Ga0495587_0016246 Ga0495587_0016246_811_1749 293
185 3300046675 Ga0495657_0040696 Ga0495657_0040696_629_1567 293
186 3300053084 Ga0495595_0087283 Ga0495595_0087283_16_954 293
187 3300005331 Ga0070670_100109602 Ga0070670_1001096022 294
188 3300049571 Ga0501034_0004846 Ga0501034_0004846_8707_9597 294
189 iso_pu_bacteria 2690315906 2691512165 294
190 iso_pu_bacteria 2775506735 2775657430 294
191 iso_pu_bacteria 2808606357 2808828788 294
192 iso_pu_bacteria 2808606360 2808850051 294
193 iso_pu_bacteria 2808606366 2808877387 294
194 iso_pu_bacteria 2808606370 2808893683 294
195 iso_pu_bacteria 2808606371 2808898863 294
196 iso_pu_bacteria 2811994871 2812319474 294
197 iso_pu_bacteria 2904776348 2904780765 294
198 iso_pu_bacteria 2945916053 2945917219 294
199 iso_pu_bacteria 2945920336 2945923227 294
200 iso_pu_bacteria 2946037020 2946041057 294
201 iso_pu_bacteria 2946059875 2946061059 294
202 iso_pu_bacteria 2953998280 2954002292 294
203 iso_pu_bacteria 2974302888 2974305179 294
204 3300005434 Ga0070709_10029444 Ga0070709_100294441 295
205 3300005435 Ga0070714_100122201 Ga0070714_1001222012 295
206 3300005436 Ga0070713_100045770 Ga0070713_1000457703 295
207 3300005437 Ga0070710_10006272 Ga0070710_100062723 295
208 3300005445 Ga0070708_100008108 Ga0070708_1000081089 295
209 3300005467 Ga0070706_100238222 Ga0070706_1002382222 295
210 3300005468 Ga0070707_100415566 Ga0070707_1004155662 295
211 3300005468 Ga0070707_100651792 Ga0070707_1006517921 295
212 3300005471 Ga0070698_100075746 Ga0070698_1000757465 295
213 3300013105 Ga0157369_10131763 Ga0157369_101317631 295
214 3300025898 Ga0207692_10011024 Ga0207692_100110243 295
215 3300025906 Ga0207699_10003488 Ga0207699_100034882 295
216 3300025906 Ga0207699_10108556 Ga0207699_101085562 295
217 3300025915 Ga0207693_10042559 Ga0207693_100425593 295
218 3300025915 Ga0207693_10054042 Ga0207693_100540422 295
219 3300025928 Ga0207700_10016587 Ga0207700_100165871 295
220 3300025928 Ga0207700_10027728 Ga0207700_100277283 295
221 3300025929 Ga0207664_10002274 Ga0207664_1000227412 295
222 3300025929 Ga0207664_10047359 Ga0207664_100473592 295
223 3300046559 Ga0495667_0058820 Ga0495667_0058820_535_1527 295
224 3300046809 Ga0495600_0125940 Ga0495600_0125940_15_980 295
225 iso_pu_bacteria 2844849076 2844851796 295
226 iso_pu_bacteria 2857740372 2857744891 295
227 iso_pu_bacteria 2904497146 2904499080 295
228 iso_pu_bacteria 2910809715 2910810262 295
229 iso_pu_bacteria 2919034639 2919039058 295
230 iso_pu_bacteria 2919059106 2919060945 295
231 iso_pu_bacteria 2919391150 2919394433 295
232 iso_pu_bacteria 2919538618 2919541349 295
233 iso_pu_bacteria 2932426870 2932430139 295
234 iso_pu_bacteria 2933418574 2933422175 295
235 iso_pu_bacteria 2939647034 2939649487 295
236 iso_pu_bacteria 2939674588 2939678986 295
237 iso_pu_bacteria 2945956166 2945960842 295
238 3300005439 Ga0070711_100075106 Ga0070711_1000751061 296
239 3300031901 Ga0307406_10135756 Ga0307406_101357562 296
240 3300031911 Ga0307412_10269407 Ga0307412_102694072 296
241 3300049823 Ga0501044_0157217 Ga0501044_0157217_864_1769 296
242 iso_pu_bacteria 2919391150 2919394585 296
243 3300013308 Ga0157375_10105244 Ga0157375_101052443 297
244 3300031731 Ga0307405_10245588 Ga0307405_102455882 297
245 3300031901 Ga0307406_10391012 Ga0307406_103910122 297
246 3300031903 Ga0307407_10068672 Ga0307407_100686724 297
247 3300032126 Ga0307415_100128408 Ga0307415_1001284082 297
248 3300046475 Ga0495639_0010246 Ga0495639_0010246_2436_3350 297
249 3300046674 Ga0495588_0004689 Ga0495588_0004689_2704_3618 297
250 iso_pu_bacteria 2945920336 2945922310 297
251 iso_pu_bacteria 2946037020 2946037419 297
252 3300005354 Ga0070675_100139434 Ga0070675_1001394342 298
253 3300009147 Ga0114129_10644162 Ga0114129_106441621 298
254 3300011119 Ga0105246_10100258 Ga0105246_101002582 298
255 3300013105 Ga0157369_10071949 Ga0157369_100719493 298
256 3300025728 Ga0207655_1004657 Ga0207655_10046575 298
257 3300027907 Ga0207428_10221903 Ga0207428_102219031 298
258 3300031548 Ga0307408_100003883 Ga0307408_1000038831 298
259 3300031548 Ga0307408_100017140 Ga0307408_1000171402 298
260 3300031548 Ga0307408_100031388 Ga0307408_1000313882 298
261 3300031548 Ga0307408_100033950 Ga0307408_1000339502 298
262 3300031548 Ga0307408_100150363 Ga0307408_1001503634 298
263 3300031548 Ga0307408_100279603 Ga0307408_1002796032 298
264 3300031548 Ga0307408_100301409 Ga0307408_1003014092 298
265 3300031548 Ga0307408_100366287 Ga0307408_1003662872 298
266 3300031731 Ga0307405_10002480 Ga0307405_100024803 298
267 3300031731 Ga0307405_10022584 Ga0307405_100225844 298
268 3300031731 Ga0307405_10032600 Ga0307405_100326001 298
269 3300031731 Ga0307405_10148184 Ga0307405_101481842 298
270 3300031731 Ga0307405_10209228 Ga0307405_102092282 298
271 3300031731 Ga0307405_10230491 Ga0307405_102304912 298
272 3300031824 Ga0307413_10001131 Ga0307413_100011312 298
273 3300031824 Ga0307413_10014538 Ga0307413_100145382 298
274 3300031824 Ga0307413_10042634 Ga0307413_100426341 298
275 3300031824 Ga0307413_10080799 Ga0307413_100807992 298
276 3300031824 Ga0307413_10222617 Ga0307413_102226171 298
277 3300031852 Ga0307410_10001562 Ga0307410_100015624 298
278 3300031852 Ga0307410_10002247 Ga0307410_100022472 298
279 3300031852 Ga0307410_10016487 Ga0307410_100164872 298
280 3300031852 Ga0307410_10097216 Ga0307410_100972162 298
281 3300031852 Ga0307410_10195336 Ga0307410_101953362 298
282 3300031852 Ga0307410_10203014 Ga0307410_102030142 298
283 3300031852 Ga0307410_10365688 Ga0307410_103656882 298
284 3300031901 Ga0307406_10021629 Ga0307406_100216293 298
285 3300031901 Ga0307406_10158045 Ga0307406_101580452 298
286 3300031903 Ga0307407_10044047 Ga0307407_100440472 298
287 3300031903 Ga0307407_10203817 Ga0307407_102038172 298
288 3300031903 Ga0307407_10266052 Ga0307407_102660522 298
289 3300031911 Ga0307412_10002118 Ga0307412_100021187 298
290 3300031911 Ga0307412_10009948 Ga0307412_100099484 298
291 3300031911 Ga0307412_10009990 Ga0307412_100099902 298
292 3300031911 Ga0307412_10012278 Ga0307412_100122784 298
293 3300031911 Ga0307412_10046526 Ga0307412_100465263 298
294 3300031911 Ga0307412_10053039 Ga0307412_100530392 298
295 3300031995 Ga0307409_100000879 Ga0307409_10000087910 298
296 3300031995 Ga0307409_100003559 Ga0307409_1000035595 298
297 3300031995 Ga0307409_100134135 Ga0307409_1001341352 298
298 3300031995 Ga0307409_100313747 Ga0307409_1003137472 298
299 3300032002 Ga0307416_100003075 Ga0307416_1000030752 298
300 3300032002 Ga0307416_100026112 Ga0307416_1000261123 298
301 3300032002 Ga0307416_100064206 Ga0307416_1000642063 298
302 3300032002 Ga0307416_100099397 Ga0307416_1000993971 298
303 3300032002 Ga0307416_100189753 Ga0307416_1001897532 298
304 3300032002 Ga0307416_100450456 Ga0307416_1004504562 298
305 3300032002 Ga0307416_100468663 Ga0307416_1004686632 298
306 3300032004 Ga0307414_10002404 Ga0307414_100024042 298
307 3300032004 Ga0307414_10104894 Ga0307414_101048942 298
308 3300032004 Ga0307414_10178196 Ga0307414_101781961 298
309 3300032126 Ga0307415_100006583 Ga0307415_1000065834 298
310 3300032126 Ga0307415_100404646 Ga0307415_1004046462 298
311 3300032126 Ga0307415_100590793 Ga0307415_1005907931 298
312 3300037312 Ga0395899_0009279 Ga0395899_0009279_4893_5789 298
313 3300037312 Ga0395899_0035911 Ga0395899_0035911_800_1714 298
314 3300037418 Ga0395900_0324385 Ga0395900_0324385_64_960 298
315 3300037466 Ga0395898_0067226 Ga0395898_0067226_2192_3106 298
316 3300041404 Ga0439436_0030658 Ga0439436_0030658_290_1186 298
317 3300041406 Ga0439439_0023433 Ga0439439_0023433_92_988 298
318 3300041411 Ga0439466_0016512 Ga0439466_0016512_1073_1969 298
319 3300041999 Ga0439433_0005118 Ga0439433_0005118_1122_2018 298
320 3300042007 Ga0439449_0040851 Ga0439449_0040851_505_1401 298
321 3300042007 Ga0439449_0045108 Ga0439449_0045108_712_1608 298
322 3300042435 Ga0439434_0043133 Ga0439434_0043133_405_1301 298
323 3300046459 Ga0495629_0055978 Ga0495629_0055978_1656_2585 298
324 3300046472 Ga0495580_0142723 Ga0495580_0142723_480_1409 298
325 3300046473 Ga0495582_0027646 Ga0495582_0027646_521_1450 298
326 3300046476 Ga0495662_0006333 Ga0495662_0006333_2429_3358 298
327 3300046477 Ga0495664_0018629 Ga0495664_0018629_2877_3806 298
328 3300046499 Ga0495594_0003933 Ga0495594_0003933_4353_5282 298
329 3300046517 Ga0495630_0022680 Ga0495630_0022680_2523_3452 298
330 3300046518 Ga0495631_0017237 Ga0495631_0017237_534_1463 298
331 3300046525 Ga0495663_0058053 Ga0495663_0058053_62_991 298
332 3300046531 Ga0495665_0001157 Ga0495665_0001157_10588_11517 298
333 3300046535 Ga0495586_0003835 Ga0495586_0003835_4336_5265 298
334 3300046536 Ga0495587_0001861 Ga0495587_0001861_2498_3427 298
335 3300046543 Ga0495645_0004408 Ga0495645_0004408_6298_7227 298
336 3300046559 Ga0495667_0001733 Ga0495667_0001733_10911_11840 298
337 3300046615 Ga0495656_0003731 Ga0495656_0003731_1079_2008 298
338 3300046664 Ga0495659_0005398 Ga0495659_0005398_2569_3498 298
339 3300046679 Ga0495623_0046043 Ga0495623_0046043_1056_1985 298
340 3300046691 Ga0495670_0016816 Ga0495670_0016816_143_1072 298
341 3300046809 Ga0495600_0030189 Ga0495600_0030189_730_1659 298
342 3300047317 Ga0495604_0052396 Ga0495604_0052396_2178_3107 298
343 3300047318 Ga0495636_0030062 Ga0495636_0030062_868_1797 298
344 3300047322 Ga0495680_0037007 Ga0495680_0037007_2508_3437 298
345 3300047444 Ga0495675_0012037 Ga0495675_0012037_1716_2645 298
346 3300047445 Ga0495677_0012402 Ga0495677_0012402_653_1582 298
347 3300049539 Ga0501323_014506 Ga0501323_014506_73_969 298
348 3300049569 Ga0501032_0039774 Ga0501032_0039774_1302_2198 298
349 3300049573 Ga0501037_0020672 Ga0501037_0020672_3126_4022 298
350 3300049573 Ga0501037_0309838 Ga0501037_0309838_92_988 298
351 3300049575 Ga0501039_0064220 Ga0501039_0064220_1302_2198 298
352 3300049823 Ga0501044_0410190 Ga0501044_0410190_212_1108 298
353 3300059424 Ga0590075_014050 Ga0590075_014050_841_1752 298
354 iso_pu_bacteria 2690315906 2691515427 298
355 iso_pu_bacteria 2808606370 2808892836 298
356 3300002773 JGI25152J39213_1000441 JGI25152J39213_10004419 299
357 3300005331 Ga0070670_100073693 Ga0070670_1000736932 299
358 3300009036 Ga0105244_10018969 Ga0105244_100189692 299
359 3300009148 Ga0105243_10016444 Ga0105243_100164443 299
360 3300009148 Ga0105243_10097248 Ga0105243_100972482 299
361 3300011119 Ga0105246_10002744 Ga0105246_100027446 299
362 3300025258 Ga0209129_1000238 Ga0209129_100023816 299
363 3300025294 Ga0209025_1000458 Ga0209025_100045826 299
364 3300025315 Ga0207697_10034765 Ga0207697_100347652 299
365 3300025728 Ga0207655_1009866 Ga0207655_10098665 299
366 3300025901 Ga0207688_10065704 Ga0207688_100657042 299
367 3300025925 Ga0207650_10492808 Ga0207650_104928082 299
368 3300031548 Ga0307408_100048506 Ga0307408_1000485063 299
369 3300031548 Ga0307408_100159840 Ga0307408_1001598402 299
370 3300031731 Ga0307405_10446778 Ga0307405_104467781 299
371 3300031824 Ga0307413_10041402 Ga0307413_100414022 299
372 3300031852 Ga0307410_10019929 Ga0307410_100199292 299
373 3300031852 Ga0307410_10353250 Ga0307410_103532501 299
374 3300031995 Ga0307409_100133995 Ga0307409_1001339951 299
375 3300031995 Ga0307409_100358522 Ga0307409_1003585221 299
376 3300032002 Ga0307416_100275083 Ga0307416_1002750832 299
377 3300032002 Ga0307416_100289789 Ga0307416_1002897892 299
378 3300032005 Ga0307411_10272488 Ga0307411_102724881 299
379 3300037312 Ga0395899_0009109 Ga0395899_0009109_1033_1932 299
380 3300037418 Ga0395900_0049658 Ga0395900_0049658_2857_3756 299
381 3300037466 Ga0395898_0033280 Ga0395898_0033280_3284_4183 299
382 3300038443 Ga0395901_0010281 Ga0395901_0010281_7954_8853 299
383 3300046472 Ga0495580_0007446 Ga0495580_0007446_5809_6717 299
384 3300046543 Ga0495645_0076466 Ga0495645_0076466_58_957 299
385 3300048903 Ga0496100_0129333 Ga0496100_0129333_34_942 299
386 3300048904 Ga0496101_0329538 Ga0496101_0329538_30_938 299
387 3300048910 Ga0496107_0267109 Ga0496107_0267109_262_1161 299
388 3300048912 Ga0496109_0082041 Ga0496109_0082041_1969_2868 299
389 3300048913 Ga0496110_0332726 Ga0496110_0332726_275_1174 299
390 3300048915 Ga0496112_0028496 Ga0496112_0028496_3979_4887 299
391 3300049540 Ga0501324_004681 Ga0501324_004681_24_923 299
392 3300049571 Ga0501034_0000038 Ga0501034_0000038_202083_202982 299
393 3300049579 Ga0501043_0027575 Ga0501043_0027575_2305_3204 299
394 3300049579 Ga0501043_0082958 Ga0501043_0082958_1090_2031 299
395 3300059643 Ga0587072_001041 Ga0587072_001041_884_1840 299

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00551

Formyl_trans_N

Formyl transferase

85

262

0.92

PF01842

ACT

ACT domain

5

68

0.87

PF13740

ACT_6

ACT domain

5

78

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lou-assembly1.cif.gz_A crystal structure of formyltetrahydrofolate deformylase (yp_105254.1) from burkholderia mallei atcc 23344 at 1.90 a resolution 0.9538 18 299
3lou-assembly1.cif.gz_B crystal structure of formyltetrahydrofolate deformylase (yp_105254.1) from burkholderia mallei atcc 23344 at 1.90 a resolution 0.9517 19 299
3lou-assembly1.cif.gz_A crystal structure of formyltetrahydrofolate deformylase (yp_105254.1) from burkholderia mallei atcc 23344 at 1.90 a resolution 0.9472 18 299
3n0v-assembly1.cif.gz_C crystal structure of a formyltetrahydrofolate deformylase (pp_0327) from pseudomonas putida kt2440 at 2.25 a resolution 0.9465 19 298
3w7b-assembly1.cif.gz_A crystal structure of formyltetrahydrofolate deformylase from thermus thermophilus hb8 0.9461 16 299
ID Description Score Start End Superfamily
3w7bA01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.9315 16 98 3.30.70.260
3obiD01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.9249 18 98 3.30.70.260
3nrbA01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.9122 18 98 3.30.70.260
3louD01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.9 19 98 3.30.70.260
3n0vB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.8999 19 96 3.30.70.260
ID Description Score Start End GO Terms
AF-A0A2S8N1M3-F1-model_v4 deleted 0.9926 101 180
AF-A0A0K8Q2V8-F1-model_v4 Formyltetrahydrofolate deformylase 0.9746 108 222 GO:0006189
GO:0006730
GO:0008864
AF-A0A7X8Y2C9-F1-model_v4 Formyltetrahydrofolate deformylase (EC 3.5.1.10) 0.9734 18 207 GO:0006189
GO:0006730
GO:0008864
AF-A0A4Q3UU89-F1-model_v4 Formyltetrahydrofolate deformylase (EC 3.5.1.10) 0.9731 114 299 GO:0006189
GO:0006730
GO:0008864
AF-A0A0T6ZK92-F1-model_v4 ACT domain-containing protein 0.9657 20 97 GO:0006189
GO:0008864

Feature Viewer

pLDDT pTM Quality
89.35 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map