metagRoot

F433239

General Info

Members	Datasets	Scaffolds	Average Seq Length
395	263	388	134

Family's Representative Sequence

Representative Sequence	3300026089\|Ga0207648_10357526\|Ga0207648_103575262
Length	140
Sequence	MRYMVMHYQTQDMEDGVLPSPEQQAAIGQYMQEAAMAGVLLSGEGVAPSSAGARVEVTDENVRVIDGPFAEAKELIAGFWIFNVQSKQEAIDWVRRCPNPHDGDAEIEIRQIFEDTDFADVSTPELQAAEARLREQLSKK

Samples

	Sample ID	Description	Type	Environment
1	2511231008	Pseudomonas sp. GM21	Isolate	Nodule
2	2623620443	Pseudomonas sp. DR 5-09	Isolate	Unclassified
3	2919063839	Pseudomonas pharyngis 1098	Isolate	Rhizosphere
4	2919456309	Pseudomonas sp. 3296	Isolate	Rhizosphere
5	3007718800	Pseudomonas fluorescens BW11P2	Isolate	Rhizosphere
6	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
7	3300002771	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB	Metagenome	Endosphere
8	3300002772	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS	Metagenome	Endosphere
9	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
10	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
11	3300003911	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
12	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
13	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
14	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
15	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
16	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
17	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
18	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
19	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
20	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
21	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
22	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
23	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
24	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
25	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
26	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
27	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
28	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
29	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
30	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
31	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
32	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
33	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
34	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
35	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
36	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
37	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
38	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
39	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
40	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
41	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
42	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
43	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
44	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
45	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
46	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
47	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
48	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
49	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
50	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
51	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
52	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
53	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
54	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
55	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
56	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
57	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
58	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
59	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
60	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
61	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
62	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
63	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
64	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
65	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
66	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
67	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
68	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
69	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
70	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
71	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
72	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
73	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
74	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
75	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
76	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
77	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
78	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
79	3300012478	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610	Metagenome	Rhizosphere
80	3300012498	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410	Metagenome	Rhizosphere
81	3300012505	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610	Metagenome	Rhizosphere
82	3300012507	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610	Metagenome	Rhizosphere
83	3300012513	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510	Metagenome	Rhizosphere
84	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
85	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
86	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
87	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
88	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
89	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
90	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
91	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
92	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
93	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
94	3300020069	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
95	3300025207	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
96	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
97	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
98	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
99	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300027360	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
131	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
135	3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Metagenome	Rhizosphere
136	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
137	3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Metagenome	Unclassified
138	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
139	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
140	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
141	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
142	3300031889	Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO	Metagenome	Rhizosphere
143	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
144	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
145	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
146	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
147	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
148	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
149	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
150	3300038705	Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1	Metagenome	Unclassified
151	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
152	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
153	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
154	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
155	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
156	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
157	3300042137	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519	Metagenome	Rhizosphere
158	3300042138	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379	Metagenome	Rhizosphere
159	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
160	3300042993	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372	Metagenome	Rhizosphere
161	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
162	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
163	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
164	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
165	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
166	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
167	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
168	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
169	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
170	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
171	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
172	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
173	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
174	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
175	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
176	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
177	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
178	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
179	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
180	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
181	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
182	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
183	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
184	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
185	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
186	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
187	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
188	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
189	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
190	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
191	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
192	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
193	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
194	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
195	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
196	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
197	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
198	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
199	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
200	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
201	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
202	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
203	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
204	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
205	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
206	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
207	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
208	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
209	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
210	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
211	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
212	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
213	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
214	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
215	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
216	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
217	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
218	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
219	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
220	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
221	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
222	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
223	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
224	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
225	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
226	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
227	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
228	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
229	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
230	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
231	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
232	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
233	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
234	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
235	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
236	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
237	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
238	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
239	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
240	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
241	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
242	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
243	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
244	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
245	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
246	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
247	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
248	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
249	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
250	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
251	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
252	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
253	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
254	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
255	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
256	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
257	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
258	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
259	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
260	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
261	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
262	8056125926	Pseudomonas azerbaijanorientalis SWRI123	Isolate	Rhizosphere
263	8056172158	Pseudomonas ekonensis COR58	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	97.97
Metatranscriptomes	0.25
Isolates	1.77

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	2.03
Nodule	0.25
Rhizoplane	4.56
Rhizosphere	90.63
Stem	0
Stem Tuber	0
Unclassified	2.53

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25162J39368_1001823	3300002737	Bacteria	10003
2	JGI25163J39215_1000884	3300002771	Bacteria	6954
3	JGI25164J39214_1000896	3300002772	Bacteria	10003
4	JGI25406J46586_10034652	3300003203	Bacteria	1850
5	JGI25406J46586_10110070	3300003203	Bacteria	816
6	JGI25165J46597_1001683	3300003214	Bacteria	10003
7	JGI25405J52794_10017984	3300003911	Bacteria	1409
8	Ga0065714_10005181	3300005288	Bacteria	8033
9	Ga0065714_10066395	3300005288	Bacteria	6941
10	Ga0065714_10165892	3300005288	Bacteria	1020
11	Ga0065715_10120391	3300005293	Bacteria	2259
12	Ga0070670_100051859	3300005331	Bacteria	3522
13	Ga0070670_100723504	3300005331	Bacteria	896
14	Ga0070677_10734239	3300005333	Bacteria	559
15	Ga0070682_100055016	3300005337	Bacteria	2498
16	Ga0070660_100448485	3300005339	Bacteria	1070
17	Ga0070692_10212987	3300005345	Bacteria	1138
18	Ga0070692_11175177	3300005345	Bacteria	545
19	Ga0070668_100019652	3300005347	Bacteria	5086
20	Ga0070668_100253032	3300005347	Bacteria	1463
21	Ga0070669_100125550	3300005353	Bacteria	1963
22	Ga0070669_100174853	3300005353	Bacteria	1676
23	Ga0070675_100932697	3300005354	Bacteria	796
24	Ga0070674_100295135	3300005356	Bacteria	1290
25	Ga0070674_101444268	3300005356	Bacteria	617
26	Ga0070673_100845862	3300005364	Unclassified	846
27	Ga0070659_101213966	3300005366	Bacteria	667
28	Ga0070703_10080956	3300005406	Bacteria	1106
29	Ga0070709_11349433	3300005434	Bacteria	576
30	Ga0070705_100040786	3300005440	Bacteria	2642
31	Ga0070705_100044764	3300005440	Bacteria	2543
32	Ga0070694_100854516	3300005444	Bacteria	749
33	Ga0070694_101097890	3300005444	Bacteria	663
34	Ga0070662_100009739	3300005457	Bacteria	6291
35	Ga0068867_100282764	3300005459	Bacteria	1361
36	Ga0068867_101561508	3300005459	Bacteria	616
37	Ga0070685_11338121	3300005466	Bacteria	548
38	Ga0070706_100113618	3300005467	Bacteria	2522
39	Ga0070698_100492836	3300005471	Bacteria	1163
40	Ga0070698_100749371	3300005471	Bacteria	920
41	Ga0068853_100181257	3300005539	Bacteria	1910
42	Ga0070695_100098102	3300005545	Bacteria	1968
43	Ga0070696_100324302	3300005546	Bacteria	1186
44	Ga0070693_100584641	3300005547	Bacteria	804
45	Ga0070704_100041334	3300005549	Bacteria	3181
46	Ga0070704_100134618	3300005549	Bacteria	1921
47	Ga0068855_100952629	3300005563	Bacteria	904
48	Ga0068854_100299169	3300005578	Bacteria	1301
49	Ga0068852_101163606	3300005616	Bacteria	792
50	Ga0068859_100694381	3300005617	Bacteria	1108
51	Ga0068859_100818698	3300005617	Bacteria	1018
52	Ga0068859_101033650	3300005617	Bacteria	903
53	Ga0068866_10007581	3300005718	Bacteria	4549
54	Ga0068866_10960139	3300005718	Unclassified	605
55	Ga0068861_100125910	3300005719	Bacteria	2073
56	Ga0068861_100321974	3300005719	Bacteria	1347
57	Ga0068870_10365826	3300005840	Bacteria	929
58	Ga0068860_100093924	3300005843	Bacteria	2859
59	Ga0068862_102341136	3300005844	Bacteria	546
60	Ga0081455_10001304	3300005937	Bacteria	30948
61	Ga0081539_10000780	3300005985	Bacteria	62088
62	Ga0081539_10002007	3300005985	Bacteria	30812
63	Ga0070717_10382851	3300006028	Bacteria	1262
64	Ga0075432_10002866	3300006058	Bacteria	5795
65	Ga0075432_10256313	3300006058	Bacteria	712
66	Ga0097621_101273127	3300006237	Bacteria	694
67	Ga0075428_100008511	3300006844	Bacteria	11381
68	Ga0075428_100046051	3300006844	Bacteria	4792
69	Ga0075430_100008356	3300006846	Bacteria	8742
70	Ga0075431_100027511	3300006847	Bacteria	5836
71	Ga0075431_100124161	3300006847	Bacteria	2663
72	Ga0075433_10036318	3300006852	Bacteria	4244
73	Ga0075433_10138459	3300006852	Bacteria	2163
74	Ga0075433_10396860	3300006852	Bacteria	1217
75	Ga0075434_100094459	3300006871	Bacteria	2995
76	Ga0075434_101220526	3300006871	Bacteria	764
77	Ga0075429_100015111	3300006880	Bacteria	6692
78	Ga0075429_100039443	3300006880	Bacteria	4110
79	Ga0075429_100125606	3300006880	Bacteria	2243
80	Ga0068865_100034905	3300006881	Bacteria	3378
81	Ga0068865_100053024	3300006881	Bacteria	2813
82	Ga0075436_100079814	3300006914	Bacteria	2267
83	Ga0097620_100694369	3300006931	Bacteria	1108
84	Ga0097620_100818506	3300006931	Bacteria	1018
85	Ga0097620_101033683	3300006931	Bacteria	903
86	Ga0075435_100007559	3300007076	Bacteria	7759
87	Ga0099795_10236402	3300007788	Bacteria	783
88	Ga0105251_10154516	3300009011	Bacteria	1035
89	Ga0105250_10239010	3300009092	Bacteria	774
90	Ga0111539_10020355	3300009094	Bacteria	8172
91	Ga0105245_10014834	3300009098	Bacteria	6786
92	Ga0105245_10026402	3300009098	Bacteria	5112
93	Ga0105245_10408373	3300009098	Bacteria	1359
94	Ga0105247_10224496	3300009101	Bacteria	1273
95	Ga0114129_10028871	3300009147	Bacteria	7860
96	Ga0114129_10085547	3300009147	Bacteria	4374
97	Ga0114129_11035447	3300009147	Bacteria	1031
98	Ga0105243_10005951	3300009148	Bacteria	9448
99	Ga0105243_10031793	3300009148	Bacteria	4072
100	Ga0105243_10380561	3300009148	Bacteria	1305
101	Ga0105241_11623142	3300009174	Bacteria	626
102	Ga0105242_10104482	3300009176	Bacteria	2405
103	Ga0105242_10192252	3300009176	Bacteria	1808
104	Ga0105242_11950922	3300009176	Bacteria	628
105	Ga0105242_11968204	3300009176	Bacteria	626
106	Ga0105248_10152076	3300009177	Bacteria	2611
107	Ga0105248_10531767	3300009177	Bacteria	1326
108	Ga0105238_10531213	3300009551	Bacteria	1179
109	Ga0105238_11613036	3300009551	Bacteria	679
110	Ga0105249_10030802	3300009553	Bacteria	4849
111	Ga0105249_10231577	3300009553	Bacteria	1822
112	Ga0105249_10706458	3300009553	Bacteria	1068
113	Ga0099796_10531396	3300010159	Bacteria	528
114	Ga0105239_11990792	3300010375	Bacteria	674
115	Ga0105246_10058547	3300011119	Bacteria	2670
116	Ga0105246_11575278	3300011119	Bacteria	620
117	Ga0157328_1001483	3300012478	Bacteria	1015
118	Ga0157345_1018264	3300012498	Bacteria	690
119	Ga0157339_1004897	3300012505	Bacteria	1036
120	Ga0157342_1024205	3300012507	Bacteria	726
121	Ga0157326_1004818	3300012513	Bacteria	1421
122	Ga0157371_10258210	3300013102	Bacteria	1256
123	Ga0157370_10003251	3300013104	Bacteria	19150
124	Ga0157370_10467390	3300013104	Bacteria	1159
125	Ga0157374_12097803	3300013296	Bacteria	592
126	Ga0157378_11576929	3300013297	Bacteria	702
127	Ga0163162_10071798	3300013306	Bacteria	3515
128	Ga0163162_10174023	3300013306	Bacteria	2277
129	Ga0163162_10219354	3300013306	Bacteria	2032
130	Ga0163162_10382231	3300013306	Bacteria	1541
131	Ga0163162_11293873	3300013306	Bacteria	828
132	Ga0163162_11803548	3300013306	Bacteria	699
133	Ga0157372_10013749	3300013307	Bacteria	8649
134	Ga0157372_10196710	3300013307	Bacteria	2335
135	Ga0157372_10853759	3300013307	Bacteria	1057
136	Ga0157375_10123647	3300013308	Bacteria	2700
137	Ga0157375_10349074	3300013308	Bacteria	1645
138	Ga0157375_10741524	3300013308	Bacteria	1134
139	Ga0157375_11957472	3300013308	Bacteria	696
140	Ga0182008_10045609	3300014497	Bacteria	2179
141	Ga0182005_1001729	3300015265	Bacteria	8435
142	Ga0163161_10005787	3300017792	Bacteria	8570
143	Ga0163161_10033938	3300017792	Bacteria	3649
144	Ga0163161_10057656	3300017792	Bacteria	2822
145	Ga0163161_10089824	3300017792	Bacteria	2273
146	Ga0163161_10149902	3300017792	Bacteria	1772
147	Ga0163161_10380303	3300017792	Bacteria	1128
148	Ga0197907_11384792	3300020069	Bacteria	695
149	Ga0209760_100061	3300025207	Bacteria	94682
150	Ga0207427_101201	3300025231	Bacteria	10055
151	Ga0209437_100982	3300025233	Bacteria	10055
152	Ga0209233_1000008	3300025261	Bacteria	1356712
153	Ga0207713_1014109	3300025735	Bacteria	4170
154	Ga0207642_10124933	3300025899	Bacteria	1333
155	Ga0207642_10603019	3300025899	Bacteria	684
156	Ga0207688_10038082	3300025901	Bacteria	2668
157	Ga0207688_10101599	3300025901	Bacteria	1661
158	Ga0207680_10762796	3300025903	Bacteria	693
159	Ga0207643_10542348	3300025908	Bacteria	746
160	Ga0207684_10166225	3300025910	Bacteria	1901
161	Ga0207654_11228455	3300025911	Bacteria	546
162	Ga0207646_10368559	3300025922	Bacteria	1298
163	Ga0207681_10163729	3300025923	Bacteria	1679
164	Ga0207681_10236918	3300025923	Bacteria	1419
165	Ga0207650_10033162	3300025925	Bacteria	3738
166	Ga0207687_10083243	3300025927	Bacteria	2316
167	Ga0207687_10509923	3300025927	Bacteria	1005
168	Ga0207687_10630175	3300025927	Bacteria	906
169	Ga0207664_10472607	3300025929	Bacteria	1121
170	Ga0207690_10177067	3300025932	Bacteria	1603
171	Ga0207706_10009075	3300025933	Bacteria	9148
172	Ga0207706_10033864	3300025933	Bacteria	4547
173	Ga0207686_10033388	3300025934	Bacteria	3072
174	Ga0207686_11189718	3300025934	Bacteria	624
175	Ga0207686_11226741	3300025934	Bacteria	614
176	Ga0207709_10223626	3300025935	Bacteria	1359
177	Ga0207669_10221180	3300025937	Bacteria	1390
178	Ga0207669_11514419	3300025937	Bacteria	572
179	Ga0207704_10243131	3300025938	Bacteria	1346
180	Ga0207704_11187509	3300025938	Bacteria	650
181	Ga0207651_11497911	3300025960	Unclassified	608
182	Ga0207712_10106900	3300025961	Bacteria	2091
183	Ga0207712_10394053	3300025961	Bacteria	1162
184	Ga0207712_10495275	3300025961	Bacteria	1044
185	Ga0207668_10021777	3300025972	Bacteria	4092
186	Ga0207668_10076539	3300025972	Bacteria	2410
187	Ga0207668_11117770	3300025972	Bacteria	707
188	Ga0207640_11875196	3300025981	Bacteria	542
189	Ga0207658_10249093	3300025986	Bacteria	1509
190	Ga0207639_10144276	3300026041	Bacteria	1987
191	Ga0207708_10774811	3300026075	Bacteria	824
192	Ga0207708_10917127	3300026075	Bacteria	759
193	Ga0207648_10236881	3300026089	Bacteria	1624
194	Ga0207648_10251534	3300026089	Bacteria	1575
195	Ga0207648_10357526	3300026089	Bacteria	1317
196	Ga0207676_10952695	3300026095	Bacteria	844
197	Ga0207676_11123956	3300026095	Bacteria	777
198	Ga0207675_100047035	3300026118	Bacteria	4030
199	Ga0207675_100141291	3300026118	Bacteria	2287
200	Ga0207675_100646145	3300026118	Bacteria	1064
201	Ga0207683_10256843	3300026121	Bacteria	1595
202	Ga0207698_10634275	3300026142	Bacteria	1057
203	Ga0209969_1032175	3300027360	Bacteria	803
204	Ga0207428_10003686	3300027907	Bacteria	14727
205	Ga0207428_10008426	3300027907	Bacteria	9309
206	Ga0268266_11581954	3300028379	Bacteria	631
207	Ga0268265_11563164	3300028380	Bacteria	664
208	Ga0268264_10511791	3300028381	Bacteria	1172
209	Ga0307511_10082470	3300030521	Bacteria	2248
210	Ga0265329_10262664	3300031242	Bacteria	578
211	Ga0307408_100600892	3300031548	Bacteria	977
212	Ga0307514_10420758	3300031649	Bacteria	671
213	Ga0265314_10354639	3300031711	Bacteria	806
214	Ga0307405_10494188	3300031731	Bacteria	979
215	Ga0307413_10097374	3300031824	Bacteria	1934
216	Ga0307410_10062300	3300031852	Bacteria	2555
217	Ga0326468_10000079	3300031889	Bacteria	8182
218	Ga0307406_10064574	3300031901	Bacteria	2376
219	Ga0307407_10054525	3300031903	Bacteria	2306
220	Ga0307409_101306372	3300031995	Bacteria	750
221	Ga0307416_102376268	3300032002	Bacteria	630
222	Ga0307411_10027823	3300032005	Bacteria	3428
223	Ga0307415_100384080	3300032126	Bacteria	1193
224	Ga0373960_0267794	3300035121	Bacteria	626
225	Ga0237819_00724	3300038705	Bacteria	10620
226	Ga0436365_0169870	3300039437	Bacteria	881
227	Ga0439466_0017818	3300041411	Bacteria	2554
228	Ga0451791_0631523	3300041451	Bacteria	915
229	Ga0451807_1693714	3300041486	Bacteria	513
230	Ga0439432_076593	3300042006	Bacteria	1016
231	Ga0439452_002538	3300042010	Bacteria	6719
232	Ga0450902_000833	3300042137	Bacteria	4012
233	Ga0450903_001812	3300042138	Bacteria	3902
234	Ga0439460_0001218	3300042461	Bacteria	6066
235	Ga0439440_0186786	3300042993	Bacteria	609
236	Ga0451576_0291044	3300045051	Bacteria	1708
237	Ga0466967_0185538	3300045976	Bacteria	1964
238	Ga0495617_028829	3300046452	Bacteria	1866
239	Ga0495617_103468	3300046452	Bacteria	924
240	Ga0495617_137606	3300046452	Bacteria	781
241	Ga0495603_0007417	3300046455	Bacteria	6595
242	Ga0495591_048432	3300046458	Bacteria	1172
243	Ga0495650_0029672	3300046471	Bacteria	2489
244	Ga0495582_0047477	3300046473	Bacteria	2365
245	Ga0495605_0370487	3300046474	Bacteria	598
246	Ga0495639_0019540	3300046475	Bacteria	2958
247	Ga0495662_0197133	3300046476	Bacteria	993
248	Ga0495664_0624897	3300046477	Bacteria	639
249	Ga0495584_0000379	3300046491	Bacteria	30633
250	Ga0495584_0001025	3300046491	Bacteria	17444
251	Ga0495584_0081715	3300046491	Bacteria	1626
252	Ga0495584_0152220	3300046491	Bacteria	1175
253	Ga0495585_0001220	3300046492	Bacteria	20826
254	Ga0495585_0014834	3300046492	Bacteria	4532
255	Ga0495585_0048175	3300046492	Bacteria	2370
256	Ga0495594_0002990	3300046499	Bacteria	8761
257	Ga0495607_0001050	3300046501	Bacteria	25225
258	Ga0495607_0052244	3300046501	Bacteria	2368
259	Ga0495607_0095695	3300046501	Bacteria	1600
260	Ga0495607_0117977	3300046501	Bacteria	1397
261	Ga0495583_0020401	3300046506	Bacteria	3433
262	Ga0495606_0034944	3300046507	Bacteria	3442
263	Ga0495610_0001941	3300046512	Bacteria	17800
264	Ga0495616_0010336	3300046513	Bacteria	5407
265	Ga0495616_0040278	3300046513	Bacteria	2388
266	Ga0495620_0006126	3300046515	Bacteria	6639
267	Ga0495620_0246689	3300046515	Bacteria	681
268	Ga0495628_0635702	3300046516	Bacteria	759
269	Ga0495630_0004901	3300046517	Bacteria	9402
270	Ga0495631_0000014	3300046518	Bacteria	109076
271	Ga0495632_0008007	3300046519	Bacteria	6558
272	Ga0495637_0006624	3300046520	Bacteria	5796
273	Ga0495637_0007000	3300046520	Bacteria	5617
274	Ga0495637_0007064	3300046520	Bacteria	5592
275	Ga0495637_0014637	3300046520	Bacteria	3696
276	Ga0495637_0265288	3300046520	Bacteria	615
277	Ga0495648_0023218	3300046524	Bacteria	4253
278	Ga0495648_0201724	3300046524	Bacteria	995
279	Ga0495666_0005975	3300046526	Bacteria	6134
280	Ga0495654_0008880	3300046530	Bacteria	5526
281	Ga0495654_0065059	3300046530	Bacteria	1741
282	Ga0495665_0465692	3300046531	Bacteria	638
283	Ga0495587_0022055	3300046536	Bacteria	3923
284	Ga0495609_0005628	3300046538	Bacteria	6534
285	Ga0495645_0369815	3300046543	Bacteria	919
286	Ga0495622_0010471	3300046557	Bacteria	4283
287	Ga0495622_0042793	3300046557	Bacteria	2105
288	Ga0495622_0144772	3300046557	Bacteria	1077
289	Ga0495633_0003382	3300046558	Bacteria	10672
290	Ga0495633_0111312	3300046558	Bacteria	1269
291	Ga0495668_0621326	3300046616	Bacteria	597
292	Ga0495634_0472395	3300046642	Bacteria	738
293	Ga0495625_0001220	3300046660	Bacteria	32631
294	Ga0495635_0004614	3300046663	Bacteria	9558
295	Ga0495661_0015638	3300046665	Bacteria	5060
296	Ga0495588_0054715	3300046674	Bacteria	2059
297	Ga0495588_0072550	3300046674	Bacteria	1791
298	Ga0495588_0157967	3300046674	Bacteria	1199
299	Ga0495599_0635766	3300046678	Bacteria	619
300	Ga0495646_0002334	3300046680	Bacteria	11630
301	Ga0495658_0608607	3300046683	Bacteria	700
302	Ga0495613_0001043	3300046689	Bacteria	21118
303	Ga0495613_0184506	3300046689	Bacteria	1476
304	Ga0495670_0005385	3300046691	Bacteria	6287
305	Ga0495670_0072064	3300046691	Bacteria	1750
306	Ga0495670_0143017	3300046691	Bacteria	1252
307	Ga0495671_0024922	3300046692	Bacteria	3112
308	Ga0495671_0025346	3300046692	Bacteria	3083
309	Ga0495671_0182147	3300046692	Bacteria	1020
310	Ga0495671_0577857	3300046692	Bacteria	535
311	Ga0495649_0102113	3300046694	Bacteria	1523
312	Ga0495649_0409297	3300046694	Bacteria	680
313	Ga0495589_0009956	3300046794	Bacteria	4939
314	Ga0495589_0012823	3300046794	Bacteria	4332
315	Ga0495600_0021499	3300046809	Bacteria	4132
316	Ga0495660_0008929	3300046810	Bacteria	5855
317	Ga0495660_0111936	3300046810	Bacteria	1392
318	Ga0495660_0162986	3300046810	Bacteria	1092
319	Ga0495604_0008768	3300047317	Bacteria	7990
320	Ga0495680_0031807	3300047322	Bacteria	4289
321	Ga0495680_0554526	3300047322	Bacteria	774
322	Ga0495683_0000057	3300047323	Bacteria	118509
323	Ga0495683_0131872	3300047323	Bacteria	1178
324	Ga0495677_0121149	3300047445	Bacteria	998
325	Ga0495673_0000725	3300047469	Bacteria	31615
326	Ga0495673_0001305	3300047469	Bacteria	20288
327	Ga0495673_0057133	3300047469	Bacteria	1685
328	Ga0495681_0005210	3300047470	Bacteria	8734
329	Ga0495593_0163611	3300047673	Bacteria	1123
330	Ga0495602_0814674	3300048088	Bacteria	626
331	Ga0496101_0829493	3300048904	Bacteria	729
332	Ga0496102_0036029	3300048905	Bacteria	4456
333	Ga0496103_0980476	3300048906	Unclassified	527
334	Ga0496104_0006937	3300048907	Bacteria	9991
335	Ga0496105_0003935	3300048908	Bacteria	11108
336	Ga0496108_0009012	3300048911	Bacteria	8082
337	Ga0496109_0001281	3300048912	Bacteria	20865
338	Ga0496109_0338357	3300048912	Bacteria	1421
339	Ga0496110_0000336	3300048913	Bacteria	31385
340	Ga0496110_0135063	3300048913	Bacteria	2229
341	Ga0496111_0000281	3300048914	Bacteria	24645
342	Ga0496112_0203897	3300048915	Bacteria	1936
343	Ga0496113_0027330	3300048916	Bacteria	4090
344	Ga0496114_0029418	3300048917	Bacteria	4515
345	Ga0496114_0139612	3300048917	Bacteria	2097
346	Ga0496115_0023209	3300048918	Bacteria	4814
347	Ga0496117_0322034	3300048920	Bacteria	810
348	Ga0496118_0087698	3300048921	Bacteria	2157
349	Ga0496121_0128727	3300048924	Bacteria	1899
350	Ga0496125_0008758	3300048928	Bacteria	10525
351	Ga0496125_0012438	3300048928	Bacteria	8449
352	Ga0501032_0471522	3300049569	Bacteria	803
353	Ga0501036_0171834	3300049572	Bacteria	1826
354	Ga0501036_1737468	3300049572	Bacteria	502
355	Ga0501039_0174830	3300049575	Bacteria	1689
356	Ga0501040_0211409	3300049576	Bacteria	1379
357	Ga0501041_0134102	3300049577	Bacteria	1543
358	Ga0501042_0431698	3300049578	Bacteria	955
359	Ga0501048_1043018	3300049582	Bacteria	588
360	Ga0501067_0219801	3300049583	Unclassified	1058
361	Ga0501072_0807907	3300049588	Bacteria	734
362	Ga0501074_0804282	3300049590	Bacteria	662
363	Ga0501076_0268724	3300049592	Bacteria	1396
364	Ga0501076_1258149	3300049592	Bacteria	609
365	Ga0501077_0308131	3300049593	Bacteria	1009
366	Ga0501079_0095938	3300049741	Bacteria	2299
367	Ga0501081_0364653	3300049743	Bacteria	1066
368	Ga0501083_0538636	3300049744	Bacteria	760
369	Ga0501045_0934391	3300049824	Bacteria	637
370	nmdc:mga05p37_361069_c1	3300050507	Bacteria	1707
371	nmdc:mga05p37_433856_c1	3300050507	Bacteria	1526
372	nmdc:mga05p37_440_c1	3300050507	Bacteria	45174
373	nmdc:mga09592_278_c1	3300050508	Bacteria	37149
374	nmdc:mga09592_30298_c1	3300050508	Bacteria	4502
375	nmdc:mga0qj67_1221083_c1	3300050509	Bacteria	584
376	nmdc:mga0qj67_4994_c1	3300050509	Bacteria	9642
377	nmdc:mga06r32_124519_c1	3300050510	Bacteria	2545
378	nmdc:mga08y16_175276_c1	3300050511	Bacteria	2227
379	nmdc:mga08y16_3966_c1	3300050511	Bacteria	15417
380	nmdc:mga0n895_1079759_c1	3300050512	Bacteria	781
381	nmdc:mga0n895_25187_c1	3300050512	Bacteria	5619
382	nmdc:mga0rr50_341661_c1	3300050513	Bacteria	1258
383	nmdc:mga0rr50_57534_c1	3300050513	Bacteria	2909
384	nmdc:mga0a205_26557_c1	3300050515	Bacteria	5524
385	nmdc:mga0a205_43109_c1	3300050515	Bacteria	4350
386	nmdc:mga0a205_46316_c1	3300050515	Bacteria	4194
387	Ga0495655_0030870	3300053083	Bacteria	1300
388	Ga0530510_0314028	3300061734	Bacteria	1174

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300031649	Ga0307514_10420758	Ga0307514_104207582	116
2	3300042993	Ga0439440_0186786	Ga0439440_0186786_104_460	117
3	3300009094	Ga0111539_10020355	Ga0111539_100203556	118
4	3300009098	Ga0105245_10408373	Ga0105245_104083732	118
5	3300009101	Ga0105247_10224496	Ga0105247_102244962	118
6	3300009147	Ga0114129_10085547	Ga0114129_100855474	118
7	3300009148	Ga0105243_10380561	Ga0105243_103805612	118
8	3300013306	Ga0163162_11293873	Ga0163162_112938731	118
9	3300013308	Ga0157375_10123647	Ga0157375_101236475	118
10	3300035121	Ga0373960_0267794	Ga0373960_0267794_11_370	118
11	3300048906	Ga0496103_0980476	Ga0496103_0980476_57_416	118
12	3300048912	Ga0496109_0338357	Ga0496109_0338357_294_653	118
13	3300048913	Ga0496110_0135063	Ga0496110_0135063_1593_1952	118
14	3300048917	Ga0496114_0139612	Ga0496114_0139612_974_1333	118
15	3300050507	nmdc:mga05p37_440_c1	nmdc:mga05p37_440_c1_9526_9885	118
16	3300050508	nmdc:mga09592_278_c1	nmdc:mga09592_278_c1_10387_10746	118
17	3300050509	nmdc:mga0qj67_4994_c1	nmdc:mga0qj67_4994_c1_6229_6588	118
18	3300050511	nmdc:mga08y16_3966_c1	nmdc:mga08y16_3966_c1_2481_2840	118
19	3300050512	nmdc:mga0n895_1079759_c1	nmdc:mga0n895_1079759_c1_338_697	118
20	3300050515	nmdc:mga0a205_43109_c1	nmdc:mga0a205_43109_c1_2569_2928	118
21	3300005466	Ga0070685_11338121	Ga0070685_113381211	119
22	3300005617	Ga0068859_101033650	Ga0068859_1010336502	119
23	3300005840	Ga0068870_10365826	Ga0068870_103658262	119
24	3300006931	Ga0097620_101033683	Ga0097620_1010336832	119
25	3300011119	Ga0105246_11575278	Ga0105246_115752782	119
26	3300013307	Ga0157372_10853759	Ga0157372_108537592	119
27	3300013308	Ga0157375_10349074	Ga0157375_103490741	119
28	3300017792	Ga0163161_10380303	Ga0163161_103803032	119
29	3300025908	Ga0207643_10542348	Ga0207643_105423481	119
30	3300025972	Ga0207668_11117770	Ga0207668_111177702	119
31	3300046678	Ga0495599_0635766	Ga0495599_0635766_236_598	119
32	3300047322	Ga0495680_0554526	Ga0495680_0554526_170_532	119
33	3300048904	Ga0496101_0829493	Ga0496101_0829493_127_489	119
34	3300049583	Ga0501067_0219801	Ga0501067_0219801_247_609	119
35	3300031548	Ga0307408_100600892	Ga0307408_1006008922	120
36	3300031731	Ga0307405_10494188	Ga0307405_104941882	120
37	3300031824	Ga0307413_10097374	Ga0307413_100973742	120
38	3300031852	Ga0307410_10062300	Ga0307410_100623003	120
39	3300031889	Ga0326468_10000079	Ga0326468_100000796	120
40	3300031901	Ga0307406_10064574	Ga0307406_100645742	120
41	3300031903	Ga0307407_10054525	Ga0307407_100545253	120
42	3300031995	Ga0307409_101306372	Ga0307409_1013063721	120
43	3300032002	Ga0307416_102376268	Ga0307416_1023762682	120
44	3300032126	Ga0307415_100384080	Ga0307415_1003840802	120
45	3300003203	JGI25406J46586_10034652	JGI25406J46586_100346522	121
46	3300003203	JGI25406J46586_10110070	JGI25406J46586_101100701	121
47	3300003911	JGI25405J52794_10017984	JGI25405J52794_100179842	121
48	3300005337	Ga0070682_100055016	Ga0070682_1000550162	121
49	3300005345	Ga0070692_10212987	Ga0070692_102129872	121
50	3300005347	Ga0070668_100019652	Ga0070668_1000196525	121
51	3300005347	Ga0070668_100253032	Ga0070668_1002530322	121
52	3300005353	Ga0070669_100125550	Ga0070669_1001255502	121
53	3300005356	Ga0070674_101444268	Ga0070674_1014442682	121
54	3300005366	Ga0070659_101213966	Ga0070659_1012139661	121
55	3300005444	Ga0070694_101097890	Ga0070694_1010978902	121
56	3300005457	Ga0070662_100009739	Ga0070662_1000097392	121
57	3300005459	Ga0068867_101561508	Ga0068867_1015615081	121
58	3300005539	Ga0068853_100181257	Ga0068853_1001812573	121
59	3300005563	Ga0068855_100952629	Ga0068855_1009526292	121
60	3300005578	Ga0068854_100299169	Ga0068854_1002991692	121
61	3300005616	Ga0068852_101163606	Ga0068852_1011636062	121
62	3300005617	Ga0068859_100818698	Ga0068859_1008186982	121
63	3300005718	Ga0068866_10007581	Ga0068866_100075812	121
64	3300005718	Ga0068866_10960139	Ga0068866_109601392	121
65	3300005719	Ga0068861_100125910	Ga0068861_1001259103	121
66	3300005719	Ga0068861_100321974	Ga0068861_1003219743	121
67	3300005844	Ga0068862_102341136	Ga0068862_1023411361	121
68	3300005937	Ga0081455_10001304	Ga0081455_100013049	121
69	3300005985	Ga0081539_10000780	Ga0081539_1000078029	121
70	3300005985	Ga0081539_10002007	Ga0081539_100020077	121
71	3300006058	Ga0075432_10002866	Ga0075432_100028665	121
72	3300006844	Ga0075428_100008511	Ga0075428_10000851112	121
73	3300006844	Ga0075428_100046051	Ga0075428_1000460514	121
74	3300006846	Ga0075430_100008356	Ga0075430_1000083565	121
75	3300006847	Ga0075431_100027511	Ga0075431_1000275116	121
76	3300006847	Ga0075431_100124161	Ga0075431_1001241613	121
77	3300006852	Ga0075433_10138459	Ga0075433_101384592	121
78	3300006852	Ga0075433_10396860	Ga0075433_103968602	121
79	3300006871	Ga0075434_100094459	Ga0075434_1000944592	121
80	3300006871	Ga0075434_101220526	Ga0075434_1012205262	121
81	3300006880	Ga0075429_100039443	Ga0075429_1000394434	121
82	3300006880	Ga0075429_100125606	Ga0075429_1001256063	121
83	3300006881	Ga0068865_100034905	Ga0068865_1000349051	121
84	3300006881	Ga0068865_100053024	Ga0068865_1000530244	121
85	3300006914	Ga0075436_100079814	Ga0075436_1000798142	121
86	3300006931	Ga0097620_100818506	Ga0097620_1008185062	121
87	3300007076	Ga0075435_100007559	Ga0075435_1000075594	121
88	3300009098	Ga0105245_10014834	Ga0105245_100148345	121
89	3300009098	Ga0105245_10026402	Ga0105245_100264024	121
90	3300009147	Ga0114129_10028871	Ga0114129_100288714	121
91	3300009148	Ga0105243_10005951	Ga0105243_100059512	121
92	3300009148	Ga0105243_10031793	Ga0105243_100317932	121
93	3300009176	Ga0105242_10104482	Ga0105242_101044822	121
94	3300009551	Ga0105238_10531213	Ga0105238_105312131	121
95	3300009551	Ga0105238_11613036	Ga0105238_116130362	121
96	3300009553	Ga0105249_10030802	Ga0105249_100308025	121
97	3300012478	Ga0157328_1001483	Ga0157328_10014832	121
98	3300012498	Ga0157345_1018264	Ga0157345_10182642	121
99	3300012505	Ga0157339_1004897	Ga0157339_10048972	121
100	3300012507	Ga0157342_1024205	Ga0157342_10242052	121
101	3300012513	Ga0157326_1004818	Ga0157326_10048182	121
102	3300013296	Ga0157374_12097803	Ga0157374_120978031	121
103	3300013297	Ga0157378_11576929	Ga0157378_115769292	121
104	3300013306	Ga0163162_10071798	Ga0163162_100717982	121
105	3300013306	Ga0163162_10382231	Ga0163162_103822313	121
106	3300013307	Ga0157372_10013749	Ga0157372_1001374910	121
107	3300017792	Ga0163161_10057656	Ga0163161_100576564	121
108	3300017792	Ga0163161_10149902	Ga0163161_101499022	121
109	3300025899	Ga0207642_10124933	Ga0207642_101249332	121
110	3300025901	Ga0207688_10038082	Ga0207688_100380823	121
111	3300025901	Ga0207688_10101599	Ga0207688_101015992	121
112	3300025923	Ga0207681_10236918	Ga0207681_102369182	121
113	3300025927	Ga0207687_10083243	Ga0207687_100832433	121
114	3300025927	Ga0207687_10509923	Ga0207687_105099232	121
115	3300025927	Ga0207687_10630175	Ga0207687_106301752	121
116	3300025932	Ga0207690_10177067	Ga0207690_101770672	121
117	3300025933	Ga0207706_10009075	Ga0207706_100090753	121
118	3300025933	Ga0207706_10033864	Ga0207706_100338643	121
119	3300025934	Ga0207686_10033388	Ga0207686_100333882	121
120	3300025935	Ga0207709_10223626	Ga0207709_102236262	121
121	3300025937	Ga0207669_11514419	Ga0207669_115144192	121
122	3300025938	Ga0207704_10243131	Ga0207704_102431311	121
123	3300025938	Ga0207704_11187509	Ga0207704_111875091	121
124	3300025961	Ga0207712_10106900	Ga0207712_101069002	121
125	3300025961	Ga0207712_10495275	Ga0207712_104952751	121
126	3300025972	Ga0207668_10021777	Ga0207668_100217775	121
127	3300025972	Ga0207668_10076539	Ga0207668_100765392	121
128	3300026041	Ga0207639_10144276	Ga0207639_101442763	121
129	3300026075	Ga0207708_10917127	Ga0207708_109171272	121
130	3300026089	Ga0207648_10236881	Ga0207648_102368812	121
131	3300026095	Ga0207676_10952695	Ga0207676_109526952	121
132	3300026118	Ga0207675_100047035	Ga0207675_1000470355	121
133	3300026118	Ga0207675_100646145	Ga0207675_1006461452	121
134	3300026121	Ga0207683_10256843	Ga0207683_102568432	121
135	3300026142	Ga0207698_10634275	Ga0207698_106342752	121
136	3300027907	Ga0207428_10003686	Ga0207428_100036864	121
137	3300027907	Ga0207428_10008426	Ga0207428_1000842610	121
138	3300028379	Ga0268266_11581954	Ga0268266_115819542	121
139	3300028380	Ga0268265_11563164	Ga0268265_115631641	121
140	3300046513	Ga0495616_0040278	Ga0495616_0040278_653_1021	121
141	3300046515	Ga0495620_0246689	Ga0495620_0246689_258_632	121
142	3300046520	Ga0495637_0265288	Ga0495637_0265288_183_551	121
143	3300046531	Ga0495665_0465692	Ga0495665_0465692_251_619	121
144	3300046683	Ga0495658_0608607	Ga0495658_0608607_320_688	121
145	3300046691	Ga0495670_0072064	Ga0495670_0072064_67_435	121
146	3300046810	Ga0495660_0162986	Ga0495660_0162986_683_1051	121
147	3300047445	Ga0495677_0121149	Ga0495677_0121149_573_941	121
148	3300047673	Ga0495593_0163611	Ga0495593_0163611_522_890	121
149	3300049569	Ga0501032_0471522	Ga0501032_0471522_110_478	121
150	3300050507	nmdc:mga05p37_433856_c1	nmdc:mga05p37_433856_c1_554_928	121
151	3300050510	nmdc:mga06r32_124519_c1	nmdc:mga06r32_124519_c1_604_978	121
152	3300050511	nmdc:mga08y16_175276_c1	nmdc:mga08y16_175276_c1_1511_1885	121
153	3300050512	nmdc:mga0n895_25187_c1	nmdc:mga0n895_25187_c1_4062_4436	121
154	3300050513	nmdc:mga0rr50_57534_c1	nmdc:mga0rr50_57534_c1_1161_1535	121
155	3300050515	nmdc:mga0a205_26557_c1	nmdc:mga0a205_26557_c1_930_1304	121
156	3300053083	Ga0495655_0030870	Ga0495655_0030870_121_489	121
157	3300006028	Ga0070717_10382851	Ga0070717_103828512	122
158	3300046476	Ga0495662_0197133	Ga0495662_0197133_186_557	122
159	3300046477	Ga0495664_0624897	Ga0495664_0624897_43_414	122
160	3300048088	Ga0495602_0814674	Ga0495602_0814674_142_513	122
161	3300048905	Ga0496102_0036029	Ga0496102_0036029_855_1226	122
162	3300048907	Ga0496104_0006937	Ga0496104_0006937_6275_6646	122
163	3300048908	Ga0496105_0003935	Ga0496105_0003935_7940_8311	122
164	3300048911	Ga0496108_0009012	Ga0496108_0009012_7192_7563	122
165	3300048912	Ga0496109_0001281	Ga0496109_0001281_15538_15909	122
166	3300048913	Ga0496110_0000336	Ga0496110_0000336_24349_24720	122
167	3300048914	Ga0496111_0000281	Ga0496111_0000281_20549_20920	122
168	3300048916	Ga0496113_0027330	Ga0496113_0027330_2297_2668	122
169	3300048917	Ga0496114_0029418	Ga0496114_0029418_1176_1547	122
170	3300048918	Ga0496115_0023209	Ga0496115_0023209_758_1129	122
171	3300013308	Ga0157375_11957472	Ga0157375_119574721	137
172	3300046491	Ga0495584_0000379	Ga0495584_0000379_25578_25991	137
173	3300046506	Ga0495583_0020401	Ga0495583_0020401_495_908	137
174	iso_pu_bacteria	2511231008	2511280353	137
175	iso_pu_bacteria	2623620443	2624480572	137
176	iso_pu_bacteria	2919063839	2919065176	137
177	iso_pu_bacteria	2919456309	2919458862	137
178	iso_pu_bacteria	3007718800	3007720707	137
179	iso_pu_bacteria	8056125926	8056129166	137
180	iso_pu_bacteria	8056172158	8056174593	137
181	3300009092	Ga0105250_10239010	Ga0105250_102390101	138
182	3300009176	Ga0105242_11950922	Ga0105242_119509221	138
183	3300011119	Ga0105246_10058547	Ga0105246_100585472	138
184	3300013102	Ga0157371_10258210	Ga0157371_102582101	138
185	3300013104	Ga0157370_10003251	Ga0157370_1000325114	138
186	3300013104	Ga0157370_10467390	Ga0157370_104673903	138
187	3300013306	Ga0163162_10174023	Ga0163162_101740232	138
188	3300013306	Ga0163162_10219354	Ga0163162_102193543	138
189	3300013307	Ga0157372_10196710	Ga0157372_101967102	138
190	3300015265	Ga0182005_1001729	Ga0182005_10017296	138
191	3300041411	Ga0439466_0017818	Ga0439466_0017818_1319_1735	138
192	3300042006	Ga0439432_076593	Ga0439432_076593_102_518	138
193	3300042010	Ga0439452_002538	Ga0439452_002538_274_690	138
194	3300042137	Ga0450902_000833	Ga0450902_000833_3194_3610	138
195	3300042138	Ga0450903_001812	Ga0450903_001812_471_887	138
196	3300042461	Ga0439460_0001218	Ga0439460_0001218_4965_5381	138
197	3300046452	Ga0495617_028829	Ga0495617_028829_921_1337	138
198	3300046452	Ga0495617_103468	Ga0495617_103468_451_867	138
199	3300046452	Ga0495617_137606	Ga0495617_137606_63_479	138
200	3300046455	Ga0495603_0007417	Ga0495603_0007417_1307_1723	138
201	3300046458	Ga0495591_048432	Ga0495591_048432_571_987	138
202	3300046473	Ga0495582_0047477	Ga0495582_0047477_977_1393	138
203	3300046475	Ga0495639_0019540	Ga0495639_0019540_2078_2494	138
204	3300046491	Ga0495584_0001025	Ga0495584_0001025_12489_12905	138
205	3300046491	Ga0495584_0081715	Ga0495584_0081715_640_1056	138
206	3300046491	Ga0495584_0152220	Ga0495584_0152220_723_1139	138
207	3300046492	Ga0495585_0001220	Ga0495585_0001220_19667_20086	138
208	3300046492	Ga0495585_0014834	Ga0495585_0014834_2162_2578	138
209	3300046492	Ga0495585_0048175	Ga0495585_0048175_1644_2060	138
210	3300046499	Ga0495594_0002990	Ga0495594_0002990_7941_8357	138
211	3300046507	Ga0495606_0034944	Ga0495606_0034944_1259_1675	138
212	3300046512	Ga0495610_0001941	Ga0495610_0001941_17172_17588	138
213	3300046513	Ga0495616_0010336	Ga0495616_0010336_1143_1559	138
214	3300046516	Ga0495628_0635702	Ga0495628_0635702_31_447	138
215	3300046517	Ga0495630_0004901	Ga0495630_0004901_8877_9293	138
216	3300046518	Ga0495631_0000014	Ga0495631_0000014_90070_90486	138
217	3300046520	Ga0495637_0006624	Ga0495637_0006624_4981_5397	138
218	3300046520	Ga0495637_0014637	Ga0495637_0014637_2268_2684	138
219	3300046524	Ga0495648_0023218	Ga0495648_0023218_1696_2112	138
220	3300046524	Ga0495648_0201724	Ga0495648_0201724_282_698	138
221	3300046526	Ga0495666_0005975	Ga0495666_0005975_51_467	138
222	3300046530	Ga0495654_0065059	Ga0495654_0065059_405_821	138
223	3300046536	Ga0495587_0022055	Ga0495587_0022055_212_628	138
224	3300046538	Ga0495609_0005628	Ga0495609_0005628_464_880	138
225	3300046543	Ga0495645_0369815	Ga0495645_0369815_352_768	138
226	3300046557	Ga0495622_0042793	Ga0495622_0042793_405_821	138
227	3300046557	Ga0495622_0144772	Ga0495622_0144772_235_651	138
228	3300046558	Ga0495633_0003382	Ga0495633_0003382_5886_6302	138
229	3300046558	Ga0495633_0111312	Ga0495633_0111312_753_1169	138
230	3300046642	Ga0495634_0472395	Ga0495634_0472395_139_555	138
231	3300046663	Ga0495635_0004614	Ga0495635_0004614_6031_6447	138
232	3300046674	Ga0495588_0054715	Ga0495588_0054715_37_453	138
233	3300046674	Ga0495588_0072550	Ga0495588_0072550_1217_1633	138
234	3300046674	Ga0495588_0157967	Ga0495588_0157967_225_641	138
235	3300046680	Ga0495646_0002334	Ga0495646_0002334_7971_8387	138
236	3300046689	Ga0495613_0184506	Ga0495613_0184506_589_1005	138
237	3300046691	Ga0495670_0005385	Ga0495670_0005385_5411_5827	138
238	3300046692	Ga0495671_0024922	Ga0495671_0024922_2582_2998	138
239	3300046692	Ga0495671_0025346	Ga0495671_0025346_851_1270	138
240	3300046692	Ga0495671_0182147	Ga0495671_0182147_324_740	138
241	3300046809	Ga0495600_0021499	Ga0495600_0021499_322_738	138
242	3300046810	Ga0495660_0008929	Ga0495660_0008929_225_641	138
243	3300046810	Ga0495660_0111936	Ga0495660_0111936_78_494	138
244	3300047317	Ga0495604_0008768	Ga0495604_0008768_4501_4917	138
245	3300047322	Ga0495680_0031807	Ga0495680_0031807_1972_2388	138
246	3300047323	Ga0495683_0131872	Ga0495683_0131872_329_745	138
247	3300047469	Ga0495673_0001305	Ga0495673_0001305_18209_18625	138
248	3300047469	Ga0495673_0057133	Ga0495673_0057133_343_759	138
249	3300048921	Ga0496118_0087698	Ga0496118_0087698_767_1183	138
250	3300048928	Ga0496125_0008758	Ga0496125_0008758_9710_10126	138
251	3300050508	nmdc:mga09592_30298_c1	nmdc:mga09592_30298_c1_2064_2480	138
252	3300050509	nmdc:mga0qj67_1221083_c1	nmdc:mga0qj67_1221083_c1_25_441	138
253	3300005331	Ga0070670_100723504	Ga0070670_1007235042	139
254	3300005434	Ga0070709_11349433	Ga0070709_113494331	139
255	3300049592	Ga0501076_1258149	Ga0501076_1258149_165_587	139
256	3300005333	Ga0070677_10734239	Ga0070677_107342391	140
257	3300005339	Ga0070660_100448485	Ga0070660_1004484852	140
258	3300005354	Ga0070675_100932697	Ga0070675_1009326971	140
259	3300005356	Ga0070674_100295135	Ga0070674_1002951352	140
260	3300005364	Ga0070673_100845862	Ga0070673_1008458622	140
261	3300009147	Ga0114129_11035447	Ga0114129_110354472	140
262	3300009553	Ga0105249_10706458	Ga0105249_107064582	140
263	3300013308	Ga0157375_10741524	Ga0157375_107415242	140
264	3300025937	Ga0207669_10221180	Ga0207669_102211802	140
265	3300025960	Ga0207651_11497911	Ga0207651_114979112	140
266	3300025986	Ga0207658_10249093	Ga0207658_102490932	140
267	3300026089	Ga0207648_10357526	Ga0207648_103575262	140
268	3300026118	Ga0207675_100141291	Ga0207675_1001412913	140
269	3300045051	Ga0451576_0291044	Ga0451576_0291044_640_1062	140
270	3300046501	Ga0495607_0095695	Ga0495607_0095695_546_971	140
271	3300046692	Ga0495671_0577857	Ga0495671_0577857_69_494	140
272	3300005288	Ga0065714_10005181	Ga0065714_100051815	141
273	3300005288	Ga0065714_10066395	Ga0065714_100663956	141
274	3300005288	Ga0065714_10165892	Ga0065714_101658921	141
275	3300005331	Ga0070670_100051859	Ga0070670_1000518594	141
276	3300005353	Ga0070669_100174853	Ga0070669_1001748531	141
277	3300006058	Ga0075432_10256313	Ga0075432_102563131	141
278	3300006880	Ga0075429_100015111	Ga0075429_1000151117	141
279	3300009011	Ga0105251_10154516	Ga0105251_101545161	141
280	3300009174	Ga0105241_11623142	Ga0105241_116231422	141
281	3300009176	Ga0105242_10192252	Ga0105242_101922522	141
282	3300009176	Ga0105242_11968204	Ga0105242_119682041	141
283	3300009553	Ga0105249_10231577	Ga0105249_102315772	141
284	3300010375	Ga0105239_11990792	Ga0105239_119907921	141
285	3300013306	Ga0163162_11803548	Ga0163162_118035481	141
286	3300014497	Ga0182008_10045609	Ga0182008_100456092	141
287	3300017792	Ga0163161_10005787	Ga0163161_100057872	141
288	3300017792	Ga0163161_10033938	Ga0163161_100339382	141
289	3300017792	Ga0163161_10089824	Ga0163161_100898243	141
290	3300025735	Ga0207713_1014109	Ga0207713_10141094	141
291	3300025899	Ga0207642_10603019	Ga0207642_106030191	141
292	3300025911	Ga0207654_11228455	Ga0207654_112284551	141
293	3300025923	Ga0207681_10163729	Ga0207681_101637292	141
294	3300025925	Ga0207650_10033162	Ga0207650_100331625	141
295	3300025934	Ga0207686_11189718	Ga0207686_111897182	141
296	3300026095	Ga0207676_11123956	Ga0207676_111239561	141
297	3300027360	Ga0209969_1032175	Ga0209969_10321751	141
298	3300030521	Ga0307511_10082470	Ga0307511_100824703	141
299	3300038705	Ga0237819_00724	Ga0237819_00724_7826_8251	141
300	3300041451	Ga0451791_0631523	Ga0451791_0631523_131_556	141
301	3300041486	Ga0451807_1693714	Ga0451807_1693714_37_462	141
302	3300046471	Ga0495650_0029672	Ga0495650_0029672_377_889	141
303	3300046474	Ga0495605_0370487	Ga0495605_0370487_29_544	141
304	3300046501	Ga0495607_0001050	Ga0495607_0001050_3141_3653	141
305	3300046501	Ga0495607_0052244	Ga0495607_0052244_148_609	141
306	3300046501	Ga0495607_0117977	Ga0495607_0117977_641_1066	141
307	3300046515	Ga0495620_0006126	Ga0495620_0006126_766_1278	141
308	3300046519	Ga0495632_0008007	Ga0495632_0008007_3939_4400	141
309	3300046520	Ga0495637_0007000	Ga0495637_0007000_4547_5008	141
310	3300046520	Ga0495637_0007064	Ga0495637_0007064_113_625	141
311	3300046530	Ga0495654_0008880	Ga0495654_0008880_4253_4765	141
312	3300046616	Ga0495668_0621326	Ga0495668_0621326_60_572	141
313	3300046660	Ga0495625_0001220	Ga0495625_0001220_25461_25973	141
314	3300046665	Ga0495661_0015638	Ga0495661_0015638_400_912	141
315	3300046689	Ga0495613_0001043	Ga0495613_0001043_737_1162	141
316	3300046691	Ga0495670_0143017	Ga0495670_0143017_140_649	141
317	3300046694	Ga0495649_0102113	Ga0495649_0102113_1067_1492	141
318	3300046694	Ga0495649_0409297	Ga0495649_0409297_60_569	141
319	3300046794	Ga0495589_0009956	Ga0495589_0009956_584_1045	141
320	3300046794	Ga0495589_0012823	Ga0495589_0012823_2482_2994	141
321	3300047323	Ga0495683_0000057	Ga0495683_0000057_92489_93001	141
322	3300047469	Ga0495673_0000725	Ga0495673_0000725_25416_25841	141
323	3300047470	Ga0495681_0005210	Ga0495681_0005210_6592_7104	141
324	3300048920	Ga0496117_0322034	Ga0496117_0322034_277_789	141
325	3300048924	Ga0496121_0128727	Ga0496121_0128727_275_787	141
326	3300048928	Ga0496125_0012438	Ga0496125_0012438_2462_2974	141
327	3300050513	nmdc:mga0rr50_341661_c1	nmdc:mga0rr50_341661_c1_74_499	141
328	3300050515	nmdc:mga0a205_46316_c1	nmdc:mga0a205_46316_c1_2921_3346	141
329	3300005406	Ga0070703_10080956	Ga0070703_100809563	142
330	3300005440	Ga0070705_100040786	Ga0070705_1000407863	142
331	3300005444	Ga0070694_100854516	Ga0070694_1008545161	142
332	3300005467	Ga0070706_100113618	Ga0070706_1001136183	142
333	3300005471	Ga0070698_100492836	Ga0070698_1004928363	142
334	3300005545	Ga0070695_100098102	Ga0070695_1000981023	142
335	3300005546	Ga0070696_100324302	Ga0070696_1003243023	142
336	3300005549	Ga0070704_100041334	Ga0070704_1000413343	142
337	3300006237	Ga0097621_101273127	Ga0097621_1012731272	142
338	3300009177	Ga0105248_10152076	Ga0105248_101520763	142
339	3300010159	Ga0099796_10531396	Ga0099796_105313961	142
340	3300025910	Ga0207684_10166225	Ga0207684_101662252	142
341	3300025922	Ga0207646_10368559	Ga0207646_103685592	142
342	3300025981	Ga0207640_11875196	Ga0207640_118751961	142
343	3300031242	Ga0265329_10262664	Ga0265329_102626641	142
344	3300031711	Ga0265314_10354639	Ga0265314_103546392	142
345	3300032005	Ga0307411_10027823	Ga0307411_100278234	142
346	3300039437	Ga0436365_0169870	Ga0436365_0169870_143_574	142
347	3300045976	Ga0466967_0185538	Ga0466967_0185538_1443_1871	142
348	3300046557	Ga0495622_0010471	Ga0495622_0010471_2381_2809	142
349	3300048915	Ga0496112_0203897	Ga0496112_0203897_262_690	142
350	3300049572	Ga0501036_0171834	Ga0501036_0171834_1216_1647	142
351	3300049824	Ga0501045_0934391	Ga0501045_0934391_47_478	142
352	3300005345	Ga0070692_11175177	Ga0070692_111751771	143
353	3300005471	Ga0070698_100749371	Ga0070698_1007493711	143
354	3300005547	Ga0070693_100584641	Ga0070693_1005846412	143
355	3300005549	Ga0070704_100134618	Ga0070704_1001346183	143
356	3300007788	Ga0099795_10236402	Ga0099795_102364021	143
357	3300025934	Ga0207686_11226741	Ga0207686_112267411	143
358	3300050507	nmdc:mga05p37_361069_c1	nmdc:mga05p37_361069_c1_121_561	143
359	3300005293	Ga0065715_10120391	Ga0065715_101203913	144
360	3300005440	Ga0070705_100044764	Ga0070705_1000447643	144
361	3300005459	Ga0068867_100282764	Ga0068867_1002827642	144
362	3300005617	Ga0068859_100694381	Ga0068859_1006943812	144
363	3300005843	Ga0068860_100093924	Ga0068860_1000939243	144
364	3300006852	Ga0075433_10036318	Ga0075433_100363185	144
365	3300006931	Ga0097620_100694369	Ga0097620_1006943692	144
366	3300009177	Ga0105248_10531767	Ga0105248_105317672	144
367	3300020069	Ga0197907_11384792	Ga0197907_113847921	144
368	3300025903	Ga0207680_10762796	Ga0207680_107627961	144
369	3300025929	Ga0207664_10472607	Ga0207664_104726072	144
370	3300025961	Ga0207712_10394053	Ga0207712_103940531	144
371	3300026075	Ga0207708_10774811	Ga0207708_107748112	144
372	3300026089	Ga0207648_10251534	Ga0207648_102515342	144
373	3300028381	Ga0268264_10511791	Ga0268264_105117912	144
374	3300049572	Ga0501036_1737468	Ga0501036_1737468_21_464	144
375	3300049575	Ga0501039_0174830	Ga0501039_0174830_939_1382	144
376	3300049576	Ga0501040_0211409	Ga0501040_0211409_569_1012	144
377	3300049577	Ga0501041_0134102	Ga0501041_0134102_203_646	144
378	3300049578	Ga0501042_0431698	Ga0501042_0431698_485_928	144
379	3300049582	Ga0501048_1043018	Ga0501048_1043018_73_516	144
380	3300049588	Ga0501072_0807907	Ga0501072_0807907_264_707	144
381	3300049590	Ga0501074_0804282	Ga0501074_0804282_99_542	144
382	3300049592	Ga0501076_0268724	Ga0501076_0268724_571_1014	144
383	3300049593	Ga0501077_0308131	Ga0501077_0308131_118_561	144
384	3300049741	Ga0501079_0095938	Ga0501079_0095938_496_939	144
385	3300049743	Ga0501081_0364653	Ga0501081_0364653_504_947	144
386	3300049744	Ga0501083_0538636	Ga0501083_0538636_289_738	144
387	3300061734	Ga0530510_0314028	Ga0530510_0314028_22_465	144
388	3300002737	JGI25162J39368_1001823	JGI25162J39368_10018238	145
389	3300002771	JGI25163J39215_1000884	JGI25163J39215_10008841	145
390	3300002772	JGI25164J39214_1000896	JGI25164J39214_10008968	145
391	3300003214	JGI25165J46597_1001683	JGI25165J46597_10016838	145
392	3300025207	Ga0209760_100061	Ga0209760_10006193	145
393	3300025231	Ga0207427_101201	Ga0207427_1012016	145
394	3300025233	Ga0209437_100982	Ga0209437_1009826	145
395	3300025261	Ga0209233_1000008	Ga0209233_10000081203	145

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

1

115

0.92 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
1s7i-assembly1.cif.gz_A-2	1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa	0.8111	1	115
1s7i-assembly1.cif.gz_A-2	1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa	0.7455	1	115
3znj-assembly3.cif.gz_9	crystal structure of unliganded clcf from r.opacus 1cp in crystal form 1.	0.7128	1	115
1mwq-assembly1.cif.gz_A	structure of hi0828, a hypothetical protein from haemophilus influenzae with a putative active-site phosphohistidine	0.7046	1	115
3zo7-assembly1.cif.gz_E	crystal structure of clcfe27a with substrate	0.7021	1	115

ID	Description	Score	Start	End	Superfamily
1s7iA00	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel	0.8111	1	115	3.30.70.1060
1s7iA00	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel	0.7455	1	115	3.30.70.1060
af_P0AB55_1_98_3.30.70.1060	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel	0.7081	1	115	3.30.70.1060
af_O07243_1_96_3.30.70.1060	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel	0.7038	1	115	3.30.70.1060
af_P0AB55_1_98_3.30.70.1060	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel	0.6893	1	115	3.30.70.1060

ID	Description	Score	Start	End
AF-A0A534STC8-F1-model_v4	Bacterial transcription activator effector binding domain-containing protein	0.9845	1	138
AF-A0A0J1B4D2-F1-model_v4	PhnB protein	0.9817	1	143
AF-A0A0K9XFK5-F1-model_v4	Dehydrogenase	0.9808	1	118
AF-A0A5B8STN2-F1-model_v4	YciI family protein	0.9787	1	118
AF-A0A7X7PU01-F1-model_v4	YciI family protein	0.978	1	120

Feature Viewer

pLDDT	pTM	Quality
91.97	0.78	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F433239

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF03795

YCII

YCII-related domain

1

115

0.92

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map