F433324

General Info

Members Datasets Scaffolds Average Seq Length
395 221 790 189

Family's Representative Sequence

Representative Sequence 3300048917|Ga0496114_0574868|Ga0496114_0574868_353_892
Length 179
Sequence MRLIIMGPPGAGKGTQAKFIAEHFKIPAISTGDIFRANVSEGTELGLEAKRFMDAGEYVPDEVTNLMVRNRIDDADAVSGFLLDGYPRTLSQVEELDGMIRFTGHRLDAVVCLTVDQDESRADDTEDVIRRRQEVYLEQTEPLIEVYKSRGIVHEIDGLGEVSDVTARVFEALDVIPES

Samples

Sample ID Description Type Environment
1 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
99 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
100 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
101 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
102 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
103 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
104 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
105 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
106 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
107 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
108 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
109 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
110 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
111 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
116 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
117 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
118 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
119 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
120 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
121 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
122 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
123 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
124 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
125 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
126 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
127 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
128 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
129 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
130 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
131 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
132 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
133 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
134 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
135 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
136 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
137 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
138 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
139 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
140 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
141 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
142 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
143 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
144 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
145 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
146 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
147 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
148 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
149 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
154 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
157 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
161 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
178 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
179 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
180 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
181 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
182 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
183 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
184 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
185 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
186 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
187 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
188 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
189 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
190 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
193 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
194 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
195 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
196 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
197 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
198 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
199 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
200 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
201 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
202 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
203 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
204 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
205 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
206 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
207 2643221576 Nocardioides sp. Root614 Isolate Unclassified
208 2643221590 Nocardioides sp. Root682 Isolate Unclassified
209 2643221604 Nocardioides sp. Root190 Isolate Unclassified
210 2643221615 Nocardioides sp. Root224 Isolate Unclassified
211 2643221617 Nocardioides sp. Root79 Isolate Unclassified
212 2643221620 Nocardioides sp. Root240 Isolate Unclassified
213 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
214 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
215 2738541305 Nocardioides sp. CF167 Isolate Unclassified
216 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
217 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
218 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
219 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
220 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
221 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.68
Metatranscriptomes 1.52
Isolates 3.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.15
Nodule 0.25
Rhizoplane 11.14
Rhizosphere 72.41
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496114_0574868 3300048917 Bacteria 995
2 LJQas_1000140 3300000549 Bacteria 12859
3 Ga0006562J51391_1010876 3300003578 Bacteria 2441
4 Ga0070658_10031563 3300005327 Bacteria 4254
5 Ga0070658_10142623 3300005327 Bacteria 2002
6 Ga0070658_11185592 3300005327 Bacteria 664
7 Ga0070683_100051368 3300005329 Bacteria 3817
8 Ga0070683_100051446 3300005329 Bacteria 3814
9 Ga0070683_100660962 3300005329 Bacteria 1001
10 Ga0070683_100708083 3300005329 Bacteria 964
11 Ga0070682_100100541 3300005337 Bacteria 1908
12 Ga0068868_100185139 3300005338 Bacteria 1730
13 Ga0068868_100258053 3300005338 Bacteria 1469
14 Ga0070660_100012207 3300005339 Bacteria 6133
15 Ga0070660_100070026 3300005339 Bacteria 2736
16 Ga0070689_100827027 3300005340 Bacteria 816
17 Ga0070692_10073706 3300005345 Bacteria 1824
18 Ga0070692_10209610 3300005345 Bacteria 1146
19 Ga0070668_100264615 3300005347 Bacteria 1431
20 Ga0070659_100102458 3300005366 Bacteria 2304
21 Ga0070659_100307751 3300005366 Bacteria 1323
22 Ga0070667_100125506 3300005367 Bacteria 2236
23 Ga0070700_100089580 3300005441 Bacteria 2005
24 Ga0070694_100364290 3300005444 Bacteria 1123
25 Ga0070708_100933734 3300005445 Bacteria 814
26 Ga0070708_101458662 3300005445 Bacteria 638
27 Ga0070663_101152179 3300005455 Bacteria 680
28 Ga0068867_101108405 3300005459 Bacteria 723
29 Ga0070685_10316823 3300005466 Bacteria 1056
30 Ga0070707_100136526 3300005468 Bacteria 2386
31 Ga0070698_100011467 3300005471 Bacteria 9406
32 Ga0070679_100992439 3300005530 Bacteria 784
33 Ga0070684_100014853 3300005535 Bacteria 6319
34 Ga0070684_100026144 3300005535 Bacteria 4915
35 Ga0070684_100130422 3300005535 Bacteria 2267
36 Ga0070684_100134956 3300005535 Bacteria 2228
37 Ga0070686_100228428 3300005544 Bacteria 1349
38 Ga0070693_100160400 3300005547 Bacteria 1432
39 Ga0070665_100105680 3300005548 Bacteria 2817
40 Ga0070665_101178138 3300005548 Bacteria 777
41 Ga0068857_100020491 3300005577 Bacteria 5816
42 Ga0068856_100422145 3300005614 Bacteria 1353
43 Ga0068852_100432624 3300005616 Bacteria 1300
44 Ga0068864_100178393 3300005618 Bacteria 1941
45 Ga0068864_100702943 3300005618 Bacteria 988
46 Ga0068861_100689707 3300005719 Bacteria 948
47 Ga0068861_101145097 3300005719 Bacteria 750
48 Ga0068863_101230140 3300005841 Bacteria 755
49 Ga0068858_100105298 3300005842 Bacteria 2632
50 Ga0068860_100281050 3300005843 Bacteria 1627
51 Ga0081539_10042963 3300005985 Bacteria 2626
52 Ga0075365_10157701 3300006038 Bacteria 1580
53 Ga0075365_10277700 3300006038 Bacteria 1178
54 Ga0075365_10335930 3300006038 Bacteria 1064
55 Ga0075365_10476994 3300006038 Bacteria 881
56 Ga0075368_10005063 3300006042 Bacteria 4511
57 Ga0075368_10016676 3300006042 Bacteria 2739
58 Ga0075368_10040958 3300006042 Bacteria 1819
59 Ga0075363_100020487 3300006048 Bacteria 3317
60 Ga0075363_100034548 3300006048 Bacteria 2640
61 Ga0075363_100098605 3300006048 Bacteria 1615
62 Ga0075363_100139246 3300006048 Bacteria 1365
63 Ga0075363_100286845 3300006048 Bacteria 953
64 Ga0075363_100503188 3300006048 Bacteria 720
65 Ga0075364_10048226 3300006051 Bacteria 2775
66 Ga0075364_10058410 3300006051 Bacteria 2528
67 Ga0070715_10349579 3300006163 Bacteria 807
68 Ga0075362_10007604 3300006177 Bacteria 4115
69 Ga0075362_10008338 3300006177 Bacteria 3960
70 Ga0075367_10017640 3300006178 Bacteria 3922
71 Ga0075367_10018451 3300006178 Bacteria 3850
72 Ga0075367_10060426 3300006178 Bacteria 2260
73 Ga0075367_10065916 3300006178 Bacteria 2169
74 Ga0075367_10140517 3300006178 Bacteria 1496
75 Ga0075370_10011631 3300006353 Bacteria 4629
76 Ga0075370_10496040 3300006353 Bacteria 737
77 Ga0068865_100251185 3300006881 Bacteria 1396
78 Ga0068865_100730615 3300006881 Bacteria 849
79 Ga0105245_10038253 3300009098 Bacteria 4269
80 Ga0105245_10133043 3300009098 Bacteria 2335
81 Ga0105245_11217174 3300009098 Bacteria 801
82 Ga0105243_10027400 3300009148 Bacteria 4366
83 Ga0105243_10030721 3300009148 Bacteria 4138
84 Ga0105243_10540304 3300009148 Bacteria 1112
85 Ga0105241_10920581 3300009174 Bacteria 813
86 Ga0105248_10298458 3300009177 Bacteria 1814
87 Ga0105237_11187785 3300009545 Bacteria 769
88 Ga0105249_10037285 3300009553 Bacteria 4412
89 Ga0105249_10221939 3300009553 Bacteria 1860
90 Ga0105249_10846993 3300009553 Bacteria 980
91 Ga0105239_10041339 3300010375 Bacteria 5053
92 Ga0157369_10065541 3300013105 Bacteria 3909
93 Ga0157374_11495670 3300013296 Bacteria 698
94 Ga0163162_10115379 3300013306 Bacteria 2786
95 Ga0157372_10065249 3300013307 Bacteria 4087
96 Ga0157372_10322053 3300013307 Bacteria 1800
97 Ga0157375_10025695 3300013308 Bacteria 5478
98 Ga0157375_10045686 3300013308 Bacteria 4264
99 Ga0163163_10537494 3300014325 Bacteria 1231
100 Ga0163163_11131760 3300014325 Bacteria 846
101 Ga0163163_11243701 3300014325 Bacteria 807
102 Ga0157377_10097861 3300014745 Bacteria 1743
103 Ga0157379_10070859 3300014968 Bacteria 3119
104 Ga0163161_10011752 3300017792 Bacteria 6071
105 Ga0207688_10238972 3300025901 Bacteria 1098
106 Ga0207647_10056251 3300025904 Bacteria 2414
107 Ga0207647_10095645 3300025904 Bacteria 1768
108 Ga0207705_10041918 3300025909 Bacteria 3285
109 Ga0207705_10145459 3300025909 Bacteria 1773
110 Ga0207705_10922816 3300025909 Bacteria 676
111 Ga0207657_10026965 3300025919 Bacteria 5268
112 Ga0207657_10384826 3300025919 Bacteria 1104
113 Ga0207652_10330806 3300025921 Bacteria 1376
114 Ga0207652_10426717 3300025921 Bacteria 1196
115 Ga0207646_10140315 3300025922 Bacteria 2176
116 Ga0207694_10103225 3300025924 Bacteria 2261
117 Ga0207659_10173906 3300025926 Bacteria 1701
118 Ga0207687_10007955 3300025927 Bacteria 6941
119 Ga0207687_10364201 3300025927 Bacteria 1181
120 Ga0207687_10370478 3300025927 Bacteria 1171
121 Ga0207690_10025989 3300025932 Bacteria 3684
122 Ga0207690_10089023 3300025932 Bacteria 2176
123 Ga0207706_10888386 3300025933 Bacteria 753
124 Ga0207686_10920909 3300025934 Bacteria 706
125 Ga0207709_10227837 3300025935 Bacteria 1348
126 Ga0207709_10482420 3300025935 Bacteria 964
127 Ga0207670_10518665 3300025936 Bacteria 970
128 Ga0207669_10123008 3300025937 Bacteria 1766
129 Ga0207704_10226012 3300025938 Bacteria 1388
130 Ga0207704_10233038 3300025938 Bacteria 1370
131 Ga0207704_10577221 3300025938 Bacteria 917
132 Ga0207691_10048754 3300025940 Bacteria 3882
133 Ga0207711_10290647 3300025941 Bacteria 1506
134 Ga0207661_10033805 3300025944 Bacteria 3971
135 Ga0207661_10197153 3300025944 Bacteria 1768
136 Ga0207661_10549248 3300025944 Bacteria 1058
137 Ga0207661_10978621 3300025944 Bacteria 779
138 Ga0207667_10537140 3300025949 Bacteria 1183
139 Ga0207712_10055874 3300025961 Bacteria 2779
140 Ga0207712_10285962 3300025961 Bacteria 1347
141 Ga0207668_10891756 3300025972 Bacteria 791
142 Ga0207658_10047247 3300025986 Bacteria 3149
143 Ga0207658_10452567 3300025986 Bacteria 1137
144 Ga0207677_10114747 3300026023 Bacteria 2014
145 Ga0207703_11113746 3300026035 Bacteria 758
146 Ga0207639_10651822 3300026041 Bacteria 974
147 Ga0207708_11153073 3300026075 Bacteria 677
148 Ga0207702_10476055 3300026078 Bacteria 1215
149 Ga0207702_10907999 3300026078 Bacteria 873
150 Ga0207641_10412367 3300026088 Bacteria 1299
151 Ga0207676_10128979 3300026095 Bacteria 2147
152 Ga0207674_10017532 3300026116 Bacteria 7812
153 Ga0207675_100399405 3300026118 Bacteria 1354
154 Ga0207675_100624603 3300026118 Bacteria 1082
155 Ga0207675_100803914 3300026118 Bacteria 954
156 Ga0207675_100987300 3300026118 Bacteria 860
157 Ga0207683_10620453 3300026121 Bacteria 1001
158 Ga0207698_10065764 3300026142 Bacteria 2850
159 Ga0209813_10007302 3300027866 Bacteria 2750
160 Ga0268266_11428900 3300028379 Bacteria 667
161 Ga0268264_10025785 3300028381 Bacteria 4801
162 Ga0316181_1021746 3300030744 Bacteria 924
163 Ga0316182_1114081 3300030745 Bacteria 1357
164 Ga0316576_10002839 3300031727 Bacteria 9979
165 Ga0316576_10003193 3300031727 Bacteria 9553
166 Ga0316578_10076557 3300031728 Bacteria 1986
167 Ga0307413_10316616 3300031824 Bacteria 1190
168 Ga0307410_10279996 3300031852 Bacteria 1308
169 Ga0307407_10248721 3300031903 Bacteria 1217
170 Ga0307412_10220644 3300031911 Bacteria 1453
171 Ga0307409_100136729 3300031995 Bacteria 2104
172 Ga0307409_100508131 3300031995 Bacteria 1175
173 Ga0307409_100612854 3300031995 Bacteria 1077
174 Ga0307409_101486350 3300031995 Bacteria 705
175 Ga0307415_100476184 3300032126 Bacteria 1086
176 Ga0307415_100835299 3300032126 Bacteria 844
177 Ga0316574_0015215 3300035398 Bacteria 4463
178 Ga0316574_0110684 3300035398 Bacteria 1760
179 Ga0316582_0064842 3300036647 Bacteria 2351
180 Ga0316584_0152733 3300036712 Bacteria 1718
181 Ga0395899_0312458 3300037312 Bacteria 1061
182 Ga0395900_0026167 3300037418 Bacteria 5974
183 Ga0395900_0083064 3300037418 Bacteria 3291
184 Ga0395900_0222871 3300037418 Bacteria 1900
185 Ga0395900_0388730 3300037418 Bacteria 1362
186 Ga0395898_0197583 3300037466 Bacteria 1921
187 Ga0395898_0485830 3300037466 Bacteria 1175
188 Ga0395901_0037073 3300038443 Bacteria 5043
189 Ga0439436_0021600 3300041404 Bacteria 1911
190 Ga0439438_022655 3300041405 Bacteria 1740
191 Ga0439439_0081789 3300041406 Bacteria 874
192 Ga0451789_0038060 3300041443 Bacteria 1048
193 Ga0451791_0597110 3300041451 Bacteria 1503
194 Ga0451849_1565886 3300041505 Bacteria 1038
195 Ga0451853_0750457 3300041512 Bacteria 920
196 Ga0439431_0000819 3300041997 Bacteria 6715
197 Ga0439431_0003754 3300041997 Bacteria 3356
198 Ga0439442_005725 3300042002 Bacteria 2489
199 Ga0439442_038729 3300042002 Bacteria 999
200 Ga0450906_057564 3300042145 Bacteria 689
201 Ga0439446_0005071 3300042156 Bacteria 3371
202 Ga0439434_0009423 3300042435 Bacteria 2870
203 Ga0439434_0011737 3300042435 Bacteria 2591
204 Ga0439460_0058335 3300042461 Bacteria 1173
205 Ga0466969_0143761 3300044656 Bacteria 1102
206 Ga0466972_0034277 3300044658 Bacteria 2488
207 Ga0466965_0001998 3300044683 Bacteria 8533
208 Ga0466965_0003400 3300044683 Bacteria 6969
209 Ga0466965_0110086 3300044683 Bacteria 1415
210 Ga0466965_0208935 3300044683 Bacteria 1037
211 Ga0466966_0097168 3300044684 Bacteria 1824
212 Ga0466966_0390352 3300044684 Bacteria 836
213 Ga0466961_0047069 3300044693 Bacteria 2758
214 Ga0466961_0061654 3300044693 Bacteria 2383
215 Ga0466963_0016490 3300044694 Bacteria 4595
216 Ga0466963_0036244 3300044694 Bacteria 3216
217 Ga0466964_0043774 3300044706 Bacteria 1817
218 Ga0466971_0007634 3300044719 Bacteria 4716
219 Ga0466970_0043325 3300044765 Bacteria 2394
220 Ga0466970_0052566 3300044765 Bacteria 2175
221 Ga0466970_0105425 3300044765 Bacteria 1537
222 Ga0466970_0337245 3300044765 Bacteria 854
223 Ga0466957_0003801 3300044842 Bacteria 8345
224 Ga0466957_0248367 3300044842 Bacteria 1182
225 Ga0466957_0605134 3300044842 Bacteria 767
226 Ga0466960_0016522 3300044901 Bacteria 3204
227 Ga0466960_0116151 3300044901 Bacteria 1396
228 Ga0466960_0229839 3300044901 Bacteria 1024
229 Ga0466960_0349904 3300044901 Bacteria 842
230 Ga0466960_0496414 3300044901 Bacteria 715
231 Ga0451576_0563532 3300045051 Bacteria 1197
232 Ga0466958_0005641 3300045836 Bacteria 6756
233 Ga0466967_0008916 3300045976 Bacteria 7403
234 Ga0466967_0024178 3300045976 Bacteria 4991
235 Ga0466967_0077632 3300045976 Bacteria 2990
236 Ga0466967_0228093 3300045976 Bacteria 1772
237 Ga0466967_0335328 3300045976 Bacteria 1461
238 Ga0466967_0820912 3300045976 Bacteria 923
239 Ga0466967_0864129 3300045976 Bacteria 899
240 Ga0495582_0322493 3300046473 Bacteria 889
241 Ga0495608_0148035 3300046511 Bacteria 1497
242 Ga0495587_0461609 3300046536 Bacteria 703
243 Ga0495647_0284074 3300046681 Bacteria 743
244 Ga0495658_0336283 3300046683 Bacteria 959
245 Ga0496101_0093645 3300048904 Bacteria 2238
246 Ga0496102_0029976 3300048905 Bacteria 4868
247 Ga0496102_0034129 3300048905 Bacteria 4575
248 Ga0496102_0236329 3300048905 Bacteria 1723
249 Ga0496102_0395806 3300048905 Bacteria 1299
250 Ga0496103_0015396 3300048906 Bacteria 4549
251 Ga0496103_0029302 3300048906 Bacteria 3345
252 Ga0496104_0150071 3300048907 Bacteria 2238
253 Ga0496104_0413070 3300048907 Bacteria 1262
254 Ga0496105_0133412 3300048908 Bacteria 2046
255 Ga0496106_0009361 3300048909 Bacteria 7242
256 Ga0496106_0780634 3300048909 Bacteria 758
257 Ga0496106_0814799 3300048909 Bacteria 740
258 Ga0496107_0146891 3300048910 Bacteria 1744
259 Ga0496107_0169959 3300048910 Bacteria 1617
260 Ga0496107_0368059 3300048910 Bacteria 1069
261 Ga0496107_0534229 3300048910 Bacteria 869
262 Ga0496108_0024864 3300048911 Bacteria 4932
263 Ga0496108_0066233 3300048911 Bacteria 3045
264 Ga0496108_0230862 3300048911 Bacteria 1609
265 Ga0496108_0333276 3300048911 Bacteria 1323
266 Ga0496109_0056669 3300048912 Bacteria 3575
267 Ga0496109_0079178 3300048912 Bacteria 3027
268 Ga0496109_0327638 3300048912 Bacteria 1446
269 Ga0496109_0772039 3300048912 Bacteria 899
270 Ga0496110_0002566 3300048913 Bacteria 13655
271 Ga0496110_0028048 3300048913 Bacteria 4831
272 Ga0496110_0815787 3300048913 Bacteria 838
273 Ga0496111_0039614 3300048914 Bacteria 3379
274 Ga0496111_0128072 3300048914 Bacteria 1877
275 Ga0496111_0296257 3300048914 Bacteria 1199
276 Ga0496111_0402238 3300048914 Bacteria 1012
277 Ga0496112_0070144 3300048915 Bacteria 3463
278 Ga0496112_0606187 3300048915 Bacteria 1027
279 Ga0496113_0051957 3300048916 Bacteria 3059
280 Ga0496113_0833766 3300048916 Bacteria 731
281 Ga0496114_0013544 3300048917 Bacteria 6541
282 Ga0496114_0142835 3300048917 Bacteria 2073
283 Ga0496114_0184362 3300048917 Bacteria 1824
284 Ga0496114_0311189 3300048917 Bacteria 1391
285 Ga0496115_0185601 3300048918 Bacteria 1718
286 Ga0501306_021646 3300049127 Bacteria 902
287 Ga0501305_032337 3300049161 Bacteria 821
288 Ga0501317_038628 3300049533 Bacteria 721
289 Ga0501318_020465 3300049534 Bacteria 833
290 Ga0501318_038509 3300049534 Bacteria 676
291 Ga0501031_0199170 3300049568 Bacteria 1307
292 Ga0501032_0039414 3300049569 Bacteria 3214
293 Ga0501034_0033837 3300049571 Bacteria 5181
294 Ga0501034_0228750 3300049571 Bacteria 1809
295 Ga0501034_0573971 3300049571 Bacteria 1035
296 Ga0501036_0004894 3300049572 Bacteria 10819
297 Ga0501036_0812108 3300049572 Bacteria 770
298 Ga0501037_0097110 3300049573 Bacteria 2129
299 Ga0501037_0204989 3300049573 Bacteria 1392
300 Ga0501038_0022121 3300049574 Bacteria 5699
301 Ga0501038_0097945 3300049574 Bacteria 2446
302 Ga0501039_0155053 3300049575 Bacteria 1799
303 Ga0501039_0171511 3300049575 Bacteria 1706
304 Ga0501039_0342225 3300049575 Bacteria 1175
305 Ga0501039_0510061 3300049575 Bacteria 944
306 Ga0501042_0170847 3300049578 Bacteria 1568
307 Ga0501042_0842966 3300049578 Bacteria 667
308 Ga0501043_0128228 3300049579 Bacteria 1989
309 Ga0501046_0229864 3300049580 Bacteria 1371
310 Ga0501047_0076698 3300049581 Bacteria 3216
311 Ga0501048_0128000 3300049582 Bacteria 1796
312 Ga0501067_0024961 3300049583 Bacteria 3314
313 Ga0501067_0025015 3300049583 Bacteria 3311
314 Ga0501067_0215992 3300049583 Bacteria 1068
315 Ga0501068_0020478 3300049584 Bacteria 3853
316 Ga0501068_0087178 3300049584 Bacteria 1922
317 Ga0501068_0120953 3300049584 Bacteria 1632
318 Ga0501068_0137884 3300049584 Bacteria 1528
319 Ga0501069_0039284 3300049585 Bacteria 2614
320 Ga0501069_0089700 3300049585 Bacteria 1738
321 Ga0501069_0090951 3300049585 Bacteria 1726
322 Ga0501069_0131830 3300049585 Bacteria 1431
323 Ga0501070_0007652 3300049586 Bacteria 9170
324 Ga0501070_0023894 3300049586 Bacteria 5122
325 Ga0501070_0051529 3300049586 Bacteria 3416
326 Ga0501070_0137725 3300049586 Bacteria 2015
327 Ga0501070_0883173 3300049586 Bacteria 698
328 Ga0501071_0153856 3300049587 Bacteria 1716
329 Ga0501071_0363999 3300049587 Bacteria 1101
330 Ga0501071_0527572 3300049587 Bacteria 906
331 Ga0501072_0099189 3300049588 Bacteria 2315
332 Ga0501072_0104218 3300049588 Bacteria 2255
333 Ga0501073_0063246 3300049589 Bacteria 2581
334 Ga0501073_0089593 3300049589 Bacteria 2138
335 Ga0501073_0401815 3300049589 Bacteria 946
336 Ga0501074_0003766 3300049590 Bacteria 10779
337 Ga0501074_0065695 3300049590 Bacteria 2610
338 Ga0501074_0068122 3300049590 Bacteria 2558
339 Ga0501076_0355089 3300049592 Bacteria 1204
340 Ga0501077_0047447 3300049593 Bacteria 2729
341 Ga0501077_0117513 3300049593 Bacteria 1685
342 Ga0501209_005241 3300049656 Bacteria 2323
343 Ga0501079_0112382 3300049741 Bacteria 2117
344 Ga0501080_0046550 3300049742 Bacteria 4038
345 Ga0501080_0155636 3300049742 Bacteria 2111
346 Ga0501080_0286952 3300049742 Bacteria 1495
347 Ga0501081_0899418 3300049743 Bacteria 668
348 Ga0501044_0075961 3300049823 Bacteria 3411
349 Ga0501044_0744113 3300049823 Bacteria 863
350 Ga0501045_0116966 3300049824 Bacteria 1979
351 Ga0501045_0613389 3300049824 Bacteria 805
352 nmdc:mga03683_26619_c1 3300050489 Bacteria 2283
353 nmdc:mga03683_31478_c1 3300050489 Bacteria 2128
354 nmdc:mga03n38_13054_c1 3300050490 Bacteria 3145
355 nmdc:mga03n38_177544_c1 3300050490 Bacteria 1089
356 nmdc:mga00v17_45860_c1 3300050491 Bacteria 2643
357 nmdc:mga0yw44_173271_c1 3300050492 Bacteria 1418
358 nmdc:mga0yw44_204771_c1 3300050492 Bacteria 1304
359 nmdc:mga0yw44_296457_c1 3300050492 Bacteria 1083
360 nmdc:mga0yw44_78083_c1 3300050492 Bacteria 2070
361 nmdc:mga06z11_125233_c1 3300050494 Bacteria 1437
362 nmdc:mga06z11_162975_c1 3300050494 Bacteria 1276
363 nmdc:mga06z11_19817_c1 3300050494 Bacteria 3100
364 nmdc:mga06z11_4705_c1 3300050494 Bacteria 5393
365 nmdc:mga04h51_35439_c1 3300050495 Bacteria 1600
366 nmdc:mga04h51_76956_c1 3300050495 Bacteria 1177
367 nmdc:mga07m45_135041_c1 3300050496 Bacteria 1428
368 nmdc:mga07m45_17554_c1 3300050496 Bacteria 3846
369 nmdc:mga07m45_42935_c1 3300050496 Bacteria 2535
370 nmdc:mga07m45_65892_c1 3300050496 Bacteria 2057
371 Ga0500644_0075122 3300053088 Bacteria 1228
372 Ga0500556_0000915 3300053104 Bacteria 16267
373 Ga0500593_000062 3300053117 Bacteria 39716
374 Ga0500568_0060628 3300053139 Bacteria 1465
375 Ga0501084_0150853 3300054114 Bacteria 1959
376 Ga0501082_0071653 3300060353 Bacteria 2984
377 Ga0501082_0216227 3300060353 Bacteria 1667
378 Ga0501082_0488715 3300060353 Bacteria 1076
379 Ga0466962_0002070 3300061719 Bacteria 9492
380 Ga0466962_0078086 3300061719 Bacteria 1583
381 2643890005 2643221576 Bacteria 5214352
382 2643959061 2643221590 Bacteria 5214697
383 2644033703 2643221604 Bacteria 5014917
384 2644091108 2643221615 Bacteria 5487866
385 2644099725 2643221617 Bacteria 5139111
386 2644116611 2643221620 Bacteria 5134593
387 2644320911 2643221657 Bacteria 5490246
388 2729908379 2728369276 Bacteria 5610032
389 2738870354 2738541305 Bacteria 4910150
390 2774391849 2773857762 Bacteria 5971770
391 2809197345 2808606439 Bacteria 5952208
392 2812331461 2811994874 Bacteria 5367947
393 2812352243 2811994878 Bacteria 5992952
394 2855389977 2855386786 Bacteria 4752232
395 8054613759 8054609563 Bacteria 5170090
396 Ga0496114_0574868
397 LJQas_1000140
398 Ga0006562J51391_1010876
399 Ga0070658_10031563
400 Ga0070658_10142623
401 Ga0070658_11185592
402 Ga0070683_100051368
403 Ga0070683_100051446
404 Ga0070683_100660962
405 Ga0070683_100708083
406 Ga0070682_100100541
407 Ga0068868_100185139
408 Ga0068868_100258053
409 Ga0070660_100012207
410 Ga0070660_100070026
411 Ga0070689_100827027
412 Ga0070692_10073706
413 Ga0070692_10209610
414 Ga0070668_100264615
415 Ga0070659_100102458
416 Ga0070659_100307751
417 Ga0070667_100125506
418 Ga0070700_100089580
419 Ga0070694_100364290
420 Ga0070708_100933734
421 Ga0070708_101458662
422 Ga0070663_101152179
423 Ga0068867_101108405
424 Ga0070685_10316823
425 Ga0070707_100136526
426 Ga0070698_100011467
427 Ga0070679_100992439
428 Ga0070684_100014853
429 Ga0070684_100026144
430 Ga0070684_100130422
431 Ga0070684_100134956
432 Ga0070686_100228428
433 Ga0070693_100160400
434 Ga0070665_100105680
435 Ga0070665_101178138
436 Ga0068857_100020491
437 Ga0068856_100422145
438 Ga0068852_100432624
439 Ga0068864_100178393
440 Ga0068864_100702943
441 Ga0068861_100689707
442 Ga0068861_101145097
443 Ga0068863_101230140
444 Ga0068858_100105298
445 Ga0068860_100281050
446 Ga0081539_10042963
447 Ga0075365_10157701
448 Ga0075365_10277700
449 Ga0075365_10335930
450 Ga0075365_10476994
451 Ga0075368_10005063
452 Ga0075368_10016676
453 Ga0075368_10040958
454 Ga0075363_100020487
455 Ga0075363_100034548
456 Ga0075363_100098605
457 Ga0075363_100139246
458 Ga0075363_100286845
459 Ga0075363_100503188
460 Ga0075364_10048226
461 Ga0075364_10058410
462 Ga0070715_10349579
463 Ga0075362_10007604
464 Ga0075362_10008338
465 Ga0075367_10017640
466 Ga0075367_10018451
467 Ga0075367_10060426
468 Ga0075367_10065916
469 Ga0075367_10140517
470 Ga0075370_10011631
471 Ga0075370_10496040
472 Ga0068865_100251185
473 Ga0068865_100730615
474 Ga0105245_10038253
475 Ga0105245_10133043
476 Ga0105245_11217174
477 Ga0105243_10027400
478 Ga0105243_10030721
479 Ga0105243_10540304
480 Ga0105241_10920581
481 Ga0105248_10298458
482 Ga0105237_11187785
483 Ga0105249_10037285
484 Ga0105249_10221939
485 Ga0105249_10846993
486 Ga0105239_10041339
487 Ga0157369_10065541
488 Ga0157374_11495670
489 Ga0163162_10115379
490 Ga0157372_10065249
491 Ga0157372_10322053
492 Ga0157375_10025695
493 Ga0157375_10045686
494 Ga0163163_10537494
495 Ga0163163_11131760
496 Ga0163163_11243701
497 Ga0157377_10097861
498 Ga0157379_10070859
499 Ga0163161_10011752
500 Ga0207688_10238972
501 Ga0207647_10056251
502 Ga0207647_10095645
503 Ga0207705_10041918
504 Ga0207705_10145459
505 Ga0207705_10922816
506 Ga0207657_10026965
507 Ga0207657_10384826
508 Ga0207652_10330806
509 Ga0207652_10426717
510 Ga0207646_10140315
511 Ga0207694_10103225
512 Ga0207659_10173906
513 Ga0207687_10007955
514 Ga0207687_10364201
515 Ga0207687_10370478
516 Ga0207690_10025989
517 Ga0207690_10089023
518 Ga0207706_10888386
519 Ga0207686_10920909
520 Ga0207709_10227837
521 Ga0207709_10482420
522 Ga0207670_10518665
523 Ga0207669_10123008
524 Ga0207704_10226012
525 Ga0207704_10233038
526 Ga0207704_10577221
527 Ga0207691_10048754
528 Ga0207711_10290647
529 Ga0207661_10033805
530 Ga0207661_10197153
531 Ga0207661_10549248
532 Ga0207661_10978621
533 Ga0207667_10537140
534 Ga0207712_10055874
535 Ga0207712_10285962
536 Ga0207668_10891756
537 Ga0207658_10047247
538 Ga0207658_10452567
539 Ga0207677_10114747
540 Ga0207703_11113746
541 Ga0207639_10651822
542 Ga0207708_11153073
543 Ga0207702_10476055
544 Ga0207702_10907999
545 Ga0207641_10412367
546 Ga0207676_10128979
547 Ga0207674_10017532
548 Ga0207675_100399405
549 Ga0207675_100624603
550 Ga0207675_100803914
551 Ga0207675_100987300
552 Ga0207683_10620453
553 Ga0207698_10065764
554 Ga0209813_10007302
555 Ga0268266_11428900
556 Ga0268264_10025785
557 Ga0316181_1021746
558 Ga0316182_1114081
559 Ga0316576_10002839
560 Ga0316576_10003193
561 Ga0316578_10076557
562 Ga0307413_10316616
563 Ga0307410_10279996
564 Ga0307407_10248721
565 Ga0307412_10220644
566 Ga0307409_100136729
567 Ga0307409_100508131
568 Ga0307409_100612854
569 Ga0307409_101486350
570 Ga0307415_100476184
571 Ga0307415_100835299
572 Ga0316574_0015215
573 Ga0316574_0110684
574 Ga0316582_0064842
575 Ga0316584_0152733
576 Ga0395899_0312458
577 Ga0395900_0026167
578 Ga0395900_0083064
579 Ga0395900_0222871
580 Ga0395900_0388730
581 Ga0395898_0197583
582 Ga0395898_0485830
583 Ga0395901_0037073
584 Ga0439436_0021600
585 Ga0439438_022655
586 Ga0439439_0081789
587 Ga0451789_0038060
588 Ga0451791_0597110
589 Ga0451849_1565886
590 Ga0451853_0750457
591 Ga0439431_0000819
592 Ga0439431_0003754
593 Ga0439442_005725
594 Ga0439442_038729
595 Ga0450906_057564
596 Ga0439446_0005071
597 Ga0439434_0009423
598 Ga0439434_0011737
599 Ga0439460_0058335
600 Ga0466969_0143761
601 Ga0466972_0034277
602 Ga0466965_0001998
603 Ga0466965_0003400
604 Ga0466965_0110086
605 Ga0466965_0208935
606 Ga0466966_0097168
607 Ga0466966_0390352
608 Ga0466961_0047069
609 Ga0466961_0061654
610 Ga0466963_0016490
611 Ga0466963_0036244
612 Ga0466964_0043774
613 Ga0466971_0007634
614 Ga0466970_0043325
615 Ga0466970_0052566
616 Ga0466970_0105425
617 Ga0466970_0337245
618 Ga0466957_0003801
619 Ga0466957_0248367
620 Ga0466957_0605134
621 Ga0466960_0016522
622 Ga0466960_0116151
623 Ga0466960_0229839
624 Ga0466960_0349904
625 Ga0466960_0496414
626 Ga0451576_0563532
627 Ga0466958_0005641
628 Ga0466967_0008916
629 Ga0466967_0024178
630 Ga0466967_0077632
631 Ga0466967_0228093
632 Ga0466967_0335328
633 Ga0466967_0820912
634 Ga0466967_0864129
635 Ga0495582_0322493
636 Ga0495608_0148035
637 Ga0495587_0461609
638 Ga0495647_0284074
639 Ga0495658_0336283
640 Ga0496101_0093645
641 Ga0496102_0029976
642 Ga0496102_0034129
643 Ga0496102_0236329
644 Ga0496102_0395806
645 Ga0496103_0015396
646 Ga0496103_0029302
647 Ga0496104_0150071
648 Ga0496104_0413070
649 Ga0496105_0133412
650 Ga0496106_0009361
651 Ga0496106_0780634
652 Ga0496106_0814799
653 Ga0496107_0146891
654 Ga0496107_0169959
655 Ga0496107_0368059
656 Ga0496107_0534229
657 Ga0496108_0024864
658 Ga0496108_0066233
659 Ga0496108_0230862
660 Ga0496108_0333276
661 Ga0496109_0056669
662 Ga0496109_0079178
663 Ga0496109_0327638
664 Ga0496109_0772039
665 Ga0496110_0002566
666 Ga0496110_0028048
667 Ga0496110_0815787
668 Ga0496111_0039614
669 Ga0496111_0128072
670 Ga0496111_0296257
671 Ga0496111_0402238
672 Ga0496112_0070144
673 Ga0496112_0606187
674 Ga0496113_0051957
675 Ga0496113_0833766
676 Ga0496114_0013544
677 Ga0496114_0142835
678 Ga0496114_0184362
679 Ga0496114_0311189
680 Ga0496115_0185601
681 Ga0501306_021646
682 Ga0501305_032337
683 Ga0501317_038628
684 Ga0501318_020465
685 Ga0501318_038509
686 Ga0501031_0199170
687 Ga0501032_0039414
688 Ga0501034_0033837
689 Ga0501034_0228750
690 Ga0501034_0573971
691 Ga0501036_0004894
692 Ga0501036_0812108
693 Ga0501037_0097110
694 Ga0501037_0204989
695 Ga0501038_0022121
696 Ga0501038_0097945
697 Ga0501039_0155053
698 Ga0501039_0171511
699 Ga0501039_0342225
700 Ga0501039_0510061
701 Ga0501042_0170847
702 Ga0501042_0842966
703 Ga0501043_0128228
704 Ga0501046_0229864
705 Ga0501047_0076698
706 Ga0501048_0128000
707 Ga0501067_0024961
708 Ga0501067_0025015
709 Ga0501067_0215992
710 Ga0501068_0020478
711 Ga0501068_0087178
712 Ga0501068_0120953
713 Ga0501068_0137884
714 Ga0501069_0039284
715 Ga0501069_0089700
716 Ga0501069_0090951
717 Ga0501069_0131830
718 Ga0501070_0007652
719 Ga0501070_0023894
720 Ga0501070_0051529
721 Ga0501070_0137725
722 Ga0501070_0883173
723 Ga0501071_0153856
724 Ga0501071_0363999
725 Ga0501071_0527572
726 Ga0501072_0099189
727 Ga0501072_0104218
728 Ga0501073_0063246
729 Ga0501073_0089593
730 Ga0501073_0401815
731 Ga0501074_0003766
732 Ga0501074_0065695
733 Ga0501074_0068122
734 Ga0501076_0355089
735 Ga0501077_0047447
736 Ga0501077_0117513
737 Ga0501209_005241
738 Ga0501079_0112382
739 Ga0501080_0046550
740 Ga0501080_0155636
741 Ga0501080_0286952
742 Ga0501081_0899418
743 Ga0501044_0075961
744 Ga0501044_0744113
745 Ga0501045_0116966
746 Ga0501045_0613389
747 nmdc:mga03683_26619_c1
748 nmdc:mga03683_31478_c1
749 nmdc:mga03n38_13054_c1
750 nmdc:mga03n38_177544_c1
751 nmdc:mga00v17_45860_c1
752 nmdc:mga0yw44_173271_c1
753 nmdc:mga0yw44_204771_c1
754 nmdc:mga0yw44_296457_c1
755 nmdc:mga0yw44_78083_c1
756 nmdc:mga06z11_125233_c1
757 nmdc:mga06z11_162975_c1
758 nmdc:mga06z11_19817_c1
759 nmdc:mga06z11_4705_c1
760 nmdc:mga04h51_35439_c1
761 nmdc:mga04h51_76956_c1
762 nmdc:mga07m45_135041_c1
763 nmdc:mga07m45_17554_c1
764 nmdc:mga07m45_42935_c1
765 nmdc:mga07m45_65892_c1
766 Ga0500644_0075122
767 Ga0500556_0000915
768 Ga0500593_000062
769 Ga0500568_0060628
770 Ga0501084_0150853
771 Ga0501082_0071653
772 Ga0501082_0216227
773 Ga0501082_0488715
774 Ga0466962_0002070
775 Ga0466962_0078086
776 2643890005
777 2643959061
778 2644033703
779 2644091108
780 2644099725
781 2644116611
782 2644320911
783 2729908379
784 2738870354
785 2774391849
786 2809197345
787 2812331461
788 2812352243
789 2855389977
790 8054613759

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00406

ADK

Adenylate kinase

5

152

0.97

PF13207

AAA_17

AAA domain

6

141

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3adk-assembly1.cif.gz_A refined structure of porcine cytosolic adenylate kinase at 2.1 angstroms resolution 0.9268 2 187
2cdn-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis adenylate kinase complexed with two molecules of adp and mg 0.8908 1 186
3adk-assembly1.cif.gz_A refined structure of porcine cytosolic adenylate kinase at 2.1 angstroms resolution 0.8854 2 187
1tev-assembly1.cif.gz_A crystal structure of the human ump/cmp kinase in open conformation 0.8795 3 187
2c9y-assembly1.cif.gz_A structure of human adenylate kinase 2 0.8739 1 186
ID Description Score Start End Superfamily
af_A0A1D6H6N6_28_186_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9355 2 125 3.40.50.300
af_P9WKF5_1_180_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8881 1 185 3.40.50.300
1tevA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8795 3 187 3.40.50.300
af_P9WKF5_1_180_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8789 1 185 3.40.50.300
af_A5PMF1_372_562_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8741 3 186 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A6L5F1D8-F1-model_v4 Adenylate kinase (EC 2.7.4.3) 0.991 2 116 GO:0004017
GO:0005524
GO:0005737
AF-A0A2T6A477-F1-model_v4 deleted 0.9894 1 186
AF-A0A499UYH4-F1-model_v4 Adenylate kinase (AK) (EC 2.7.4.3) (ATP-AMP transphosphorylase) (ATP:AMP phosphotransferase) (Adenylate monophosphate kinase) 0.9878 1 116 GO:0004017
GO:0005524
GO:0005737
GO:0044209
AF-A0A3D5AS70-F1-model_v4 Adenylate kinase (EC 2.7.4.3) 0.9838 1 124 GO:0004017
GO:0005524
GO:0005737
AF-A0A0A0C3D1-F1-model_v4 Adenylate kinase (AK) (EC 2.7.4.3) (ATP-AMP transphosphorylase) (ATP:AMP phosphotransferase) (Adenylate monophosphate kinase) 0.9835 2 186 GO:0004017
GO:0005524
GO:0005737
GO:0044209

Map