F433238

General Info

Members Datasets Scaffolds Average Seq Length
395 178 790 252

Family's Representative Sequence

Representative Sequence 3300026067|Ga0207678_10258375|Ga0207678_102583751
Length 281
Sequence MKAIVLAAGYATRLRPLTDSWAKELLPIGGRPIIDWIADAIAAVPDVDEVHVVTNSRKAAAFARWAEGREVIVHDDGTSSNDDRLGAIGDMLFVVRQAGLDDDLLVIAGDNLFDFSLDEFVAFWRSKGVASAVAVRDVGSLELASHYGIVALAPDGRLLDFVEKPADPPSSLAATATYLFHREHARLLADYLAGEHGSDQPGRFVGWLQRHEPVYGWEFEGDWFDIGNSEQLLEADNRLRSRSGLPTRRGRRASSCRALRRTTARAPRARRWQARRPTSAR

Samples

Sample ID Description Type Environment
1 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
44 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
76 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
77 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
78 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
79 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
80 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
81 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
82 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
83 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
84 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
85 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
86 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
87 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
88 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
89 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
90 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
91 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
92 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
93 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
94 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
95 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
97 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
98 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
99 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
100 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
101 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
102 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
103 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
104 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
105 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
106 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
107 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
108 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
109 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
110 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
111 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
112 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
113 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
114 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
117 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
118 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
119 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
120 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
121 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
122 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
123 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
124 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
125 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
126 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
127 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
128 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
129 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
130 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
131 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
132 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
133 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
134 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
135 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
136 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
137 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
138 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
139 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
140 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
141 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
142 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
143 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
144 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
145 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
146 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
147 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
148 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
149 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
150 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
151 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
152 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
157 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
158 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
162 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
163 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
164 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
169 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
170 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
171 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
172 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
173 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
174 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
175 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
176 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
177 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
178 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.97
Metatranscriptomes 2.03
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.1
Rhizosphere 91.14
Stem 0
Stem Tuber 0
Unclassified 6.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207678_10258375 3300026067 Bacteria 1493
2 rootH1_10173893 3300003323 Unclassified 1395
3 Ga0070658_10015937 3300005327 Bacteria 6011
4 Ga0070658_10063141 3300005327 Bacteria 3019
5 Ga0070658_10067852 3300005327 Bacteria 2915
6 Ga0070658_10423732 3300005327 Archaea 1145
7 Ga0070683_100019602 3300005329 Bacteria 6009
8 Ga0070683_100055431 3300005329 Bacteria 3679
9 Ga0070683_100165918 3300005329 Bacteria 2095
10 Ga0070670_100321350 3300005331 Bacteria 1356
11 Ga0070680_100008118 3300005336 Bacteria 8016
12 Ga0070680_100113972 3300005336 Bacteria 2252
13 Ga0070682_100002116 3300005337 Bacteria 11030
14 Ga0070682_100581707 3300005337 Archaea 881
15 Ga0070660_100034624 3300005339 Bacteria 3817
16 Ga0070660_100044329 3300005339 Bacteria 3401
17 Ga0070660_100086637 3300005339 Archaea 2464
18 Ga0070660_100104303 3300005339 Bacteria 2249
19 Ga0070660_100370832 3300005339 Bacteria 1181
20 Ga0070689_100392531 3300005340 Bacteria 1171
21 Ga0070661_100238739 3300005344 Archaea 1399
22 Ga0070661_100494087 3300005344 Unclassified 979
23 Ga0070659_100109709 3300005366 Archaea 2227
24 Ga0070659_100136029 3300005366 Bacteria 1998
25 Ga0070713_100081216 3300005436 Bacteria 2766
26 Ga0070713_100084897 3300005436 Bacteria 2710
27 Ga0070713_100124439 3300005436 Bacteria 2266
28 Ga0070708_100088493 3300005445 Bacteria 2816
29 Ga0070663_100129488 3300005455 Archaea 1915
30 Ga0070678_100087951 3300005456 Bacteria 2374
31 Ga0070678_100103965 3300005456 Bacteria 2208
32 Ga0070681_10010547 3300005458 Bacteria 9124
33 Ga0070681_10026745 3300005458 Bacteria 5800
34 Ga0070681_10062439 3300005458 Bacteria 3699
35 Ga0070681_10079731 3300005458 Bacteria 3230
36 Ga0070681_10154400 3300005458 Bacteria 2221
37 Ga0070685_10152212 3300005466 Bacteria 1467
38 Ga0070706_100037104 3300005467 Bacteria 4503
39 Ga0070707_100067070 3300005468 Bacteria 3451
40 Ga0070707_100110034 3300005468 Bacteria 2671
41 Ga0070698_100000108 3300005471 Bacteria 69455
42 Ga0070679_100002604 3300005530 Bacteria 16412
43 Ga0070679_100021879 3300005530 Bacteria 6246
44 Ga0070679_100075897 3300005530 Bacteria 3351
45 Ga0070679_100158312 3300005530 Bacteria 2239
46 Ga0070679_100252952 3300005530 Unclassified 1718
47 Ga0070684_100027914 3300005535 Bacteria 4769
48 Ga0070684_100035187 3300005535 Bacteria 4286
49 Ga0070684_100052881 3300005535 Bacteria 3533
50 Ga0068853_100058504 3300005539 Bacteria 3327
51 Ga0068853_100081353 3300005539 Bacteria 2836
52 Ga0068853_100128383 3300005539 Unclassified 2267
53 Ga0068855_100005599 3300005563 Bacteria 15336
54 Ga0068855_100060132 3300005563 Bacteria 4444
55 Ga0068855_100126832 3300005563 Bacteria 2917
56 Ga0068855_100137686 3300005563 Bacteria 2785
57 Ga0068855_100455538 3300005563 Bacteria 1395
58 Ga0068857_100133636 3300005577 Bacteria 2239
59 Ga0068856_100299975 3300005614 Bacteria 1624
60 Ga0070702_100224993 3300005615 Bacteria 1257
61 Ga0068852_100133098 3300005616 Bacteria 2292
62 Ga0068852_100149450 3300005616 Bacteria 2171
63 Ga0081539_10046231 3300005985 Bacteria 2496
64 Ga0070717_10093042 3300006028 Bacteria 2547
65 Ga0070712_100290433 3300006175 Bacteria 1320
66 Ga0097621_100112911 3300006237 Bacteria 2298
67 Ga0097621_100334364 3300006237 Bacteria 1344
68 Ga0075434_100043704 3300006871 Bacteria 4444
69 Ga0075435_100031598 3300007076 Bacteria 4173
70 Ga0105240_10034978 3300009093 Bacteria 6477
71 Ga0105240_10473903 3300009093 Bacteria 1397
72 Ga0105245_10154202 3300009098 Bacteria 2174
73 Ga0114129_10536035 3300009147 Bacteria 1524
74 Ga0105241_10417668 3300009174 Bacteria 1180
75 Ga0105242_10020277 3300009176 Bacteria 5211
76 Ga0105242_10600913 3300009176 Bacteria 1063
77 Ga0105248_10045265 3300009177 Bacteria 4935
78 Ga0105237_10082903 3300009545 Bacteria 3198
79 Ga0105237_10115790 3300009545 Bacteria 2674
80 Ga0105238_10131651 3300009551 Bacteria 2480
81 Ga0157373_10028141 3300013100 Bacteria 4055
82 Ga0157371_10229469 3300013102 Bacteria 1334
83 Ga0157371_10321557 3300013102 Archaea 1123
84 Ga0157370_10030188 3300013104 Bacteria 5313
85 Ga0157370_10061174 3300013104 Archaea 3574
86 Ga0157370_10095399 3300013104 Bacteria 2790
87 Ga0157370_10454813 3300013104 Bacteria 1177
88 Ga0157370_10561620 3300013104 Bacteria 1046
89 Ga0157369_10089997 3300013105 Bacteria 3276
90 Ga0157369_10126272 3300013105 Bacteria 2712
91 Ga0157369_10813094 3300013105 Bacteria 960
92 Ga0157374_10524575 3300013296 Unclassified 1190
93 Ga0157374_10552007 3300013296 Bacteria 1160
94 Ga0157378_10361086 3300013297 Bacteria 1421
95 Ga0157372_10065043 3300013307 Bacteria 4094
96 Ga0157372_10075644 3300013307 Bacteria 3800
97 Ga0157372_10076648 3300013307 Bacteria 3775
98 Ga0157372_10099479 3300013307 Bacteria 3317
99 Ga0157372_10102233 3300013307 Bacteria 3273
100 Ga0157372_10137173 3300013307 Bacteria 2818
101 Ga0206356_10059091 3300020070 Bacteria 1669
102 Ga0206356_11580771 3300020070 Bacteria 2456
103 Ga0206354_10019376 3300020081 Bacteria 2427
104 Ga0206354_10644970 3300020081 Archaea 1066
105 Ga0206353_11370779 3300020082 Bacteria 2713
106 Ga0206353_11374441 3300020082 Bacteria 1859
107 Ga0206353_11412740 3300020082 Bacteria 4308
108 Ga0206353_11867777 3300020082 Bacteria 2578
109 Ga0207705_10414854 3300025909 Archaea 1042
110 Ga0207684_10038380 3300025910 Bacteria 4064
111 Ga0207707_10011584 3300025912 Bacteria 7679
112 Ga0207707_10081354 3300025912 Bacteria 2827
113 Ga0207707_10120942 3300025912 Archaea 2289
114 Ga0207695_10252646 3300025913 Bacteria 1662
115 Ga0207695_10573658 3300025913 Archaea 1010
116 Ga0207671_10312760 3300025914 Bacteria 1242
117 Ga0207693_10145519 3300025915 Bacteria 1863
118 Ga0207693_10233577 3300025915 Bacteria 1444
119 Ga0207660_10006011 3300025917 Bacteria 7883
120 Ga0207660_10077539 3300025917 Bacteria 2433
121 Ga0207660_10256134 3300025917 Bacteria 1382
122 Ga0207657_10000207 3300025919 Bacteria 60795
123 Ga0207657_10005769 3300025919 Bacteria 12909
124 Ga0207657_10046764 3300025919 Bacteria 3789
125 Ga0207657_10059141 3300025919 Bacteria 3295
126 Ga0207657_10074109 3300025919 Bacteria 2875
127 Ga0207649_10138825 3300025920 Bacteria 1660
128 Ga0207652_10021124 3300025921 Bacteria 5370
129 Ga0207652_10025974 3300025921 Bacteria 4874
130 Ga0207652_10027407 3300025921 Bacteria 4748
131 Ga0207652_10039663 3300025921 Bacteria 3997
132 Ga0207652_10076679 3300025921 Bacteria 2916
133 Ga0207652_10270336 3300025921 Bacteria 1533
134 Ga0207646_10041496 3300025922 Bacteria 4137
135 Ga0207646_10100482 3300025922 Bacteria 2593
136 Ga0207694_10167905 3300025924 Archaea 1775
137 Ga0207700_10104504 3300025928 Bacteria 2266
138 Ga0207700_10420091 3300025928 Unclassified 1174
139 Ga0207690_10277928 3300025932 Archaea 1303
140 Ga0207686_10059735 3300025934 Bacteria 2410
141 Ga0207686_10105602 3300025934 Bacteria 1889
142 Ga0207670_10282701 3300025936 Bacteria 1294
143 Ga0207661_10088530 3300025944 Bacteria 2574
144 Ga0207661_10217312 3300025944 Bacteria 1688
145 Ga0207661_10241493 3300025944 Bacteria 1603
146 Ga0207661_10484755 3300025944 Bacteria 1129
147 Ga0207667_10084457 3300025949 Bacteria 3287
148 Ga0207667_10152192 3300025949 Bacteria 2381
149 Ga0207667_10329066 3300025949 Bacteria 1560
150 Ga0207639_10095034 3300026041 Bacteria 2394
151 Ga0207639_10238328 3300026041 Unclassified 1580
152 Ga0207678_10098490 3300026067 Bacteria 2498
153 Ga0207702_10021838 3300026078 Bacteria 5300
154 Ga0207702_10126693 3300026078 Archaea 2293
155 Ga0207702_10279958 3300026078 Bacteria 1576
156 Ga0207674_10158014 3300026116 Bacteria 2222
157 Ga0207683_10079886 3300026121 Bacteria 2900
158 Ga0265319_1003390 3300028563 Bacteria 8334
159 Ga0265319_1060355 3300028563 Bacteria 1232
160 Ga0265318_10002905 3300028577 Bacteria 8906
161 Ga0265336_10005733 3300028666 Bacteria 4544
162 Ga0265338_10005306 3300028800 Bacteria 16876
163 Ga0265338_10005947 3300028800 Bacteria 15716
164 Ga0265338_10041849 3300028800 Bacteria 4278
165 Ga0265338_10058760 3300028800 Bacteria 3391
166 Ga0265338_10291615 3300028800 Bacteria 1189
167 Ga0265330_10030822 3300031235 Bacteria 2406
168 Ga0265330_10031904 3300031235 Bacteria 2362
169 Ga0265325_10114327 3300031241 Bacteria 1308
170 Ga0265331_10071022 3300031250 Bacteria 1629
171 Ga0265327_10021687 3300031251 Bacteria 3868
172 Ga0265316_10033637 3300031344 Bacteria 4172
173 Ga0265316_10078214 3300031344 Bacteria 2539
174 Ga0265313_10012866 3300031595 Bacteria 5076
175 Ga0265314_10024109 3300031711 Bacteria 4620
176 Ga0265342_10058663 3300031712 Bacteria 2275
177 Ga0373944_0006334 3300035089 Bacteria 3138
178 Ga0373936_0006688 3300035113 Bacteria 4340
179 Ga0373945_0004024 3300035116 Bacteria 4649
180 Ga0373945_0008969 3300035116 Bacteria 3270
181 Ga0373943_0000450 3300035170 Bacteria 17418
182 Ga0373946_0006898 3300035171 Bacteria 4135
183 Ga0373935_0074736 3300035692 Bacteria 2191
184 Ga0373927_0039050 3300035695 Bacteria 3081
185 Ga0373927_0239509 3300035695 Bacteria 1192
186 Ga0373947_0002176 3300035725 Bacteria 11907
187 Ga0373947_0095998 3300035725 Bacteria 1855
188 Ga0373937_0212810 3300036401 Bacteria 1819
189 Ga0373925_0013017 3300037068 Bacteria 6024
190 Ga0373925_0109105 3300037068 Bacteria 2136
191 Ga0395899_0206597 3300037312 Unclassified 1366
192 Ga0395899_0220429 3300037312 Bacteria 1314
193 Ga0395899_0280482 3300037312 Bacteria 1134
194 Ga0395900_0042977 3300037418 Bacteria 4656
195 Ga0395900_0111611 3300037418 Bacteria 2808
196 Ga0395900_0140394 3300037418 Bacteria 2474
197 Ga0395900_0157787 3300037418 Bacteria 2317
198 Ga0395900_0282290 3300037418 Bacteria 1652
199 Ga0395900_0437016 3300037418 Archaea 1267
200 Ga0395898_0002496 3300037466 Bacteria 21639
201 Ga0395898_0005097 3300037466 Bacteria 14235
202 Ga0395898_0005483 3300037466 Bacteria 13708
203 Ga0395898_0034470 3300037466 Bacteria 5045
204 Ga0395898_0046782 3300037466 Bacteria 4249
205 Ga0395898_0067772 3300037466 Bacteria 3454
206 Ga0395898_0136780 3300037466 Bacteria 2346
207 Ga0395898_0159012 3300037466 Bacteria 2161
208 Ga0395898_0315733 3300037466 Bacteria 1491
209 Ga0395898_0509286 3300037466 Unclassified 1145
210 Ga0395898_0787161 3300037466 Archaea 892
211 Ga0395905_0029771 3300037471 Bacteria 5146
212 Ga0395905_0041140 3300037471 Bacteria 4336
213 Ga0395905_0257543 3300037471 Bacteria 1629
214 Ga0395905_1080469 3300037471 Bacteria 705
215 Ga0395901_0005570 3300038443 Bacteria 12740
216 Ga0395901_0008415 3300038443 Bacteria 10427
217 Ga0395901_0015406 3300038443 Bacteria 7784
218 Ga0395901_0020919 3300038443 Bacteria 6702
219 Ga0395901_0034252 3300038443 Bacteria 5244
220 Ga0395901_0045436 3300038443 Bacteria 4558
221 Ga0395901_0089308 3300038443 Bacteria 3225
222 Ga0395901_0216376 3300038443 Bacteria 2004
223 Ga0395901_0319075 3300038443 Bacteria 1608
224 Ga0395901_0473510 3300038443 Bacteria 1278
225 Ga0395901_0551159 3300038443 Bacteria 1168
226 Ga0436365_0351532 3300039437 Unclassified 1042
227 Ga0436363_1448349 3300039450 Unclassified 1289
228 Ga0466969_0036691 3300044656 Bacteria 2475
229 Ga0466966_0000678 3300044684 Bacteria 21592
230 Ga0466966_0038168 3300044684 Bacteria 3095
231 Ga0466961_0002905 3300044693 Bacteria 10634
232 Ga0466961_0007370 3300044693 Bacteria 6998
233 Ga0466961_0062763 3300044693 Bacteria 2361
234 Ga0466963_0000661 3300044694 Bacteria 16639
235 Ga0466963_0002252 3300044694 Bacteria 10714
236 Ga0466963_0006726 3300044694 Bacteria 6829
237 Ga0466963_0015398 3300044694 Bacteria 4734
238 Ga0466963_0034963 3300044694 Bacteria 3272
239 Ga0466963_0090916 3300044694 Bacteria 2078
240 Ga0466963_0175796 3300044694 Bacteria 1494
241 Ga0466964_0000335 3300044706 Bacteria 14066
242 Ga0466964_0003782 3300044706 Bacteria 5552
243 Ga0466964_0016615 3300044706 Bacteria 2812
244 Ga0466964_0110065 3300044706 Bacteria 1227
245 Ga0466971_0001268 3300044719 Bacteria 10525
246 Ga0466971_0111162 3300044719 Bacteria 1264
247 Ga0466968_0000749 3300044735 Bacteria 11242
248 Ga0466970_0019033 3300044765 Bacteria 3558
249 Ga0466970_0041812 3300044765 Bacteria 2436
250 Ga0466970_0162215 3300044765 Archaea 1237
251 Ga0466957_0000566 3300044842 Bacteria 18671
252 Ga0466957_0023375 3300044842 Bacteria 3655
253 Ga0466957_0060671 3300044842 Bacteria 2319
254 Ga0466957_0134334 3300044842 Unclassified 1588
255 Ga0466957_0425595 3300044842 Archaea 911
256 Ga0466957_0473821 3300044842 Bacteria 865
257 Ga0466959_0001055 3300045049 Bacteria 16508
258 Ga0466959_0007108 3300045049 Bacteria 7832
259 Ga0466959_0030465 3300045049 Bacteria 3995
260 Ga0466959_0038112 3300045049 Bacteria 3552
261 Ga0466959_0079300 3300045049 Bacteria 2368
262 Ga0466959_0140513 3300045049 Unclassified 1707
263 Ga0466958_0000591 3300045836 Bacteria 15435
264 Ga0466958_0000942 3300045836 Bacteria 13132
265 Ga0466958_0002736 3300045836 Bacteria 8948
266 Ga0466958_0030610 3300045836 Bacteria 3198
267 Ga0466958_0132361 3300045836 Archaea 1567
268 Ga0466958_0216408 3300045836 Bacteria 1222
269 Ga0466967_0003466 3300045976 Bacteria 10297
270 Ga0466967_0007851 3300045976 Bacteria 7752
271 Ga0466967_0008878 3300045976 Bacteria 7413
272 Ga0466967_0025408 3300045976 Bacteria 4884
273 Ga0466967_0025994 3300045976 Bacteria 4839
274 Ga0466967_0114224 3300045976 Bacteria 2486
275 Ga0466967_0115491 3300045976 Bacteria 2472
276 Ga0466967_0122941 3300045976 Bacteria 2401
277 Ga0466967_0123298 3300045976 Bacteria 2397
278 Ga0466967_0174403 3300045976 Bacteria 2025
279 Ga0466967_0291423 3300045976 Bacteria 1568
280 Ga0466967_0352276 3300045976 Bacteria 1425
281 Ga0495592_0183138 3300046454 Bacteria 1425
282 Ga0495592_0256956 3300046454 Bacteria 1152
283 Ga0495603_0149523 3300046455 Unclassified 1357
284 Ga0495629_0015080 3300046459 Bacteria 5554
285 Ga0495629_0166355 3300046459 Bacteria 1531
286 Ga0495641_0001273 3300046461 Bacteria 21638
287 Ga0495641_0027139 3300046461 Bacteria 2788
288 Ga0495641_0114582 3300046461 Bacteria 1202
289 Ga0495653_0115596 3300046463 Archaea 1920
290 Ga0495582_0000066 3300046473 Bacteria 53920
291 Ga0495639_0001852 3300046475 Bacteria 9359
292 Ga0495662_0000694 3300046476 Bacteria 15948
293 Ga0495584_0034975 3300046491 Bacteria 2540
294 Ga0495594_0159746 3300046499 Bacteria 1281
295 Ga0495594_0207807 3300046499 Unclassified 1116
296 Ga0495608_0349313 3300046511 Bacteria 910
297 Ga0495618_0123715 3300046514 Bacteria 1656
298 Ga0495618_0320961 3300046514 Bacteria 959
299 Ga0495628_0035162 3300046516 Bacteria 4028
300 Ga0495630_0004203 3300046517 Bacteria 10081
301 Ga0495630_0135282 3300046517 Bacteria 1873
302 Ga0495637_0080439 3300046520 Unclassified 1300
303 Ga0495652_0077444 3300046529 Bacteria 2756
304 Ga0495665_0000252 3300046531 Bacteria 26953
305 Ga0495640_0095695 3300046533 Bacteria 1954
306 Ga0495586_0057388 3300046535 Bacteria 2112
307 Ga0495667_0019051 3300046559 Bacteria 4631
308 Ga0495667_0104540 3300046559 Bacteria 1831
309 Ga0495634_0039339 3300046642 Bacteria 3220
310 Ga0495634_0099779 3300046642 Bacteria 1877
311 Ga0495634_0146085 3300046642 Bacteria 1498
312 Ga0495588_0171889 3300046674 Archaea 1146
313 Ga0495599_0023520 3300046678 Bacteria 3853
314 Ga0495647_0089126 3300046681 Archaea 1262
315 Ga0495658_0004118 3300046683 Bacteria 7162
316 Ga0495658_0007364 3300046683 Bacteria 5442
317 Ga0495658_0027070 3300046683 Bacteria 3080
318 Ga0495613_0036684 3300046689 Bacteria 3635
319 Ga0495613_0232110 3300046689 Bacteria 1292
320 Ga0495670_0147490 3300046691 Bacteria 1233
321 Ga0495600_0140681 3300046809 Bacteria 1566
322 Ga0495600_0373273 3300046809 Bacteria 891
323 Ga0495581_0006426 3300047315 Bacteria 6819
324 Ga0495604_0217950 3300047317 Bacteria 1315
325 Ga0495636_0118626 3300047318 Bacteria 1169
326 Ga0495674_0010412 3300047319 Bacteria 8803
327 Ga0495674_0044530 3300047319 Bacteria 3945
328 Ga0495674_0047570 3300047319 Bacteria 3802
329 Ga0495676_0041764 3300047321 Bacteria 3771
330 Ga0495680_0023945 3300047322 Bacteria 5072
331 Ga0495680_0031820 3300047322 Bacteria 4288
332 Ga0495680_0050489 3300047322 Bacteria 3252
333 Ga0495680_0356259 3300047322 Unclassified 1018
334 Ga0495684_0033235 3300047471 Bacteria 3958
335 Ga0496100_0074128 3300048903 Bacteria 2280
336 Ga0496101_0050157 3300048904 Bacteria 3003
337 Ga0496101_0054597 3300048904 Bacteria 2884
338 Ga0496101_0063944 3300048904 Bacteria 2680
339 Ga0496101_0070818 3300048904 Bacteria 2554
340 Ga0496101_0143199 3300048904 Bacteria 1823
341 Ga0496101_0206317 3300048904 Bacteria 1521
342 Ga0496101_0227392 3300048904 Archaea 1449
343 Ga0496101_0270003 3300048904 Bacteria 1328
344 Ga0496102_0079532 3300048905 Bacteria 3019
345 Ga0496102_0206187 3300048905 Bacteria 1853
346 Ga0496103_0209108 3300048906 Bacteria 1255
347 Ga0496104_0057009 3300048907 Bacteria 3696
348 Ga0496104_0108954 3300048907 Bacteria 2655
349 Ga0496104_0309354 3300048907 Unclassified 1493
350 Ga0496105_0005357 3300048908 Bacteria 9725
351 Ga0496105_0290610 3300048908 Unclassified 1316
352 Ga0496106_0176397 3300048909 Bacteria 1695
353 Ga0496107_0028251 3300048910 Bacteria 3985
354 Ga0496107_0073407 3300048910 Archaea 2488
355 Ga0496109_0005677 3300048912 Bacteria 10442
356 Ga0496110_0056022 3300048913 Bacteria 3469
357 Ga0496110_0097973 3300048913 Bacteria 2627
358 Ga0496110_0207453 3300048913 Unclassified 1781
359 Ga0496113_0026109 3300048916 Bacteria 4173
360 Ga0496114_0013201 3300048917 Bacteria 6621
361 Ga0496114_0014325 3300048917 Bacteria 6362
362 Ga0496114_0077797 3300048917 Bacteria 2797
363 Ga0496114_0177581 3300048917 Bacteria 1858
364 Ga0496114_0429123 3300048917 Bacteria 1171
365 Ga0496115_0193455 3300048918 Bacteria 1680
366 Ga0496115_0340391 3300048918 Bacteria 1224
367 Ga0501032_0249758 3300049569 Bacteria 1152
368 Ga0501040_0099620 3300049576 Bacteria 2026
369 Ga0501043_0432841 3300049579 Bacteria 991
370 Ga0501047_0032312 3300049581 Bacteria 5051
371 Ga0501047_0353941 3300049581 Unclassified 1305
372 Ga0501069_0011020 3300049585 Bacteria 4794
373 Ga0501070_0002110 3300049586 Bacteria 17450
374 Ga0501070_0016229 3300049586 Bacteria 6258
375 Ga0501070_0179279 3300049586 Bacteria 1744
376 Ga0501073_0171817 3300049589 Bacteria 1500
377 Ga0501074_0015892 3300049590 Bacteria 5474
378 Ga0501074_0155999 3300049590 Bacteria 1631
379 Ga0501074_0208321 3300049590 Bacteria 1393
380 Ga0501080_0058185 3300049742 Bacteria 3598
381 Ga0501080_0077076 3300049742 Bacteria 3100
382 Ga0501080_0206577 3300049742 Archaea 1801
383 Ga0501044_0127700 3300049823 Bacteria 2539
384 Ga0501044_0465050 3300049823 Unclassified 1170
385 nmdc:mga05p37_503562_c1 3300050507 Bacteria 1389
386 Ga0495601_0136796 3300053077 Bacteria 1597
387 Ga0495595_0001437 3300053084 Bacteria 9279
388 Ga0495595_0163607 3300053084 Bacteria 1099
389 Ga0495619_0008847 3300053085 Bacteria 6366
390 Ga0495619_0084438 3300053085 Bacteria 2143
391 Ga0495619_0340251 3300053085 Unclassified 1038
392 Ga0495619_0510043 3300053085 Unclassified 827
393 Ga0466962_0022368 3300061719 Bacteria 3038
394 Ga0466962_0091062 3300061719 Bacteria 1461
395 Ga0466962_0094880 3300061719 Bacteria 1430
396 Ga0207678_10258375
397 rootH1_10173893
398 Ga0070658_10015937
399 Ga0070658_10063141
400 Ga0070658_10067852
401 Ga0070658_10423732
402 Ga0070683_100019602
403 Ga0070683_100055431
404 Ga0070683_100165918
405 Ga0070670_100321350
406 Ga0070680_100008118
407 Ga0070680_100113972
408 Ga0070682_100002116
409 Ga0070682_100581707
410 Ga0070660_100034624
411 Ga0070660_100044329
412 Ga0070660_100086637
413 Ga0070660_100104303
414 Ga0070660_100370832
415 Ga0070689_100392531
416 Ga0070661_100238739
417 Ga0070661_100494087
418 Ga0070659_100109709
419 Ga0070659_100136029
420 Ga0070713_100081216
421 Ga0070713_100084897
422 Ga0070713_100124439
423 Ga0070708_100088493
424 Ga0070663_100129488
425 Ga0070678_100087951
426 Ga0070678_100103965
427 Ga0070681_10010547
428 Ga0070681_10026745
429 Ga0070681_10062439
430 Ga0070681_10079731
431 Ga0070681_10154400
432 Ga0070685_10152212
433 Ga0070706_100037104
434 Ga0070707_100067070
435 Ga0070707_100110034
436 Ga0070698_100000108
437 Ga0070679_100002604
438 Ga0070679_100021879
439 Ga0070679_100075897
440 Ga0070679_100158312
441 Ga0070679_100252952
442 Ga0070684_100027914
443 Ga0070684_100035187
444 Ga0070684_100052881
445 Ga0068853_100058504
446 Ga0068853_100081353
447 Ga0068853_100128383
448 Ga0068855_100005599
449 Ga0068855_100060132
450 Ga0068855_100126832
451 Ga0068855_100137686
452 Ga0068855_100455538
453 Ga0068857_100133636
454 Ga0068856_100299975
455 Ga0070702_100224993
456 Ga0068852_100133098
457 Ga0068852_100149450
458 Ga0081539_10046231
459 Ga0070717_10093042
460 Ga0070712_100290433
461 Ga0097621_100112911
462 Ga0097621_100334364
463 Ga0075434_100043704
464 Ga0075435_100031598
465 Ga0105240_10034978
466 Ga0105240_10473903
467 Ga0105245_10154202
468 Ga0114129_10536035
469 Ga0105241_10417668
470 Ga0105242_10020277
471 Ga0105242_10600913
472 Ga0105248_10045265
473 Ga0105237_10082903
474 Ga0105237_10115790
475 Ga0105238_10131651
476 Ga0157373_10028141
477 Ga0157371_10229469
478 Ga0157371_10321557
479 Ga0157370_10030188
480 Ga0157370_10061174
481 Ga0157370_10095399
482 Ga0157370_10454813
483 Ga0157370_10561620
484 Ga0157369_10089997
485 Ga0157369_10126272
486 Ga0157369_10813094
487 Ga0157374_10524575
488 Ga0157374_10552007
489 Ga0157378_10361086
490 Ga0157372_10065043
491 Ga0157372_10075644
492 Ga0157372_10076648
493 Ga0157372_10099479
494 Ga0157372_10102233
495 Ga0157372_10137173
496 Ga0206356_10059091
497 Ga0206356_11580771
498 Ga0206354_10019376
499 Ga0206354_10644970
500 Ga0206353_11370779
501 Ga0206353_11374441
502 Ga0206353_11412740
503 Ga0206353_11867777
504 Ga0207705_10414854
505 Ga0207684_10038380
506 Ga0207707_10011584
507 Ga0207707_10081354
508 Ga0207707_10120942
509 Ga0207695_10252646
510 Ga0207695_10573658
511 Ga0207671_10312760
512 Ga0207693_10145519
513 Ga0207693_10233577
514 Ga0207660_10006011
515 Ga0207660_10077539
516 Ga0207660_10256134
517 Ga0207657_10000207
518 Ga0207657_10005769
519 Ga0207657_10046764
520 Ga0207657_10059141
521 Ga0207657_10074109
522 Ga0207649_10138825
523 Ga0207652_10021124
524 Ga0207652_10025974
525 Ga0207652_10027407
526 Ga0207652_10039663
527 Ga0207652_10076679
528 Ga0207652_10270336
529 Ga0207646_10041496
530 Ga0207646_10100482
531 Ga0207694_10167905
532 Ga0207700_10104504
533 Ga0207700_10420091
534 Ga0207690_10277928
535 Ga0207686_10059735
536 Ga0207686_10105602
537 Ga0207670_10282701
538 Ga0207661_10088530
539 Ga0207661_10217312
540 Ga0207661_10241493
541 Ga0207661_10484755
542 Ga0207667_10084457
543 Ga0207667_10152192
544 Ga0207667_10329066
545 Ga0207639_10095034
546 Ga0207639_10238328
547 Ga0207678_10098490
548 Ga0207702_10021838
549 Ga0207702_10126693
550 Ga0207702_10279958
551 Ga0207674_10158014
552 Ga0207683_10079886
553 Ga0265319_1003390
554 Ga0265319_1060355
555 Ga0265318_10002905
556 Ga0265336_10005733
557 Ga0265338_10005306
558 Ga0265338_10005947
559 Ga0265338_10041849
560 Ga0265338_10058760
561 Ga0265338_10291615
562 Ga0265330_10030822
563 Ga0265330_10031904
564 Ga0265325_10114327
565 Ga0265331_10071022
566 Ga0265327_10021687
567 Ga0265316_10033637
568 Ga0265316_10078214
569 Ga0265313_10012866
570 Ga0265314_10024109
571 Ga0265342_10058663
572 Ga0373944_0006334
573 Ga0373936_0006688
574 Ga0373945_0004024
575 Ga0373945_0008969
576 Ga0373943_0000450
577 Ga0373946_0006898
578 Ga0373935_0074736
579 Ga0373927_0039050
580 Ga0373927_0239509
581 Ga0373947_0002176
582 Ga0373947_0095998
583 Ga0373937_0212810
584 Ga0373925_0013017
585 Ga0373925_0109105
586 Ga0395899_0206597
587 Ga0395899_0220429
588 Ga0395899_0280482
589 Ga0395900_0042977
590 Ga0395900_0111611
591 Ga0395900_0140394
592 Ga0395900_0157787
593 Ga0395900_0282290
594 Ga0395900_0437016
595 Ga0395898_0002496
596 Ga0395898_0005097
597 Ga0395898_0005483
598 Ga0395898_0034470
599 Ga0395898_0046782
600 Ga0395898_0067772
601 Ga0395898_0136780
602 Ga0395898_0159012
603 Ga0395898_0315733
604 Ga0395898_0509286
605 Ga0395898_0787161
606 Ga0395905_0029771
607 Ga0395905_0041140
608 Ga0395905_0257543
609 Ga0395905_1080469
610 Ga0395901_0005570
611 Ga0395901_0008415
612 Ga0395901_0015406
613 Ga0395901_0020919
614 Ga0395901_0034252
615 Ga0395901_0045436
616 Ga0395901_0089308
617 Ga0395901_0216376
618 Ga0395901_0319075
619 Ga0395901_0473510
620 Ga0395901_0551159
621 Ga0436365_0351532
622 Ga0436363_1448349
623 Ga0466969_0036691
624 Ga0466966_0000678
625 Ga0466966_0038168
626 Ga0466961_0002905
627 Ga0466961_0007370
628 Ga0466961_0062763
629 Ga0466963_0000661
630 Ga0466963_0002252
631 Ga0466963_0006726
632 Ga0466963_0015398
633 Ga0466963_0034963
634 Ga0466963_0090916
635 Ga0466963_0175796
636 Ga0466964_0000335
637 Ga0466964_0003782
638 Ga0466964_0016615
639 Ga0466964_0110065
640 Ga0466971_0001268
641 Ga0466971_0111162
642 Ga0466968_0000749
643 Ga0466970_0019033
644 Ga0466970_0041812
645 Ga0466970_0162215
646 Ga0466957_0000566
647 Ga0466957_0023375
648 Ga0466957_0060671
649 Ga0466957_0134334
650 Ga0466957_0425595
651 Ga0466957_0473821
652 Ga0466959_0001055
653 Ga0466959_0007108
654 Ga0466959_0030465
655 Ga0466959_0038112
656 Ga0466959_0079300
657 Ga0466959_0140513
658 Ga0466958_0000591
659 Ga0466958_0000942
660 Ga0466958_0002736
661 Ga0466958_0030610
662 Ga0466958_0132361
663 Ga0466958_0216408
664 Ga0466967_0003466
665 Ga0466967_0007851
666 Ga0466967_0008878
667 Ga0466967_0025408
668 Ga0466967_0025994
669 Ga0466967_0114224
670 Ga0466967_0115491
671 Ga0466967_0122941
672 Ga0466967_0123298
673 Ga0466967_0174403
674 Ga0466967_0291423
675 Ga0466967_0352276
676 Ga0495592_0183138
677 Ga0495592_0256956
678 Ga0495603_0149523
679 Ga0495629_0015080
680 Ga0495629_0166355
681 Ga0495641_0001273
682 Ga0495641_0027139
683 Ga0495641_0114582
684 Ga0495653_0115596
685 Ga0495582_0000066
686 Ga0495639_0001852
687 Ga0495662_0000694
688 Ga0495584_0034975
689 Ga0495594_0159746
690 Ga0495594_0207807
691 Ga0495608_0349313
692 Ga0495618_0123715
693 Ga0495618_0320961
694 Ga0495628_0035162
695 Ga0495630_0004203
696 Ga0495630_0135282
697 Ga0495637_0080439
698 Ga0495652_0077444
699 Ga0495665_0000252
700 Ga0495640_0095695
701 Ga0495586_0057388
702 Ga0495667_0019051
703 Ga0495667_0104540
704 Ga0495634_0039339
705 Ga0495634_0099779
706 Ga0495634_0146085
707 Ga0495588_0171889
708 Ga0495599_0023520
709 Ga0495647_0089126
710 Ga0495658_0004118
711 Ga0495658_0007364
712 Ga0495658_0027070
713 Ga0495613_0036684
714 Ga0495613_0232110
715 Ga0495670_0147490
716 Ga0495600_0140681
717 Ga0495600_0373273
718 Ga0495581_0006426
719 Ga0495604_0217950
720 Ga0495636_0118626
721 Ga0495674_0010412
722 Ga0495674_0044530
723 Ga0495674_0047570
724 Ga0495676_0041764
725 Ga0495680_0023945
726 Ga0495680_0031820
727 Ga0495680_0050489
728 Ga0495680_0356259
729 Ga0495684_0033235
730 Ga0496100_0074128
731 Ga0496101_0050157
732 Ga0496101_0054597
733 Ga0496101_0063944
734 Ga0496101_0070818
735 Ga0496101_0143199
736 Ga0496101_0206317
737 Ga0496101_0227392
738 Ga0496101_0270003
739 Ga0496102_0079532
740 Ga0496102_0206187
741 Ga0496103_0209108
742 Ga0496104_0057009
743 Ga0496104_0108954
744 Ga0496104_0309354
745 Ga0496105_0005357
746 Ga0496105_0290610
747 Ga0496106_0176397
748 Ga0496107_0028251
749 Ga0496107_0073407
750 Ga0496109_0005677
751 Ga0496110_0056022
752 Ga0496110_0097973
753 Ga0496110_0207453
754 Ga0496113_0026109
755 Ga0496114_0013201
756 Ga0496114_0014325
757 Ga0496114_0077797
758 Ga0496114_0177581
759 Ga0496114_0429123
760 Ga0496115_0193455
761 Ga0496115_0340391
762 Ga0501032_0249758
763 Ga0501040_0099620
764 Ga0501043_0432841
765 Ga0501047_0032312
766 Ga0501047_0353941
767 Ga0501069_0011020
768 Ga0501070_0002110
769 Ga0501070_0016229
770 Ga0501070_0179279
771 Ga0501073_0171817
772 Ga0501074_0015892
773 Ga0501074_0155999
774 Ga0501074_0208321
775 Ga0501080_0058185
776 Ga0501080_0077076
777 Ga0501080_0206577
778 Ga0501044_0127700
779 Ga0501044_0465050
780 nmdc:mga05p37_503562_c1
781 Ga0495601_0136796
782 Ga0495595_0001437
783 Ga0495595_0163607
784 Ga0495619_0008847
785 Ga0495619_0084438
786 Ga0495619_0340251
787 Ga0495619_0510043
788 Ga0466962_0022368
789 Ga0466962_0091062
790 Ga0466962_0094880

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00483

NTP_transferase

Nucleotidyl transferase

2

242

0.83

PF12804

NTP_transf_3

MobA-like NTP transferase domain

3

212

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
5z0a-assembly2.cif.gz_C-3 st0452(y97n)-glcnac binding form 0.881 1 232
5z0a-assembly1.cif.gz_E-2 st0452(y97n)-glcnac binding form 0.8618 1 232
7d73-assembly1.cif.gz_A cryo-em structure of gmppa/gmppb complex bound to gtp (state i) 0.8534 2 237
5l6v-assembly1.cif.gz_D crystal structure of e. coli adp-glucose pyrophosphorylase (agpase) in complex with a negative allosteric regulator adenosine monophosphate (amp) - agpase*amp 0.853 2 230
5l6v-assembly2.cif.gz_H crystal structure of e. coli adp-glucose pyrophosphorylase (agpase) in complex with a negative allosteric regulator adenosine monophosphate (amp) - agpase*amp 0.8519 2 230
ID Description Score Start End Superfamily
af_Q1RM52_1_272_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9043 1 234 3.90.550.10
af_F6NZ60_1_274_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8638 1 238 3.90.550.10
af_Q58501_1_209_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.855 1 221 3.90.550.10
5z0aE01 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8549 1 221 3.90.550.10
4ecmA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8546 2 234 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A1G1PIN9-F1-model_v4 Nucleotidyl transferase domain-containing protein 0.963 1 234 GO:0009058
AF-A0A358AE60-F1-model_v4 Nucleoside-diphosphate-sugar pyrophosphorylase 0.9627 2 237 GO:0009058
AF-A0A7J4TG24-F1-model_v4 NDP-sugar synthase 0.9624 106 235 GO:0009058
AF-A0A1G1Q4J3-F1-model_v4 Nucleotidyl transferase domain-containing protein 0.9603 1 237 GO:0009058
AF-A0A2G9YIK8-F1-model_v4 Nucleoside-diphosphate-sugar pyrophosphorylase 0.9594 1 230 GO:0009058

Map