F433264

General Info

Members Datasets Scaffolds Average Seq Length
395 192 790 252

Family's Representative Sequence

Representative Sequence 3300037068|Ga0373925_0000253|Ga0373925_0000253_27889_28650
Length 253
Sequence MPVLDIFDLTGRRVLVTGASRGIGAGLAAALGQAGAEVALVARDRAALTTVAAEIEQKTVCIAADLSDPAAAVDVVEQAEQALGPLDVLVNNSAMTVGGPALDATADSWDTVSNLNARAPFLLAQAAARGMIERRSGKIINLGSIVSYVGDSMAPAYVATKTAVLGLTRALAVEWAPFGVTVNALCPGWIETDMTADLQANAKFNERVLRSVPARRWGKPSDLTAAMIFLASPGSDFMTGQSLIVDGGLLARW

Samples

Sample ID Description Type Environment
1 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
75 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
76 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
77 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
124 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
125 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
126 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
127 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
128 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
129 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
132 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
136 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
137 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
138 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
139 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
140 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
141 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
142 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
145 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
146 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
147 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
148 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
149 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
150 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
151 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
152 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
153 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
154 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
155 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
156 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
157 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
158 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
159 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
160 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
161 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
162 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
163 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
164 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
165 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
166 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
167 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
168 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
169 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
170 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
171 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
172 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
173 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
176 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
180 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
181 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
182 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
183 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
187 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
188 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
189 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
190 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
191 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
192 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.28
Rhizosphere 95.19
Stem 0
Stem Tuber 0
Unclassified 20

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373925_0000253 3300037068 Bacteria 56157
2 rootH1_10111403 3300003316 Bacteria 1537
3 Ga0065712_10135457 3300005290 Bacteria 1488
4 Ga0070658_10004038 3300005327 Bacteria 12027
5 Ga0070658_10368108 3300005327 Unclassified 1232
6 Ga0070676_10118315 3300005328 Bacteria 1659
7 Ga0070683_100026728 3300005329 Bacteria 5201
8 Ga0070683_100058052 3300005329 Bacteria 3596
9 Ga0070683_100087678 3300005329 Bacteria 2919
10 Ga0070683_100171699 3300005329 Bacteria 2058
11 Ga0070683_100481856 3300005329 Unclassified 1184
12 Ga0070670_100002956 3300005331 Bacteria 14083
13 Ga0068869_100034772 3300005334 Unclassified 3567
14 Ga0070680_100002797 3300005336 Bacteria 12961
15 Ga0070680_100067775 3300005336 Bacteria 2928
16 Ga0070682_100323171 3300005337 Unclassified 1140
17 Ga0070660_100100572 3300005339 Unclassified 2290
18 Ga0070689_100021583 3300005340 Bacteria 4797
19 Ga0070661_100004454 3300005344 Bacteria 9657
20 Ga0070661_100069164 3300005344 Bacteria 2596
21 Ga0070671_100034809 3300005355 Bacteria 4171
22 Ga0070673_100074047 3300005364 Unclassified 2743
23 Ga0070673_100120872 3300005364 Bacteria 2185
24 Ga0070688_100014824 3300005365 Bacteria 4423
25 Ga0070659_100075360 3300005366 Unclassified 2689
26 Ga0070714_100260905 3300005435 Bacteria 1604
27 Ga0070713_100359097 3300005436 Bacteria 1353
28 Ga0070710_10023230 3300005437 Bacteria 3256
29 Ga0070711_100002676 3300005439 Bacteria 10220
30 Ga0070711_100109689 3300005439 Unclassified 2023
31 Ga0070678_100053590 3300005456 Bacteria 2934
32 Ga0070678_100497320 3300005456 Bacteria 1075
33 Ga0070662_100023796 3300005457 Unclassified 4212
34 Ga0070662_100090758 3300005457 Bacteria 2294
35 Ga0070681_10000496 3300005458 Bacteria 32107
36 Ga0070681_10020695 3300005458 Bacteria 6591
37 Ga0070681_10144444 3300005458 Bacteria 2309
38 Ga0068867_100021504 3300005459 Unclassified 4603
39 Ga0068867_100149858 3300005459 Unclassified 1831
40 Ga0070706_100018133 3300005467 Bacteria 6493
41 Ga0070679_100006647 3300005530 Bacteria 10783
42 Ga0070679_100037898 3300005530 Unclassified 4791
43 Ga0070679_100051960 3300005530 Unclassified 4083
44 Ga0070684_100017373 3300005535 Bacteria 5903
45 Ga0070684_100037109 3300005535 Unclassified 4178
46 Ga0070684_100049846 3300005535 Bacteria 3636
47 Ga0070684_100068832 3300005535 Bacteria 3112
48 Ga0068853_100048226 3300005539 Bacteria 3658
49 Ga0068853_100050745 3300005539 Bacteria 3570
50 Ga0068853_100062866 3300005539 Bacteria 3214
51 Ga0068853_100098406 3300005539 Unclassified 2583
52 Ga0070693_100013670 3300005547 Bacteria 4141
53 Ga0070665_100001171 3300005548 Bacteria 32170
54 Ga0070665_100027454 3300005548 Bacteria 5734
55 Ga0070665_100077079 3300005548 Bacteria 3340
56 Ga0070665_100082258 3300005548 Bacteria 3225
57 Ga0070665_100452074 3300005548 Unclassified 1294
58 Ga0068855_100001685 3300005563 Bacteria 27674
59 Ga0068855_100001812 3300005563 Bacteria 26661
60 Ga0068855_100012070 3300005563 Bacteria 10442
61 Ga0068855_100013065 3300005563 Bacteria 10016
62 Ga0068855_100018126 3300005563 Bacteria 8460
63 Ga0068855_100064698 3300005563 Bacteria 4265
64 Ga0068855_100087019 3300005563 Bacteria 3612
65 Ga0068855_100322886 3300005563 Bacteria 1706
66 Ga0068855_100968239 3300005563 Bacteria 895
67 Ga0070664_100003374 3300005564 Bacteria 12903
68 Ga0070664_100135620 3300005564 Bacteria 2164
69 Ga0068857_100000136 3300005577 Bacteria 44769
70 Ga0068857_100003729 3300005577 Bacteria 12791
71 Ga0068857_100118844 3300005577 Bacteria 2379
72 Ga0068857_100159125 3300005577 Bacteria 2049
73 Ga0068854_100013790 3300005578 Bacteria 5314
74 Ga0068854_100037230 3300005578 Bacteria 3414
75 Ga0068854_100076668 3300005578 Bacteria 2458
76 Ga0068856_100002233 3300005614 Bacteria 20000
77 Ga0068856_100002345 3300005614 Bacteria 19474
78 Ga0068856_100008769 3300005614 Bacteria 9836
79 Ga0068856_100036213 3300005614 Unclassified 4838
80 Ga0068856_100376860 3300005614 Unclassified 1438
81 Ga0068856_100653610 3300005614 Unclassified 1072
82 Ga0068856_100897009 3300005614 Unclassified 905
83 Ga0068852_100000124 3300005616 Bacteria 51999
84 Ga0068852_100023350 3300005616 Unclassified 4977
85 Ga0068852_100930553 3300005616 Bacteria 887
86 Ga0068859_100003481 3300005617 Bacteria 16023
87 Ga0068859_100439380 3300005617 Bacteria 1401
88 Ga0068859_100744762 3300005617 Unclassified 1069
89 Ga0068864_100001130 3300005618 Bacteria 22316
90 Ga0068866_10023863 3300005718 Unclassified 2850
91 Ga0068861_100074054 3300005719 Bacteria 2647
92 Ga0068861_100267207 3300005719 Bacteria 1467
93 Ga0068870_10093203 3300005840 Bacteria 1688
94 Ga0068863_100021360 3300005841 Bacteria 6178
95 Ga0068863_100046779 3300005841 Bacteria 4107
96 Ga0068858_100012239 3300005842 Bacteria 8089
97 Ga0068858_100019182 3300005842 Bacteria 6398
98 Ga0068858_100055965 3300005842 Bacteria 3646
99 Ga0068860_100029134 3300005843 Bacteria 5311
100 Ga0081455_10012239 3300005937 Bacteria 8566
101 Ga0081540_1003734 3300005983 Bacteria 11930
102 Ga0070717_10000341 3300006028 Bacteria 30049
103 Ga0070717_10007093 3300006028 Bacteria 8301
104 Ga0070712_100000139 3300006175 Bacteria 37733
105 Ga0097621_100007910 3300006237 Bacteria 7625
106 Ga0097621_100008199 3300006237 Bacteria 7515
107 Ga0097621_100013352 3300006237 Bacteria 6120
108 Ga0068871_100001676 3300006358 Bacteria 14888
109 Ga0068871_100023430 3300006358 Unclassified 4776
110 Ga0068871_100113484 3300006358 Bacteria 2282
111 Ga0075428_100073893 3300006844 Bacteria 3724
112 Ga0075431_100018179 3300006847 Bacteria 7152
113 Ga0068865_100054105 3300006881 Bacteria 2787
114 Ga0068865_100071457 3300006881 Bacteria 2462
115 Ga0097620_100003481 3300006931 Bacteria 16023
116 Ga0097620_100439406 3300006931 Bacteria 1401
117 Ga0097620_100744572 3300006931 Unclassified 1069
118 Ga0105240_10002589 3300009093 Bacteria 28966
119 Ga0105240_10003814 3300009093 Bacteria 23293
120 Ga0105240_10007376 3300009093 Bacteria 15995
121 Ga0105240_10130586 3300009093 Bacteria 3014
122 Ga0105240_10181378 3300009093 Unclassified 2484
123 Ga0105240_10196872 3300009093 Bacteria 2365
124 Ga0105240_10238094 3300009093 Bacteria 2111
125 Ga0105245_10182258 3300009098 Bacteria 2007
126 Ga0105245_10243720 3300009098 Bacteria 1743
127 Ga0105241_10302891 3300009174 Unclassified 1372
128 Ga0105242_10177620 3300009176 Bacteria 1876
129 Ga0105242_10815072 3300009176 Bacteria 925
130 Ga0105248_10017290 3300009177 Bacteria 7946
131 Ga0105248_10084643 3300009177 Bacteria 3567
132 Ga0105248_10307986 3300009177 Unclassified 1784
133 Ga0105237_10007959 3300009545 Bacteria 11549
134 Ga0105237_10148396 3300009545 Bacteria 2340
135 Ga0105238_10000720 3300009551 Bacteria 34494
136 Ga0105238_10003041 3300009551 Bacteria 16730
137 Ga0105238_10008117 3300009551 Bacteria 10497
138 Ga0105238_10147420 3300009551 Bacteria 2329
139 Ga0105238_10225112 3300009551 Bacteria 1852
140 Ga0105238_10229806 3300009551 Bacteria 1832
141 Ga0105238_10816893 3300009551 Bacteria 948
142 Ga0105239_10034765 3300010375 Bacteria 5536
143 Ga0105239_10327480 3300010375 Bacteria 1728
144 Ga0105239_10618235 3300010375 Bacteria 1236
145 Ga0105239_11006009 3300010375 Bacteria 958
146 Ga0105246_10050481 3300011119 Unclassified 2853
147 Ga0157373_10016554 3300013100 Bacteria 5376
148 Ga0157373_10025994 3300013100 Unclassified 4230
149 Ga0157370_10002425 3300013104 Bacteria 22483
150 Ga0157370_10007432 3300013104 Bacteria 11919
151 Ga0157370_10113674 3300013104 Unclassified 2530
152 Ga0157370_10451713 3300013104 Bacteria 1181
153 Ga0157369_10000134 3300013105 Bacteria 105562
154 Ga0157369_10005720 3300013105 Bacteria 14444
155 Ga0157369_10008243 3300013105 Bacteria 11946
156 Ga0157369_10012228 3300013105 Bacteria 9746
157 Ga0157369_10034177 3300013105 Bacteria 5582
158 Ga0157369_10339192 3300013105 Unclassified 1561
159 Ga0157369_10354706 3300013105 Bacteria 1523
160 Ga0157374_10000183 3300013296 Bacteria 58330
161 Ga0157374_10004050 3300013296 Bacteria 12312
162 Ga0157374_10045916 3300013296 Bacteria 4044
163 Ga0157374_10115147 3300013296 Bacteria 2589
164 Ga0157374_10276538 3300013296 Unclassified 1657
165 Ga0157378_10000107 3300013297 Bacteria 79357
166 Ga0157378_10000641 3300013297 Bacteria 32867
167 Ga0157378_10008381 3300013297 Bacteria 9005
168 Ga0157378_10011621 3300013297 Bacteria 7708
169 Ga0157372_10000153 3300013307 Bacteria 74783
170 Ga0157372_10000865 3300013307 Bacteria 32847
171 Ga0157372_10001235 3300013307 Bacteria 27682
172 Ga0157372_10001994 3300013307 Bacteria 22174
173 Ga0157372_10049537 3300013307 Unclassified 4671
174 Ga0157372_10066553 3300013307 Unclassified 4048
175 Ga0157372_10068422 3300013307 Bacteria 3992
176 Ga0157372_10212099 3300013307 Unclassified 2244
177 Ga0157372_10216070 3300013307 Bacteria 2222
178 Ga0157372_10387557 3300013307 Bacteria 1628
179 Ga0157372_10797503 3300013307 Unclassified 1097
180 Ga0163163_10157859 3300014325 Bacteria 2313
181 Ga0157379_10220076 3300014968 Unclassified 1720
182 Ga0157376_10067036 3300014969 Bacteria 3035
183 Ga0157376_10113480 3300014969 Unclassified 2389
184 Ga0157376_10135486 3300014969 Bacteria 2203
185 Ga0157376_10279364 3300014969 Bacteria 1572
186 Ga0157376_10432478 3300014969 Bacteria 1279
187 Ga0157376_10557015 3300014969 Bacteria 1135
188 Ga0213872_10004069 3300021361 Bacteria 7873
189 Ga0213872_10005311 3300021361 Bacteria 6656
190 Ga0213872_10058087 3300021361 Bacteria 1751
191 Ga0213875_10017186 3300021388 Bacteria 3500
192 Ga0213875_10158257 3300021388 Unclassified 1062
193 Ga0213871_10065738 3300021441 Bacteria 1017
194 Ga0207692_10037574 3300025898 Bacteria 2369
195 Ga0207642_10165247 3300025899 Bacteria 1192
196 Ga0207642_10186732 3300025899 Bacteria 1134
197 Ga0207647_10066016 3300025904 Bacteria 2195
198 Ga0207647_10162329 3300025904 Bacteria 1303
199 Ga0207705_10042217 3300025909 Unclassified 3274
200 Ga0207705_10260314 3300025909 Bacteria 1324
201 Ga0207684_10040417 3300025910 Bacteria 3954
202 Ga0207654_10129316 3300025911 Bacteria 1596
203 Ga0207654_10395953 3300025911 Unclassified 959
204 Ga0207707_10000664 3300025912 Bacteria 34148
205 Ga0207707_10134267 3300025912 Bacteria 2164
206 Ga0207695_10000105 3300025913 Bacteria 254764
207 Ga0207695_10004545 3300025913 Bacteria 18875
208 Ga0207695_10047795 3300025913 Bacteria 4524
209 Ga0207695_10085305 3300025913 Bacteria 3187
210 Ga0207695_10101190 3300025913 Bacteria 2876
211 Ga0207671_10007652 3300025914 Bacteria 9332
212 Ga0207671_10171574 3300025914 Bacteria 1685
213 Ga0207693_10004438 3300025915 Bacteria 11858
214 Ga0207693_10310540 3300025915 Unclassified 1235
215 Ga0207693_10474120 3300025915 Bacteria 977
216 Ga0207663_10015144 3300025916 Bacteria 4246
217 Ga0207660_10085159 3300025917 Bacteria 2331
218 Ga0207660_10125776 3300025917 Bacteria 1946
219 Ga0207657_10111014 3300025919 Unclassified 2265
220 Ga0207649_10018552 3300025920 Unclassified 3960
221 Ga0207652_10004953 3300025921 Bacteria 10785
222 Ga0207652_10052896 3300025921 Unclassified 3487
223 Ga0207652_10101701 3300025921 Bacteria 2539
224 Ga0207652_10282661 3300025921 Bacteria 1497
225 Ga0207694_10015141 3300025924 Bacteria 5815
226 Ga0207694_10027314 3300025924 Bacteria 4346
227 Ga0207694_10039519 3300025924 Bacteria 3631
228 Ga0207694_10105342 3300025924 Bacteria 2239
229 Ga0207694_10108352 3300025924 Bacteria 2207
230 Ga0207650_10024637 3300025925 Unclassified 4280
231 Ga0207700_10310418 3300025928 Bacteria 1364
232 Ga0207664_10112521 3300025929 Unclassified 2266
233 Ga0207664_10137006 3300025929 Unclassified 2067
234 Ga0207644_10029052 3300025931 Bacteria 3833
235 Ga0207690_10036309 3300025932 Bacteria 3190
236 Ga0207706_10043227 3300025933 Bacteria 3994
237 Ga0207686_10151688 3300025934 Bacteria 1614
238 Ga0207670_10023435 3300025936 Bacteria 3843
239 Ga0207704_10018458 3300025938 Bacteria 3641
240 Ga0207704_10025591 3300025938 Bacteria 3222
241 Ga0207665_10044014 3300025939 Bacteria 2987
242 Ga0207711_10023135 3300025941 Bacteria 5202
243 Ga0207711_10082568 3300025941 Bacteria 2809
244 Ga0207711_10423816 3300025941 Bacteria 1238
245 Ga0207689_10018358 3300025942 Bacteria 5902
246 Ga0207661_10018089 3300025944 Bacteria 5232
247 Ga0207661_10070675 3300025944 Bacteria 2850
248 Ga0207661_10081523 3300025944 Unclassified 2673
249 Ga0207661_10109138 3300025944 Bacteria 2337
250 Ga0207679_10180741 3300025945 Bacteria 1745
251 Ga0207679_10201419 3300025945 Unclassified 1663
252 Ga0207667_10000245 3300025949 Bacteria 76423
253 Ga0207667_10007320 3300025949 Bacteria 13285
254 Ga0207667_10013317 3300025949 Bacteria 9420
255 Ga0207667_10028833 3300025949 Bacteria 6026
256 Ga0207667_10085802 3300025949 Bacteria 3259
257 Ga0207667_10158077 3300025949 Bacteria 2332
258 Ga0207667_10221136 3300025949 Unclassified 1940
259 Ga0207667_10301762 3300025949 Bacteria 1636
260 Ga0207667_10440498 3300025949 Bacteria 1325
261 Ga0207667_10554314 3300025949 Unclassified 1162
262 Ga0207651_10077834 3300025960 Bacteria 2376
263 Ga0207640_10007983 3300025981 Bacteria 5846
264 Ga0207640_10059994 3300025981 Bacteria 2512
265 Ga0207658_10274856 3300025986 Bacteria 1442
266 Ga0207658_10511700 3300025986 Bacteria 1071
267 Ga0207703_10009812 3300026035 Bacteria 7510
268 Ga0207703_10020963 3300026035 Bacteria 5114
269 Ga0207639_10035413 3300026041 Bacteria 3694
270 Ga0207639_10115259 3300026041 Unclassified 2197
271 Ga0207639_10381310 3300026041 Bacteria 1266
272 Ga0207639_10393780 3300026041 Bacteria 1247
273 Ga0207639_10812976 3300026041 Unclassified 871
274 Ga0207702_10000454 3300026078 Bacteria 46222
275 Ga0207702_10003743 3300026078 Bacteria 13744
276 Ga0207702_10008081 3300026078 Bacteria 8900
277 Ga0207702_10178585 3300026078 Bacteria 1953
278 Ga0207702_10312872 3300026078 Bacteria 1493
279 Ga0207641_10010173 3300026088 Bacteria 7736
280 Ga0207641_10064925 3300026088 Bacteria 3121
281 Ga0207648_10113274 3300026089 Bacteria 2382
282 Ga0207648_10184232 3300026089 Unclassified 1849
283 Ga0207676_10021891 3300026095 Bacteria 4695
284 Ga0207676_10034838 3300026095 Bacteria 3814
285 Ga0207676_10121768 3300026095 Bacteria 2202
286 Ga0207674_10000126 3300026116 Bacteria 88965
287 Ga0207674_10000449 3300026116 Bacteria 53656
288 Ga0207674_10011567 3300026116 Bacteria 9911
289 Ga0207674_10260011 3300026116 Bacteria 1683
290 Ga0207675_100007747 3300026118 Bacteria 10133
291 Ga0207683_10106959 3300026121 Bacteria 2502
292 Ga0207698_10000103 3300026142 Bacteria 53811
293 Ga0268266_10000683 3300028379 Bacteria 45837
294 Ga0268266_10001284 3300028379 Bacteria 30597
295 Ga0268266_10106530 3300028379 Bacteria 2478
296 Ga0268264_10048636 3300028381 Unclassified 3528
297 Ga0268264_10060761 3300028381 Bacteria 3168
298 Ga0268264_10256721 3300028381 Unclassified 1626
299 Ga0265324_10055503 3300029957 Bacteria 1358
300 Ga0265328_10011636 3300031239 Bacteria 3511
301 Ga0265329_10000376 3300031242 Bacteria 23627
302 Ga0265316_10000746 3300031344 Bacteria 35953
303 Ga0265316_10120907 3300031344 Bacteria 1978
304 Ga0265314_10000364 3300031711 Bacteria 62957
305 Ga0307414_10046638 3300032004 Bacteria 2976
306 Ga0373933_0122902 3300035724 Bacteria 1627
307 Ga0373937_0248173 3300036401 Bacteria 1678
308 Ga0373925_0537124 3300037068 Bacteria 961
309 Ga0395900_0300080 3300037418 Bacteria 1593
310 Ga0436364_0898323 3300037853 Bacteria 5070
311 Ga0436364_1486020 3300037853 Bacteria 5962
312 Ga0395901_1067753 3300038443 Unclassified 780
313 Ga0436365_1033588 3300039437 Bacteria 1163
314 Ga0436365_1081067 3300039437 Bacteria 1266
315 Ga0436360_0271351 3300039438 Bacteria 1716
316 Ga0436360_0341769 3300039438 Bacteria 1691
317 Ga0436360_1235401 3300039438 Bacteria 1796
318 Ga0436361_0197709 3300039447 Bacteria 17245
319 Ga0436361_0352553 3300039447 Bacteria 3271
320 Ga0436361_0694849 3300039447 Bacteria 18264
321 Ga0451577_0269851 3300042876 Bacteria 1541
322 Ga0451577_0514353 3300042876 Bacteria 1087
323 Ga0466961_0081993 3300044693 Bacteria 2041
324 Ga0466963_0012389 3300044694 Bacteria 5219
325 Ga0466964_0199047 3300044706 Bacteria 960
326 Ga0466959_0206338 3300045049 Bacteria 1367
327 Ga0466959_0380755 3300045049 Bacteria 960
328 Ga0466958_0324354 3300045836 Bacteria 990
329 Ga0466958_0404542 3300045836 Unclassified 881
330 Ga0466967_0237551 3300045976 Bacteria 1737
331 Ga0495592_0015099 3300046454 Bacteria 5866
332 Ga0495629_0127741 3300046459 Bacteria 1771
333 Ga0495651_0056404 3300046462 Bacteria 3018
334 Ga0495651_0252371 3300046462 Unclassified 1204
335 Ga0495650_0001584 3300046471 Bacteria 21335
336 Ga0495580_0002987 3300046472 Bacteria 14507
337 Ga0495582_0181995 3300046473 Unclassified 1198
338 Ga0495664_0011144 3300046477 Bacteria 5059
339 Ga0495664_0365607 3300046477 Bacteria 868
340 Ga0495608_0252957 3300046511 Unclassified 1098
341 Ga0495628_0495776 3300046516 Unclassified 882
342 Ga0495628_0505604 3300046516 Bacteria 872
343 Ga0495630_0158232 3300046517 Unclassified 1724
344 Ga0495643_0068919 3300046522 Bacteria 1861
345 Ga0495666_0108072 3300046526 Bacteria 1308
346 Ga0495652_0130827 3300046529 Unclassified 1987
347 Ga0495665_0210342 3300046531 Unclassified 1007
348 Ga0495640_0041680 3300046533 Unclassified 3207
349 Ga0495587_0186949 3300046536 Bacteria 1173
350 Ga0495645_0002692 3300046543 Bacteria 12053
351 Ga0495645_0028331 3300046543 Bacteria 4070
352 Ga0495645_0118277 3300046543 Bacteria 1868
353 Ga0495667_0031729 3300046559 Unclassified 3543
354 Ga0495625_0000149 3300046660 Bacteria 106557
355 Ga0495635_0010225 3300046663 Bacteria 6561
356 Ga0495599_0042438 3300046678 Unclassified 2854
357 Ga0495623_0070969 3300046679 Unclassified 2169
358 Ga0495623_0084178 3300046679 Unclassified 1963
359 Ga0495623_0088381 3300046679 Unclassified 1907
360 Ga0495646_0257647 3300046680 Bacteria 933
361 Ga0495613_0045679 3300046689 Bacteria 3239
362 Ga0495613_0158198 3300046689 Bacteria 1613
363 Ga0495600_0423812 3300046809 Unclassified 826
364 Ga0495604_0020976 3300047317 Bacteria 5214
365 Ga0495604_0376943 3300047317 Unclassified 938
366 Ga0495674_0409879 3300047319 Bacteria 1093
367 Ga0495674_0463416 3300047319 Bacteria 1017
368 Ga0495684_0039351 3300047471 Unclassified 3624
369 Ga0495602_0142579 3300048088 Bacteria 1895
370 Ga0495602_0304258 3300048088 Bacteria 1166
371 Ga0496100_0146493 3300048903 Bacteria 1680
372 Ga0496102_0144333 3300048905 Bacteria 2233
373 Ga0496104_0205843 3300048907 Bacteria 1879
374 Ga0496104_0221132 3300048907 Bacteria 1806
375 Ga0496107_0179751 3300048910 Bacteria 1571
376 Ga0496109_0532898 3300048912 Unclassified 1108
377 Ga0496112_0000712 3300048915 Bacteria 23067
378 Ga0496112_0046861 3300048915 Unclassified 4241
379 Ga0496115_0036088 3300048918 Bacteria 3913
380 Ga0496117_0155181 3300048920 Bacteria 1349
381 Ga0496121_0049030 3300048924 Bacteria 3587
382 Ga0496126_0001301 3300048929 Bacteria 39774
383 Ga0501034_0553921 3300049571 Bacteria 1059
384 Ga0501043_0585516 3300049579 Bacteria 826
385 Ga0501047_0192372 3300049581 Bacteria 1903
386 Ga0501047_0309007 3300049581 Bacteria 1422
387 Ga0501080_0089486 3300049742 Bacteria 2860
388 Ga0501044_0071694 3300049823 Bacteria 3522
389 nmdc:mga0qj67_145273_c1 3300050509 Bacteria 1923
390 nmdc:mga0qj67_93057_c1 3300050509 Bacteria 2423
391 nmdc:mga06r32_62083_c1 3300050510 Bacteria 3599
392 Ga0495601_0081188 3300053077 Unclassified 2081
393 Ga0495619_0427064 3300053085 Bacteria 914
394 Ga0495619_0566467 3300053085 Bacteria 779
395 Ga0466962_0030856 3300061719 Bacteria 2566
396 Ga0373925_0000253
397 rootH1_10111403
398 Ga0065712_10135457
399 Ga0070658_10004038
400 Ga0070658_10368108
401 Ga0070676_10118315
402 Ga0070683_100026728
403 Ga0070683_100058052
404 Ga0070683_100087678
405 Ga0070683_100171699
406 Ga0070683_100481856
407 Ga0070670_100002956
408 Ga0068869_100034772
409 Ga0070680_100002797
410 Ga0070680_100067775
411 Ga0070682_100323171
412 Ga0070660_100100572
413 Ga0070689_100021583
414 Ga0070661_100004454
415 Ga0070661_100069164
416 Ga0070671_100034809
417 Ga0070673_100074047
418 Ga0070673_100120872
419 Ga0070688_100014824
420 Ga0070659_100075360
421 Ga0070714_100260905
422 Ga0070713_100359097
423 Ga0070710_10023230
424 Ga0070711_100002676
425 Ga0070711_100109689
426 Ga0070678_100053590
427 Ga0070678_100497320
428 Ga0070662_100023796
429 Ga0070662_100090758
430 Ga0070681_10000496
431 Ga0070681_10020695
432 Ga0070681_10144444
433 Ga0068867_100021504
434 Ga0068867_100149858
435 Ga0070706_100018133
436 Ga0070679_100006647
437 Ga0070679_100037898
438 Ga0070679_100051960
439 Ga0070684_100017373
440 Ga0070684_100037109
441 Ga0070684_100049846
442 Ga0070684_100068832
443 Ga0068853_100048226
444 Ga0068853_100050745
445 Ga0068853_100062866
446 Ga0068853_100098406
447 Ga0070693_100013670
448 Ga0070665_100001171
449 Ga0070665_100027454
450 Ga0070665_100077079
451 Ga0070665_100082258
452 Ga0070665_100452074
453 Ga0068855_100001685
454 Ga0068855_100001812
455 Ga0068855_100012070
456 Ga0068855_100013065
457 Ga0068855_100018126
458 Ga0068855_100064698
459 Ga0068855_100087019
460 Ga0068855_100322886
461 Ga0068855_100968239
462 Ga0070664_100003374
463 Ga0070664_100135620
464 Ga0068857_100000136
465 Ga0068857_100003729
466 Ga0068857_100118844
467 Ga0068857_100159125
468 Ga0068854_100013790
469 Ga0068854_100037230
470 Ga0068854_100076668
471 Ga0068856_100002233
472 Ga0068856_100002345
473 Ga0068856_100008769
474 Ga0068856_100036213
475 Ga0068856_100376860
476 Ga0068856_100653610
477 Ga0068856_100897009
478 Ga0068852_100000124
479 Ga0068852_100023350
480 Ga0068852_100930553
481 Ga0068859_100003481
482 Ga0068859_100439380
483 Ga0068859_100744762
484 Ga0068864_100001130
485 Ga0068866_10023863
486 Ga0068861_100074054
487 Ga0068861_100267207
488 Ga0068870_10093203
489 Ga0068863_100021360
490 Ga0068863_100046779
491 Ga0068858_100012239
492 Ga0068858_100019182
493 Ga0068858_100055965
494 Ga0068860_100029134
495 Ga0081455_10012239
496 Ga0081540_1003734
497 Ga0070717_10000341
498 Ga0070717_10007093
499 Ga0070712_100000139
500 Ga0097621_100007910
501 Ga0097621_100008199
502 Ga0097621_100013352
503 Ga0068871_100001676
504 Ga0068871_100023430
505 Ga0068871_100113484
506 Ga0075428_100073893
507 Ga0075431_100018179
508 Ga0068865_100054105
509 Ga0068865_100071457
510 Ga0097620_100003481
511 Ga0097620_100439406
512 Ga0097620_100744572
513 Ga0105240_10002589
514 Ga0105240_10003814
515 Ga0105240_10007376
516 Ga0105240_10130586
517 Ga0105240_10181378
518 Ga0105240_10196872
519 Ga0105240_10238094
520 Ga0105245_10182258
521 Ga0105245_10243720
522 Ga0105241_10302891
523 Ga0105242_10177620
524 Ga0105242_10815072
525 Ga0105248_10017290
526 Ga0105248_10084643
527 Ga0105248_10307986
528 Ga0105237_10007959
529 Ga0105237_10148396
530 Ga0105238_10000720
531 Ga0105238_10003041
532 Ga0105238_10008117
533 Ga0105238_10147420
534 Ga0105238_10225112
535 Ga0105238_10229806
536 Ga0105238_10816893
537 Ga0105239_10034765
538 Ga0105239_10327480
539 Ga0105239_10618235
540 Ga0105239_11006009
541 Ga0105246_10050481
542 Ga0157373_10016554
543 Ga0157373_10025994
544 Ga0157370_10002425
545 Ga0157370_10007432
546 Ga0157370_10113674
547 Ga0157370_10451713
548 Ga0157369_10000134
549 Ga0157369_10005720
550 Ga0157369_10008243
551 Ga0157369_10012228
552 Ga0157369_10034177
553 Ga0157369_10339192
554 Ga0157369_10354706
555 Ga0157374_10000183
556 Ga0157374_10004050
557 Ga0157374_10045916
558 Ga0157374_10115147
559 Ga0157374_10276538
560 Ga0157378_10000107
561 Ga0157378_10000641
562 Ga0157378_10008381
563 Ga0157378_10011621
564 Ga0157372_10000153
565 Ga0157372_10000865
566 Ga0157372_10001235
567 Ga0157372_10001994
568 Ga0157372_10049537
569 Ga0157372_10066553
570 Ga0157372_10068422
571 Ga0157372_10212099
572 Ga0157372_10216070
573 Ga0157372_10387557
574 Ga0157372_10797503
575 Ga0163163_10157859
576 Ga0157379_10220076
577 Ga0157376_10067036
578 Ga0157376_10113480
579 Ga0157376_10135486
580 Ga0157376_10279364
581 Ga0157376_10432478
582 Ga0157376_10557015
583 Ga0213872_10004069
584 Ga0213872_10005311
585 Ga0213872_10058087
586 Ga0213875_10017186
587 Ga0213875_10158257
588 Ga0213871_10065738
589 Ga0207692_10037574
590 Ga0207642_10165247
591 Ga0207642_10186732
592 Ga0207647_10066016
593 Ga0207647_10162329
594 Ga0207705_10042217
595 Ga0207705_10260314
596 Ga0207684_10040417
597 Ga0207654_10129316
598 Ga0207654_10395953
599 Ga0207707_10000664
600 Ga0207707_10134267
601 Ga0207695_10000105
602 Ga0207695_10004545
603 Ga0207695_10047795
604 Ga0207695_10085305
605 Ga0207695_10101190
606 Ga0207671_10007652
607 Ga0207671_10171574
608 Ga0207693_10004438
609 Ga0207693_10310540
610 Ga0207693_10474120
611 Ga0207663_10015144
612 Ga0207660_10085159
613 Ga0207660_10125776
614 Ga0207657_10111014
615 Ga0207649_10018552
616 Ga0207652_10004953
617 Ga0207652_10052896
618 Ga0207652_10101701
619 Ga0207652_10282661
620 Ga0207694_10015141
621 Ga0207694_10027314
622 Ga0207694_10039519
623 Ga0207694_10105342
624 Ga0207694_10108352
625 Ga0207650_10024637
626 Ga0207700_10310418
627 Ga0207664_10112521
628 Ga0207664_10137006
629 Ga0207644_10029052
630 Ga0207690_10036309
631 Ga0207706_10043227
632 Ga0207686_10151688
633 Ga0207670_10023435
634 Ga0207704_10018458
635 Ga0207704_10025591
636 Ga0207665_10044014
637 Ga0207711_10023135
638 Ga0207711_10082568
639 Ga0207711_10423816
640 Ga0207689_10018358
641 Ga0207661_10018089
642 Ga0207661_10070675
643 Ga0207661_10081523
644 Ga0207661_10109138
645 Ga0207679_10180741
646 Ga0207679_10201419
647 Ga0207667_10000245
648 Ga0207667_10007320
649 Ga0207667_10013317
650 Ga0207667_10028833
651 Ga0207667_10085802
652 Ga0207667_10158077
653 Ga0207667_10221136
654 Ga0207667_10301762
655 Ga0207667_10440498
656 Ga0207667_10554314
657 Ga0207651_10077834
658 Ga0207640_10007983
659 Ga0207640_10059994
660 Ga0207658_10274856
661 Ga0207658_10511700
662 Ga0207703_10009812
663 Ga0207703_10020963
664 Ga0207639_10035413
665 Ga0207639_10115259
666 Ga0207639_10381310
667 Ga0207639_10393780
668 Ga0207639_10812976
669 Ga0207702_10000454
670 Ga0207702_10003743
671 Ga0207702_10008081
672 Ga0207702_10178585
673 Ga0207702_10312872
674 Ga0207641_10010173
675 Ga0207641_10064925
676 Ga0207648_10113274
677 Ga0207648_10184232
678 Ga0207676_10021891
679 Ga0207676_10034838
680 Ga0207676_10121768
681 Ga0207674_10000126
682 Ga0207674_10000449
683 Ga0207674_10011567
684 Ga0207674_10260011
685 Ga0207675_100007747
686 Ga0207683_10106959
687 Ga0207698_10000103
688 Ga0268266_10000683
689 Ga0268266_10001284
690 Ga0268266_10106530
691 Ga0268264_10048636
692 Ga0268264_10060761
693 Ga0268264_10256721
694 Ga0265324_10055503
695 Ga0265328_10011636
696 Ga0265329_10000376
697 Ga0265316_10000746
698 Ga0265316_10120907
699 Ga0265314_10000364
700 Ga0307414_10046638
701 Ga0373933_0122902
702 Ga0373937_0248173
703 Ga0373925_0537124
704 Ga0395900_0300080
705 Ga0436364_0898323
706 Ga0436364_1486020
707 Ga0395901_1067753
708 Ga0436365_1033588
709 Ga0436365_1081067
710 Ga0436360_0271351
711 Ga0436360_0341769
712 Ga0436360_1235401
713 Ga0436361_0197709
714 Ga0436361_0352553
715 Ga0436361_0694849
716 Ga0451577_0269851
717 Ga0451577_0514353
718 Ga0466961_0081993
719 Ga0466963_0012389
720 Ga0466964_0199047
721 Ga0466959_0206338
722 Ga0466959_0380755
723 Ga0466958_0324354
724 Ga0466958_0404542
725 Ga0466967_0237551
726 Ga0495592_0015099
727 Ga0495629_0127741
728 Ga0495651_0056404
729 Ga0495651_0252371
730 Ga0495650_0001584
731 Ga0495580_0002987
732 Ga0495582_0181995
733 Ga0495664_0011144
734 Ga0495664_0365607
735 Ga0495608_0252957
736 Ga0495628_0495776
737 Ga0495628_0505604
738 Ga0495630_0158232
739 Ga0495643_0068919
740 Ga0495666_0108072
741 Ga0495652_0130827
742 Ga0495665_0210342
743 Ga0495640_0041680
744 Ga0495587_0186949
745 Ga0495645_0002692
746 Ga0495645_0028331
747 Ga0495645_0118277
748 Ga0495667_0031729
749 Ga0495625_0000149
750 Ga0495635_0010225
751 Ga0495599_0042438
752 Ga0495623_0070969
753 Ga0495623_0084178
754 Ga0495623_0088381
755 Ga0495646_0257647
756 Ga0495613_0045679
757 Ga0495613_0158198
758 Ga0495600_0423812
759 Ga0495604_0020976
760 Ga0495604_0376943
761 Ga0495674_0409879
762 Ga0495674_0463416
763 Ga0495684_0039351
764 Ga0495602_0142579
765 Ga0495602_0304258
766 Ga0496100_0146493
767 Ga0496102_0144333
768 Ga0496104_0205843
769 Ga0496104_0221132
770 Ga0496107_0179751
771 Ga0496109_0532898
772 Ga0496112_0000712
773 Ga0496112_0046861
774 Ga0496115_0036088
775 Ga0496117_0155181
776 Ga0496121_0049030
777 Ga0496126_0001301
778 Ga0501034_0553921
779 Ga0501043_0585516
780 Ga0501047_0192372
781 Ga0501047_0309007
782 Ga0501080_0089486
783 Ga0501044_0071694
784 nmdc:mga0qj67_145273_c1
785 nmdc:mga0qj67_93057_c1
786 nmdc:mga06r32_62083_c1
787 Ga0495601_0081188
788 Ga0495619_0427064
789 Ga0495619_0566467
790 Ga0466962_0030856

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

12

203

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

18

250

0.96

PF08659

KR

KR domain

13

183

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ew8-assembly1.cif.gz_C crystal structure of the (s)-specific 1-phenylethanol dehydrogenase of the denitrifying bacterium strain ebn1 0.9713 5 248
4bmn-assembly1.cif.gz_B apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 0.9704 4 251
2ewm-assembly1.cif.gz_A-2 crystal structure of the (s)-specific 1-phenylethanol dehydrogenase of the denitrifying bacterium strain ebn1 0.9699 5 248
1q7c-assembly1.cif.gz_A the structure of betaketoacyl-[acp] reductase y151f mutant in complex with nadph fragment 0.9694 4 248
4nbv-assembly1.cif.gz_A crystal structure of fabg from cupriavidus taiwanensis 0.9689 3 247
ID Description Score Start End Superfamily
4hsyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9746 5 249 3.40.50.720
af_P0AET8_1_255_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9727 4 247 3.40.50.720
3ftpC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9688 5 248 3.40.50.720
3grpC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9645 4 247 3.40.50.720
af_P76633_10_261_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9634 4 251 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4V2AIP9-F1-model_v4 deleted 0.987 3 73
AF-A0A382JBS9-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9817 3 83 GO:0016491
AF-A0A7C7JRJ5-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9815 3 144
AF-X1HCU3-F1-model_v4 Uncharacterized protein 0.9797 5 92
AF-A0A838DWV4-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9795 5 70

Map