F433282

General Info

Members Datasets Scaffolds Average Seq Length
395 222 790 105

Family's Representative Sequence

Representative Sequence 3300044673|Ga0453683_0621545|Ga0453683_0621545_85_432
Length 115
Sequence MSGPTVPSTTDGLTEQDFRLKADRALEDAQRQLLTLADEQGFEVELQNGVLQVIFEEPSPAKFVVSPNAPVRQVWISALSRSYKLSWSARVDAFALDDTPLPVLLDRLVQEHLAS

Samples

Sample ID Description Type Environment
1 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
155 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
156 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
157 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
158 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
159 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
160 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
166 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
167 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
168 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
169 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
170 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
171 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
172 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
173 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
174 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
175 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
176 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
177 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
178 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
179 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
180 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
181 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
182 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
183 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
184 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
185 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
186 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
187 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
188 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
189 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
190 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
195 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
196 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
197 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
198 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
205 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
206 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
207 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
208 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
209 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
210 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
211 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
212 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
213 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
215 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
216 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
217 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
218 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
219 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
220 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
221 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
222 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.52
Rhizosphere 97.72
Stem 0
Stem Tuber 0
Unclassified 23.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453683_0621545 3300044673 Unclassified 705
2 SwRhRL2b_contig_3233084 2162886007 Eukaryota 1140
3 JGI24746J21847_1001308 3300001977 Bacteria 3974
4 JGI24743J22301_10061479 3300001991 Unclassified 774
5 JGI25406J46586_10000121 3300003203 Bacteria 34339
6 Ga0058859_11424613 3300004798 Unclassified 735
7 Ga0065704_10096003 3300005289 Unclassified 2462
8 Ga0065712_10103685 3300005290 Bacteria 1964
9 Ga0065712_10542407 3300005290 Bacteria 622
10 Ga0065715_10089338 3300005293 Bacteria 11032
11 Ga0065715_10203318 3300005293 Unclassified 1350
12 Ga0065707_10001027 3300005295 Bacteria 19259
13 Ga0065707_10098148 3300005295 Bacteria 3109
14 Ga0070676_10006017 3300005328 Bacteria 6476
15 Ga0070676_10198211 3300005328 Unclassified 1315
16 Ga0070676_10241877 3300005328 Bacteria 1201
17 Ga0070690_100025575 3300005330 Bacteria 3635
18 Ga0070690_100200414 3300005330 Bacteria 1388
19 Ga0070690_100859680 3300005330 Bacteria 707
20 Ga0070690_101197423 3300005330 Unclassified 606
21 Ga0070670_100010439 3300005331 Bacteria 7926
22 Ga0070677_10064164 3300005333 Bacteria 1524
23 Ga0070677_10428851 3300005333 Bacteria 703
24 Ga0068869_100275914 3300005334 Bacteria 1350
25 Ga0070666_10003448 3300005335 Bacteria 9581
26 Ga0070666_10743505 3300005335 Bacteria 721
27 Ga0070680_101850115 3300005336 Bacteria 523
28 Ga0068868_100008128 3300005338 Bacteria 7506
29 Ga0068868_100306522 3300005338 Unclassified 1350
30 Ga0070660_100060320 3300005339 Bacteria 2944
31 Ga0070689_100019005 3300005340 Bacteria 5074
32 Ga0070689_100085144 3300005340 Bacteria 2485
33 Ga0070687_100006866 3300005343 Bacteria 4698
34 Ga0070687_100021575 3300005343 Bacteria 3030
35 Ga0070687_100250747 3300005343 Bacteria 1100
36 Ga0070661_100025941 3300005344 Bacteria 4212
37 Ga0070661_101916597 3300005344 Bacteria 504
38 Ga0070692_10011079 3300005345 Bacteria 4129
39 Ga0070668_100226725 3300005347 Bacteria 1543
40 Ga0070668_100279311 3300005347 Bacteria 1394
41 Ga0070669_100000337 3300005353 Bacteria 36590
42 Ga0070669_100251733 3300005353 Bacteria 1406
43 Ga0070669_101299184 3300005353 Bacteria 630
44 Ga0070675_100003183 3300005354 Bacteria 12424
45 Ga0070675_100139215 3300005354 Bacteria 2073
46 Ga0070675_101340222 3300005354 Bacteria 660
47 Ga0070675_101757648 3300005354 Unclassified 572
48 Ga0070671_100012857 3300005355 Bacteria 6750
49 Ga0070671_101940268 3300005355 Bacteria 524
50 Ga0070674_100700000 3300005356 Bacteria 866
51 Ga0070673_100105055 3300005364 Unclassified 2333
52 Ga0070673_100203430 3300005364 Bacteria 1706
53 Ga0070673_100217360 3300005364 Bacteria 1653
54 Ga0070673_100237987 3300005364 Bacteria 1582
55 Ga0070673_100250524 3300005364 Unclassified 1543
56 Ga0070688_100058324 3300005365 Bacteria 2431
57 Ga0070688_100122316 3300005365 Bacteria 1745
58 Ga0070688_100624583 3300005365 Unclassified 827
59 Ga0070659_100222515 3300005366 Bacteria 1558
60 Ga0070659_100947219 3300005366 Bacteria 754
61 Ga0070667_100007549 3300005367 Bacteria 9018
62 Ga0070709_11209891 3300005434 Unclassified 607
63 Ga0070713_100472958 3300005436 Bacteria 1180
64 Ga0070701_10036304 3300005438 Bacteria 2483
65 Ga0070701_10096079 3300005438 Bacteria 1633
66 Ga0070705_100234714 3300005440 Bacteria 1278
67 Ga0070705_101082291 3300005440 Unclassified 655
68 Ga0070700_100010457 3300005441 Bacteria 5124
69 Ga0070700_100116056 3300005441 Bacteria 1787
70 Ga0070694_100496312 3300005444 Bacteria 971
71 Ga0070694_100780308 3300005444 Unclassified 782
72 Ga0070663_100451324 3300005455 Unclassified 1060
73 Ga0070663_101942187 3300005455 Unclassified 529
74 Ga0070678_100017376 3300005456 Bacteria 4630
75 Ga0070678_100081548 3300005456 Unclassified 2453
76 Ga0070678_100295645 3300005456 Bacteria 1374
77 Ga0070662_100006519 3300005457 Bacteria 7528
78 Ga0070662_100044662 3300005457 Bacteria 3175
79 Ga0068867_100011721 3300005459 Bacteria 6190
80 Ga0068867_100158025 3300005459 Bacteria 1786
81 Ga0068867_101528207 3300005459 Bacteria 622
82 Ga0070685_10082124 3300005466 Bacteria 1933
83 Ga0070685_10083441 3300005466 Bacteria 1920
84 Ga0070685_10233574 3300005466 Bacteria 1211
85 Ga0070707_100029869 3300005468 Bacteria 5187
86 Ga0070707_100882979 3300005468 Bacteria 858
87 Ga0070698_100859953 3300005471 Unclassified 852
88 Ga0070698_101066718 3300005471 Bacteria 756
89 Ga0070698_101413355 3300005471 Bacteria 647
90 Ga0070699_100012292 3300005518 Bacteria 7386
91 Ga0070699_100290782 3300005518 Bacteria 1465
92 Ga0070699_100605806 3300005518 Bacteria 999
93 Ga0070684_100013651 3300005535 Bacteria 6555
94 Ga0070684_100917443 3300005535 Unclassified 821
95 Ga0070697_100808324 3300005536 Unclassified 830
96 Ga0070697_101941124 3300005536 Bacteria 527
97 Ga0068853_100962774 3300005539 Unclassified 821
98 Ga0070672_100146498 3300005543 Bacteria 1951
99 Ga0070686_100007546 3300005544 Bacteria 6073
100 Ga0070686_100208820 3300005544 Bacteria 1404
101 Ga0070695_101127731 3300005545 Unclassified 643
102 Ga0070695_101307608 3300005545 Unclassified 599
103 Ga0070693_100256081 3300005547 Bacteria 1162
104 Ga0070665_100541856 3300005548 Bacteria 1176
105 Ga0070665_100784313 3300005548 Unclassified 966
106 Ga0070704_100000305 3300005549 Bacteria 21817
107 Ga0070704_100293965 3300005549 Bacteria 1351
108 Ga0070664_100001479 3300005564 Bacteria 18721
109 Ga0070664_100032720 3300005564 Bacteria 4350
110 Ga0070664_100174823 3300005564 Bacteria 1906
111 Ga0070664_100221834 3300005564 Bacteria 1692
112 Ga0070664_101654127 3300005564 Unclassified 607
113 Ga0068857_100038355 3300005577 Bacteria 4244
114 Ga0068854_100255915 3300005578 Bacteria 1400
115 Ga0068854_100500741 3300005578 Bacteria 1023
116 Ga0070702_100547910 3300005615 Unclassified 858
117 Ga0068852_100099702 3300005616 Bacteria 2619
118 Ga0068852_100922059 3300005616 Unclassified 891
119 Ga0068859_100006955 3300005617 Bacteria 11489
120 Ga0068859_100033489 3300005617 Bacteria 5159
121 Ga0068859_100080112 3300005617 Bacteria 3306
122 Ga0068864_100038815 3300005618 Bacteria 4068
123 Ga0068864_100068028 3300005618 Bacteria 3093
124 Ga0068864_100651084 3300005618 Bacteria 1026
125 Ga0068864_101038035 3300005618 Bacteria 814
126 Ga0068861_100000361 3300005719 Bacteria 26042
127 Ga0068861_100002202 3300005719 Bacteria 12652
128 Ga0068851_10650633 3300005834 Unclassified 645
129 Ga0068870_10000089 3300005840 Bacteria 29678
130 Ga0068870_10004915 3300005840 Bacteria 5787
131 Ga0068870_10057000 3300005840 Bacteria 2087
132 Ga0068863_100008500 3300005841 Bacteria 10025
133 Ga0068863_100200551 3300005841 Bacteria 1919
134 Ga0068858_100030704 3300005842 Bacteria 4990
135 Ga0068858_100052212 3300005842 Unclassified 3782
136 Ga0068858_100660367 3300005842 Bacteria 1016
137 Ga0068860_100005483 3300005843 Bacteria 12857
138 Ga0068860_100082063 3300005843 Bacteria 3066
139 Ga0068860_100199571 3300005843 Bacteria 1938
140 Ga0068860_100710957 3300005843 Bacteria 1015
141 Ga0068862_100003113 3300005844 Bacteria 14453
142 Ga0068862_100120774 3300005844 Bacteria 2309
143 Ga0081539_10001118 3300005985 Bacteria 48678
144 Ga0081539_10002724 3300005985 Bacteria 23904
145 Ga0070717_10491979 3300006028 Bacteria 1108
146 Ga0075432_10089535 3300006058 Unclassified 1125
147 Ga0097621_100038995 3300006237 Bacteria 3814
148 Ga0097621_100052481 3300006237 Unclassified 3322
149 Ga0097621_100932949 3300006237 Unclassified 810
150 Ga0068871_100008051 3300006358 Bacteria 7566
151 Ga0068871_100062813 3300006358 Bacteria 3036
152 Ga0068871_100136833 3300006358 Unclassified 2081
153 Ga0068871_100554100 3300006358 Unclassified 1042
154 Ga0068871_101217555 3300006358 Bacteria 707
155 Ga0068871_101996591 3300006358 Bacteria 552
156 Ga0075428_100022505 3300006844 Bacteria 6979
157 Ga0075428_100311598 3300006844 Bacteria 1692
158 Ga0075430_100234811 3300006846 Bacteria 1520
159 Ga0075430_101002092 3300006846 Unclassified 688
160 Ga0075431_100660623 3300006847 Bacteria 1025
161 Ga0075433_10014863 3300006852 Bacteria 6372
162 Ga0075434_100027744 3300006871 Bacteria 5559
163 Ga0075434_100032629 3300006871 Bacteria 5136
164 Ga0075429_100004264 3300006880 Bacteria 12260
165 Ga0075429_100202153 3300006880 Bacteria 1741
166 Ga0068865_100029160 3300006881 Unclassified 3659
167 Ga0068865_100066294 3300006881 Bacteria 2546
168 Ga0068865_100309958 3300006881 Bacteria 1266
169 Ga0097620_100006955 3300006931 Bacteria 11489
170 Ga0097620_100033493 3300006931 Bacteria 5159
171 Ga0097620_100080116 3300006931 Bacteria 3306
172 Ga0105240_10065630 3300009093 Unclassified 4505
173 Ga0111539_10003238 3300009094 Bacteria 21524
174 Ga0111539_10013701 3300009094 Bacteria 10129
175 Ga0111539_10045632 3300009094 Bacteria 5246
176 Ga0111539_11277614 3300009094 Bacteria 852
177 Ga0105247_10064839 3300009101 Bacteria 2271
178 Ga0105243_10006838 3300009148 Bacteria 8791
179 Ga0105243_10528180 3300009148 Bacteria 1123
180 Ga0105248_10266887 3300009177 Bacteria 1927
181 Ga0105248_11281656 3300009177 Unclassified 829
182 Ga0105249_10003011 3300009553 Bacteria 14537
183 Ga0105249_10009790 3300009553 Bacteria 8397
184 Ga0105246_10120958 3300011119 Bacteria 1940
185 Ga0105246_10443145 3300011119 Unclassified 1089
186 Ga0157315_1039930 3300012508 Unclassified 590
187 Ga0157374_10190971 3300013296 Bacteria 2003
188 Ga0157378_10246540 3300013297 Bacteria 1709
189 Ga0157378_10430807 3300013297 Bacteria 1305
190 Ga0163162_10033356 3300013306 Bacteria 5116
191 Ga0163162_10043457 3300013306 Bacteria 4499
192 Ga0157375_10001912 3300013308 Bacteria 17919
193 Ga0157375_10191939 3300013308 Bacteria 2197
194 Ga0157375_10416307 3300013308 Bacteria 1510
195 Ga0163163_10465950 3300014325 Bacteria 1324
196 Ga0157380_10004702 3300014326 Bacteria 9504
197 Ga0157380_10437351 3300014326 Bacteria 1252
198 Ga0157380_11826968 3300014326 Bacteria 667
199 Ga0157377_10009255 3300014745 Bacteria 4826
200 Ga0157377_10039734 3300014745 Bacteria 2604
201 Ga0157377_10086190 3300014745 Bacteria 1845
202 Ga0157377_10406937 3300014745 Bacteria 928
203 Ga0157379_10012322 3300014968 Bacteria 7469
204 Ga0157376_10125349 3300014969 Bacteria 2283
205 Ga0157376_10164403 3300014969 Bacteria 2015
206 Ga0157376_10215839 3300014969 Bacteria 1774
207 Ga0157376_10622251 3300014969 Bacteria 1077
208 Ga0163161_10059575 3300017792 Bacteria 2777
209 Ga0163161_10232279 3300017792 Bacteria 1432
210 Ga0213874_10313241 3300021377 Unclassified 593
211 Ga0207697_10000326 3300025315 Bacteria 26570
212 Ga0207697_10339937 3300025315 Unclassified 667
213 Ga0207682_10000570 3300025893 Bacteria 17062
214 Ga0207682_10030764 3300025893 Bacteria 2152
215 Ga0207682_10500386 3300025893 Bacteria 575
216 Ga0207688_10005042 3300025901 Bacteria 7183
217 Ga0207688_10088567 3300025901 Bacteria 1775
218 Ga0207680_10034262 3300025903 Bacteria 2904
219 Ga0207680_10850169 3300025903 Bacteria 654
220 Ga0207645_10002124 3300025907 Bacteria 15865
221 Ga0207645_10110657 3300025907 Bacteria 1778
222 Ga0207643_10000652 3300025908 Bacteria 21645
223 Ga0207643_10005770 3300025908 Bacteria 6614
224 Ga0207643_10283339 3300025908 Unclassified 1028
225 Ga0207693_10966253 3300025915 Bacteria 652
226 Ga0207663_11224579 3300025916 Unclassified 604
227 Ga0207660_11332030 3300025917 Bacteria 583
228 Ga0207662_10011002 3300025918 Bacteria 5006
229 Ga0207662_10012832 3300025918 Bacteria 4673
230 Ga0207662_10047483 3300025918 Bacteria 2543
231 Ga0207646_10010715 3300025922 Bacteria 8924
232 Ga0207681_10004095 3300025923 Bacteria 9031
233 Ga0207681_10074699 3300025923 Unclassified 2375
234 Ga0207681_10215281 3300025923 Bacteria 1483
235 Ga0207650_10302577 3300025925 Bacteria 1306
236 Ga0207650_10613868 3300025925 Bacteria 915
237 Ga0207650_11786902 3300025925 Bacteria 520
238 Ga0207659_10000286 3300025926 Bacteria 30659
239 Ga0207659_10013614 3300025926 Bacteria 5216
240 Ga0207700_10094413 3300025928 Bacteria 2370
241 Ga0207644_10014285 3300025931 Bacteria 5312
242 Ga0207644_11195279 3300025931 Bacteria 639
243 Ga0207690_10220264 3300025932 Bacteria 1452
244 Ga0207690_11772207 3300025932 Bacteria 516
245 Ga0207706_10007265 3300025933 Bacteria 10241
246 Ga0207709_10014237 3300025935 Bacteria 4389
247 Ga0207670_10012455 3300025936 Bacteria 4979
248 Ga0207670_10092353 3300025936 Bacteria 2142
249 Ga0207670_10559552 3300025936 Unclassified 935
250 Ga0207669_10697208 3300025937 Bacteria 834
251 Ga0207704_10139673 3300025938 Bacteria 1692
252 Ga0207704_10264347 3300025938 Bacteria 1299
253 Ga0207691_10004316 3300025940 Bacteria 13810
254 Ga0207691_11691010 3300025940 Bacteria 512
255 Ga0207711_10060579 3300025941 Unclassified 3262
256 Ga0207689_10004036 3300025942 Bacteria 13339
257 Ga0207689_10173413 3300025942 Bacteria 1778
258 Ga0207661_10027356 3300025944 Bacteria 4356
259 Ga0207679_10025480 3300025945 Bacteria 4069
260 Ga0207679_10168237 3300025945 Bacteria 1802
261 Ga0207679_10926895 3300025945 Unclassified 797
262 Ga0207679_11671192 3300025945 Unclassified 583
263 Ga0207651_10061914 3300025960 Bacteria 2605
264 Ga0207651_10131602 3300025960 Bacteria 1916
265 Ga0207651_10135616 3300025960 Bacteria 1892
266 Ga0207651_10166347 3300025960 Bacteria 1734
267 Ga0207651_10266104 3300025960 Bacteria 1410
268 Ga0207651_10736774 3300025960 Bacteria 870
269 Ga0207712_10005860 3300025961 Bacteria 7743
270 Ga0207668_10176395 3300025972 Bacteria 1681
271 Ga0207668_10215797 3300025972 Bacteria 1537
272 Ga0207640_10227648 3300025981 Bacteria 1432
273 Ga0207658_11194404 3300025986 Unclassified 695
274 Ga0207677_11746341 3300026023 Unclassified 577
275 Ga0207703_10125841 3300026035 Bacteria 2206
276 Ga0207703_10137408 3300026035 Bacteria 2117
277 Ga0207639_10913551 3300026041 Unclassified 821
278 Ga0207678_10149227 3300026067 Bacteria 1996
279 Ga0207708_10003478 3300026075 Bacteria 11611
280 Ga0207708_10248094 3300026075 Bacteria 1434
281 Ga0207641_10017137 3300026088 Bacteria 5927
282 Ga0207648_10005028 3300026089 Bacteria 13422
283 Ga0207648_10036419 3300026089 Bacteria 4335
284 Ga0207648_11173010 3300026089 Bacteria 721
285 Ga0207676_10017139 3300026095 Bacteria 5248
286 Ga0207676_10069454 3300026095 Bacteria 2821
287 Ga0207676_11001830 3300026095 Bacteria 823
288 Ga0207674_10053116 3300026116 Bacteria 4130
289 Ga0207674_10495379 3300026116 Unclassified 1181
290 Ga0207675_100002253 3300026118 Bacteria 19173
291 Ga0207675_100002587 3300026118 Bacteria 17927
292 Ga0207683_10006282 3300026121 Bacteria 10183
293 Ga0207683_10076868 3300026121 Unclassified 2956
294 Ga0207698_10074605 3300026142 Bacteria 2707
295 Ga0209974_10108746 3300027876 Bacteria 974
296 Ga0209974_10208879 3300027876 Unclassified 723
297 Ga0207428_10000532 3300027907 Bacteria 45376
298 Ga0207428_10000632 3300027907 Bacteria 41360
299 Ga0207428_10047141 3300027907 Bacteria 3461
300 Ga0268265_10001914 3300028380 Bacteria 16539
301 Ga0268265_11019022 3300028380 Unclassified 818
302 Ga0268264_10005036 3300028381 Bacteria 11180
303 Ga0307408_100846814 3300031548 Bacteria 833
304 Ga0307408_101488172 3300031548 Unclassified 640
305 Ga0307405_11562258 3300031731 Bacteria 581
306 Ga0307416_100611675 3300032002 Bacteria 1171
307 Ga0307415_100953256 3300032126 Unclassified 794
308 Ga0373958_0028478 3300034819 Unclassified 1081
309 Ga0373959_0039083 3300034820 Bacteria 989
310 Ga0373949_0064249 3300035090 Bacteria 950
311 Ga0373951_0166206 3300035091 Unclassified 627
312 Ga0373941_0256988 3300035115 Unclassified 684
313 Ga0373956_0523439 3300035119 Bacteria 566
314 Ga0373962_0037986 3300035242 Bacteria 1346
315 Ga0373962_0113417 3300035242 Unclassified 857
316 Ga0373931_1204740 3300035691 Unclassified 518
317 Ga0373937_0695125 3300036401 Bacteria 963
318 Ga0373925_0072988 3300037068 Bacteria 2597
319 Ga0395900_0232431 3300037418 Bacteria 1854
320 Ga0436363_0110739 3300039450 Unclassified 735
321 Ga0439461_0152699 3300041410 Bacteria 597
322 Ga0439462_0101747 3300042015 Bacteria 792
323 Ga0451577_0589315 3300042876 Unclassified 1009
324 Ga0451576_0007024 3300045051 Bacteria 13613
325 Ga0451576_0085684 3300045051 Bacteria 3277
326 Ga0451576_0127434 3300045051 Unclassified 2652
327 Ga0451576_0169078 3300045051 Bacteria 2281
328 Ga0451576_0220267 3300045051 Bacteria 1981
329 Ga0466967_0254443 3300045976 Bacteria 1679
330 Ga0495603_0009288 3300046455 Bacteria 5948
331 Ga0495603_0218911 3300046455 Bacteria 1099
332 Ga0495591_180272 3300046458 Unclassified 503
333 Ga0495629_0037946 3300046459 Bacteria 3395
334 Ga0495629_0044930 3300046459 Bacteria 3100
335 Ga0495641_0206502 3300046461 Unclassified 880
336 Ga0495582_0409835 3300046473 Unclassified 782
337 Ga0495584_0035225 3300046491 Bacteria 2531
338 Ga0495607_0514166 3300046501 Unclassified 530
339 Ga0495630_0471788 3300046517 Bacteria 962
340 Ga0495621_0044394 3300046539 Unclassified 1571
341 Ga0495621_0048466 3300046539 Bacteria 1513
342 Ga0495621_0052907 3300046539 Bacteria 1456
343 Ga0495635_1030019 3300046663 Unclassified 523
344 Ga0495659_0016340 3300046664 Bacteria 2447
345 Ga0495659_0149850 3300046664 Bacteria 936
346 Ga0495658_0074754 3300046683 Bacteria 1975
347 Ga0495669_0097172 3300046684 Unclassified 1365
348 Ga0495581_0461610 3300047315 Unclassified 739
349 Ga0495676_0060154 3300047321 Bacteria 2979
350 Ga0495677_0242066 3300047445 Bacteria 705
351 Ga0495685_301878 3300047447 Bacteria 503
352 Ga0495602_0919669 3300048088 Unclassified 581
353 Ga0495614_0082099 3300048089 Unclassified 1397
354 Ga0496102_0630833 3300048905 Bacteria 995
355 Ga0496104_1099346 3300048907 Unclassified 699
356 Ga0496107_0390097 3300048910 Unclassified 1036
357 Ga0496109_0385916 3300048912 Bacteria 1323
358 Ga0496113_0170630 3300048916 Bacteria 1723
359 Ga0496115_0875298 3300048918 Unclassified 694
360 Ga0501295_098132 3300049518 Unclassified 684
361 Ga0501298_005534 3300049521 Bacteria 2034
362 Ga0501033_0704757 3300049570 Bacteria 687
363 Ga0501040_0610884 3300049576 Bacteria 788
364 Ga0501041_0555193 3300049577 Unclassified 732
365 Ga0501042_0256234 3300049578 Bacteria 1263
366 Ga0501046_0932491 3300049580 Bacteria 605
367 Ga0501048_0131397 3300049582 Bacteria 1770
368 Ga0501048_0898525 3300049582 Unclassified 637
369 Ga0501067_0027860 3300049583 Bacteria 3131
370 Ga0501071_0889656 3300049587 Bacteria 687
371 Ga0501071_1608048 3300049587 Bacteria 502
372 Ga0501074_1210377 3300049590 Unclassified 530
373 Ga0501076_0730400 3300049592 Bacteria 817
374 Ga0501217_137996 3300049661 Unclassified 720
375 Ga0501245_047547 3300049708 Unclassified 752
376 Ga0501081_0178565 3300049743 Bacteria 1535
377 Ga0501241_085342 3300049758 Unclassified 662
378 Ga0501265_088668 3300049762 Unclassified 549
379 Ga0501044_1340125 3300049823 Bacteria 582
380 Ga0501045_1134183 3300049824 Unclassified 571
381 nmdc:mga05p37_459585_c1 3300050507 Unclassified 1471
382 nmdc:mga09592_17514_c1 3300050508 Bacteria 5870
383 nmdc:mga09592_317020_c1 3300050508 Bacteria 1351
384 nmdc:mga09592_923095_c1 3300050508 Bacteria 733
385 nmdc:mga0qj67_808043_c1 3300050509 Bacteria 742
386 nmdc:mga06r32_606779_c1 3300050510 Bacteria 1065
387 nmdc:mga08y16_1339412_c1 3300050511 Bacteria 681
388 nmdc:mga08y16_5246_c1 3300050511 Bacteria 13536
389 nmdc:mga08y16_6239_c1 3300050511 Bacteria 12499
390 nmdc:mga08y16_73706_c1 3300050511 Bacteria 3557
391 nmdc:mga0n895_132602_c1 3300050512 Unclassified 2517
392 nmdc:mga0n895_13753_c2 3300050512 Bacteria 2615
393 nmdc:mga0rr50_615169_c1 3300050513 Bacteria 926
394 nmdc:mga0a205_26657_c1 3300050515 Bacteria 5514
395 nmdc:mga0a205_402730_c1 3300050515 Unclassified 1232
396 Ga0453683_0621545
397 SwRhRL2b_contig_3233084
398 JGI24746J21847_1001308
399 JGI24743J22301_10061479
400 JGI25406J46586_10000121
401 Ga0058859_11424613
402 Ga0065704_10096003
403 Ga0065712_10103685
404 Ga0065712_10542407
405 Ga0065715_10089338
406 Ga0065715_10203318
407 Ga0065707_10001027
408 Ga0065707_10098148
409 Ga0070676_10006017
410 Ga0070676_10198211
411 Ga0070676_10241877
412 Ga0070690_100025575
413 Ga0070690_100200414
414 Ga0070690_100859680
415 Ga0070690_101197423
416 Ga0070670_100010439
417 Ga0070677_10064164
418 Ga0070677_10428851
419 Ga0068869_100275914
420 Ga0070666_10003448
421 Ga0070666_10743505
422 Ga0070680_101850115
423 Ga0068868_100008128
424 Ga0068868_100306522
425 Ga0070660_100060320
426 Ga0070689_100019005
427 Ga0070689_100085144
428 Ga0070687_100006866
429 Ga0070687_100021575
430 Ga0070687_100250747
431 Ga0070661_100025941
432 Ga0070661_101916597
433 Ga0070692_10011079
434 Ga0070668_100226725
435 Ga0070668_100279311
436 Ga0070669_100000337
437 Ga0070669_100251733
438 Ga0070669_101299184
439 Ga0070675_100003183
440 Ga0070675_100139215
441 Ga0070675_101340222
442 Ga0070675_101757648
443 Ga0070671_100012857
444 Ga0070671_101940268
445 Ga0070674_100700000
446 Ga0070673_100105055
447 Ga0070673_100203430
448 Ga0070673_100217360
449 Ga0070673_100237987
450 Ga0070673_100250524
451 Ga0070688_100058324
452 Ga0070688_100122316
453 Ga0070688_100624583
454 Ga0070659_100222515
455 Ga0070659_100947219
456 Ga0070667_100007549
457 Ga0070709_11209891
458 Ga0070713_100472958
459 Ga0070701_10036304
460 Ga0070701_10096079
461 Ga0070705_100234714
462 Ga0070705_101082291
463 Ga0070700_100010457
464 Ga0070700_100116056
465 Ga0070694_100496312
466 Ga0070694_100780308
467 Ga0070663_100451324
468 Ga0070663_101942187
469 Ga0070678_100017376
470 Ga0070678_100081548
471 Ga0070678_100295645
472 Ga0070662_100006519
473 Ga0070662_100044662
474 Ga0068867_100011721
475 Ga0068867_100158025
476 Ga0068867_101528207
477 Ga0070685_10082124
478 Ga0070685_10083441
479 Ga0070685_10233574
480 Ga0070707_100029869
481 Ga0070707_100882979
482 Ga0070698_100859953
483 Ga0070698_101066718
484 Ga0070698_101413355
485 Ga0070699_100012292
486 Ga0070699_100290782
487 Ga0070699_100605806
488 Ga0070684_100013651
489 Ga0070684_100917443
490 Ga0070697_100808324
491 Ga0070697_101941124
492 Ga0068853_100962774
493 Ga0070672_100146498
494 Ga0070686_100007546
495 Ga0070686_100208820
496 Ga0070695_101127731
497 Ga0070695_101307608
498 Ga0070693_100256081
499 Ga0070665_100541856
500 Ga0070665_100784313
501 Ga0070704_100000305
502 Ga0070704_100293965
503 Ga0070664_100001479
504 Ga0070664_100032720
505 Ga0070664_100174823
506 Ga0070664_100221834
507 Ga0070664_101654127
508 Ga0068857_100038355
509 Ga0068854_100255915
510 Ga0068854_100500741
511 Ga0070702_100547910
512 Ga0068852_100099702
513 Ga0068852_100922059
514 Ga0068859_100006955
515 Ga0068859_100033489
516 Ga0068859_100080112
517 Ga0068864_100038815
518 Ga0068864_100068028
519 Ga0068864_100651084
520 Ga0068864_101038035
521 Ga0068861_100000361
522 Ga0068861_100002202
523 Ga0068851_10650633
524 Ga0068870_10000089
525 Ga0068870_10004915
526 Ga0068870_10057000
527 Ga0068863_100008500
528 Ga0068863_100200551
529 Ga0068858_100030704
530 Ga0068858_100052212
531 Ga0068858_100660367
532 Ga0068860_100005483
533 Ga0068860_100082063
534 Ga0068860_100199571
535 Ga0068860_100710957
536 Ga0068862_100003113
537 Ga0068862_100120774
538 Ga0081539_10001118
539 Ga0081539_10002724
540 Ga0070717_10491979
541 Ga0075432_10089535
542 Ga0097621_100038995
543 Ga0097621_100052481
544 Ga0097621_100932949
545 Ga0068871_100008051
546 Ga0068871_100062813
547 Ga0068871_100136833
548 Ga0068871_100554100
549 Ga0068871_101217555
550 Ga0068871_101996591
551 Ga0075428_100022505
552 Ga0075428_100311598
553 Ga0075430_100234811
554 Ga0075430_101002092
555 Ga0075431_100660623
556 Ga0075433_10014863
557 Ga0075434_100027744
558 Ga0075434_100032629
559 Ga0075429_100004264
560 Ga0075429_100202153
561 Ga0068865_100029160
562 Ga0068865_100066294
563 Ga0068865_100309958
564 Ga0097620_100006955
565 Ga0097620_100033493
566 Ga0097620_100080116
567 Ga0105240_10065630
568 Ga0111539_10003238
569 Ga0111539_10013701
570 Ga0111539_10045632
571 Ga0111539_11277614
572 Ga0105247_10064839
573 Ga0105243_10006838
574 Ga0105243_10528180
575 Ga0105248_10266887
576 Ga0105248_11281656
577 Ga0105249_10003011
578 Ga0105249_10009790
579 Ga0105246_10120958
580 Ga0105246_10443145
581 Ga0157315_1039930
582 Ga0157374_10190971
583 Ga0157378_10246540
584 Ga0157378_10430807
585 Ga0163162_10033356
586 Ga0163162_10043457
587 Ga0157375_10001912
588 Ga0157375_10191939
589 Ga0157375_10416307
590 Ga0163163_10465950
591 Ga0157380_10004702
592 Ga0157380_10437351
593 Ga0157380_11826968
594 Ga0157377_10009255
595 Ga0157377_10039734
596 Ga0157377_10086190
597 Ga0157377_10406937
598 Ga0157379_10012322
599 Ga0157376_10125349
600 Ga0157376_10164403
601 Ga0157376_10215839
602 Ga0157376_10622251
603 Ga0163161_10059575
604 Ga0163161_10232279
605 Ga0213874_10313241
606 Ga0207697_10000326
607 Ga0207697_10339937
608 Ga0207682_10000570
609 Ga0207682_10030764
610 Ga0207682_10500386
611 Ga0207688_10005042
612 Ga0207688_10088567
613 Ga0207680_10034262
614 Ga0207680_10850169
615 Ga0207645_10002124
616 Ga0207645_10110657
617 Ga0207643_10000652
618 Ga0207643_10005770
619 Ga0207643_10283339
620 Ga0207693_10966253
621 Ga0207663_11224579
622 Ga0207660_11332030
623 Ga0207662_10011002
624 Ga0207662_10012832
625 Ga0207662_10047483
626 Ga0207646_10010715
627 Ga0207681_10004095
628 Ga0207681_10074699
629 Ga0207681_10215281
630 Ga0207650_10302577
631 Ga0207650_10613868
632 Ga0207650_11786902
633 Ga0207659_10000286
634 Ga0207659_10013614
635 Ga0207700_10094413
636 Ga0207644_10014285
637 Ga0207644_11195279
638 Ga0207690_10220264
639 Ga0207690_11772207
640 Ga0207706_10007265
641 Ga0207709_10014237
642 Ga0207670_10012455
643 Ga0207670_10092353
644 Ga0207670_10559552
645 Ga0207669_10697208
646 Ga0207704_10139673
647 Ga0207704_10264347
648 Ga0207691_10004316
649 Ga0207691_11691010
650 Ga0207711_10060579
651 Ga0207689_10004036
652 Ga0207689_10173413
653 Ga0207661_10027356
654 Ga0207679_10025480
655 Ga0207679_10168237
656 Ga0207679_10926895
657 Ga0207679_11671192
658 Ga0207651_10061914
659 Ga0207651_10131602
660 Ga0207651_10135616
661 Ga0207651_10166347
662 Ga0207651_10266104
663 Ga0207651_10736774
664 Ga0207712_10005860
665 Ga0207668_10176395
666 Ga0207668_10215797
667 Ga0207640_10227648
668 Ga0207658_11194404
669 Ga0207677_11746341
670 Ga0207703_10125841
671 Ga0207703_10137408
672 Ga0207639_10913551
673 Ga0207678_10149227
674 Ga0207708_10003478
675 Ga0207708_10248094
676 Ga0207641_10017137
677 Ga0207648_10005028
678 Ga0207648_10036419
679 Ga0207648_11173010
680 Ga0207676_10017139
681 Ga0207676_10069454
682 Ga0207676_11001830
683 Ga0207674_10053116
684 Ga0207674_10495379
685 Ga0207675_100002253
686 Ga0207675_100002587
687 Ga0207683_10006282
688 Ga0207683_10076868
689 Ga0207698_10074605
690 Ga0209974_10108746
691 Ga0209974_10208879
692 Ga0207428_10000532
693 Ga0207428_10000632
694 Ga0207428_10047141
695 Ga0268265_10001914
696 Ga0268265_11019022
697 Ga0268264_10005036
698 Ga0307408_100846814
699 Ga0307408_101488172
700 Ga0307405_11562258
701 Ga0307416_100611675
702 Ga0307415_100953256
703 Ga0373958_0028478
704 Ga0373959_0039083
705 Ga0373949_0064249
706 Ga0373951_0166206
707 Ga0373941_0256988
708 Ga0373956_0523439
709 Ga0373962_0037986
710 Ga0373962_0113417
711 Ga0373931_1204740
712 Ga0373937_0695125
713 Ga0373925_0072988
714 Ga0395900_0232431
715 Ga0436363_0110739
716 Ga0439461_0152699
717 Ga0439462_0101747
718 Ga0451577_0589315
719 Ga0451576_0007024
720 Ga0451576_0085684
721 Ga0451576_0127434
722 Ga0451576_0169078
723 Ga0451576_0220267
724 Ga0466967_0254443
725 Ga0495603_0009288
726 Ga0495603_0218911
727 Ga0495591_180272
728 Ga0495629_0037946
729 Ga0495629_0044930
730 Ga0495641_0206502
731 Ga0495582_0409835
732 Ga0495584_0035225
733 Ga0495607_0514166
734 Ga0495630_0471788
735 Ga0495621_0044394
736 Ga0495621_0048466
737 Ga0495621_0052907
738 Ga0495635_1030019
739 Ga0495659_0016340
740 Ga0495659_0149850
741 Ga0495658_0074754
742 Ga0495669_0097172
743 Ga0495581_0461610
744 Ga0495676_0060154
745 Ga0495677_0242066
746 Ga0495685_301878
747 Ga0495602_0919669
748 Ga0495614_0082099
749 Ga0496102_0630833
750 Ga0496104_1099346
751 Ga0496107_0390097
752 Ga0496109_0385916
753 Ga0496113_0170630
754 Ga0496115_0875298
755 Ga0501295_098132
756 Ga0501298_005534
757 Ga0501033_0704757
758 Ga0501040_0610884
759 Ga0501041_0555193
760 Ga0501042_0256234
761 Ga0501046_0932491
762 Ga0501048_0131397
763 Ga0501048_0898525
764 Ga0501067_0027860
765 Ga0501071_0889656
766 Ga0501071_1608048
767 Ga0501074_1210377
768 Ga0501076_0730400
769 Ga0501217_137996
770 Ga0501245_047547
771 Ga0501081_0178565
772 Ga0501241_085342
773 Ga0501265_088668
774 Ga0501044_1340125
775 Ga0501045_1134183
776 nmdc:mga05p37_459585_c1
777 nmdc:mga09592_17514_c1
778 nmdc:mga09592_317020_c1
779 nmdc:mga09592_923095_c1
780 nmdc:mga0qj67_808043_c1
781 nmdc:mga06r32_606779_c1
782 nmdc:mga08y16_1339412_c1
783 nmdc:mga08y16_5246_c1
784 nmdc:mga08y16_6239_c1
785 nmdc:mga08y16_73706_c1
786 nmdc:mga0n895_132602_c1
787 nmdc:mga0n895_13753_c2
788 nmdc:mga0rr50_615169_c1
789 nmdc:mga0a205_26657_c1
790 nmdc:mga0a205_402730_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01491

Frataxin_Cyay

Frataxin-like domain

13

115

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3t3l-assembly1.cif.gz_A 1.15 a structure of human frataxin variant q153a 0.8152 3 105
3s5f-assembly1.cif.gz_A crystal structure of human frataxin variant w155f 0.8071 2 105
5h7d-assembly1.cif.gz_A crystal structure of the ygjg-protein a-zpa963-calmodulin complex 0.7977 5 47
6fco-assembly1.cif.gz_D structural and functional characterisation of frataxin (fxn) like protein from chaetomium thermophilum 0.7947 1 99
3t3l-assembly1.cif.gz_A 1.15 a structure of human frataxin variant q153a 0.7947 3 105
ID Description Score Start End Superfamily
af_Q07540_63_174_3.30.920.10 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Frataxin/CyaY 0.814 3 104 3.30.920.10
6jfwA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain 0.8139 17 44 3.30.1330.60
af_I1JK59_72_191_3.30.920.10 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Frataxin/CyaY 0.8126 3 105 3.30.920.10
af_Q9TY03_16_135_3.30.920.10 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Frataxin/CyaY 0.7978 1 105 3.30.920.10
af_Q59PA3_59_177_3.30.920.10 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Frataxin/CyaY 0.7961 1 105 3.30.920.10
ID Description Score Start End GO Terms
AF-A0A1F2SFF9-F1-model_v4 Iron donor protein CyaY 0.9997 3 104 GO:0005737
GO:0008199
GO:0016226
AF-A0A7Y4WDA4-F1-model_v4 Iron donor protein CyaY 0.992 2 105 GO:0005737
GO:0008199
GO:0016226
AF-A0A7Y4WDA4-F1-model_v4 Iron donor protein CyaY 0.9824 2 105 GO:0005737
GO:0008199
GO:0016226
AF-A0A1F2SFF9-F1-model_v4 Iron donor protein CyaY 0.9619 3 104 GO:0005737
GO:0008199
GO:0016226
AF-A0A2V9BXV0-F1-model_v4 Iron donor protein CyaY 0.9524 3 105 GO:0005737
GO:0008199
GO:0016226

Map