F433221

General Info

Members Datasets Scaffolds Average Seq Length
395 182 395 371

Family's Representative Sequence

Representative Sequence 3300025899|Ga0207642_10113467|Ga0207642_101134672
Length 400
Sequence MMNRSDKSGFANWWFTVDRVALLCMLALAGIGLMLAFAASPAITGGPLTAGDFRYSARQVAFAAMAIGILGGVSLLNLRQIRIVAAVAFACALIGSFLVLFIGADLLGARRELDFGAFSLQPSEFLKPSFAILAAAVLADRQPLSIPKPVVTLLLLVPALVILIRQPDVGQTGLLLCLWGAMLFVWVGAGLGAAGALGLAAYEIFPHVHHRVDQYLSESDTGYQAGLALKAFAHGGLSGVGPGAGTIKYRIPDAHSDFIFAVAGEEFGFLLCGLIALLFCVLTVRLLLRSAGSREPFAQLAGAGLAVVTGVQAFINMGVAVSLLPAKGMTLPFISYGGSSLVPTLAGVGILLNISQYAPLGGRAGYDEGDYEDEWQLERPAKKRRPVRQSRQAGTRPRYG

Samples

Sample ID Description Type Environment
1 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
59 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
60 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
61 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
62 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
104 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
105 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
108 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
109 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
110 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
111 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
112 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
113 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
114 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
115 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
116 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
117 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
118 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
119 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
120 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
121 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
122 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
123 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
124 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
125 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
130 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
131 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
132 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
133 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
134 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
135 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
136 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
137 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
138 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
139 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
140 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
141 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
142 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
143 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
144 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
145 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
146 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
147 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
148 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
149 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
150 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
151 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
165 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
166 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
167 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
168 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
169 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
170 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
171 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
172 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
173 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
175 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
176 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
177 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
178 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
179 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
180 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
181 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
182 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.53
Nodule 0
Rhizoplane 0.25
Rhizosphere 93.67
Stem 0
Stem Tuber 0
Unclassified 3.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000008 3300003214 Bacteria 478603
2 Ga0070658_10014463 3300005327 Bacteria 6332
3 Ga0070658_10022236 3300005327 Bacteria 5089
4 Ga0070683_100051559 3300005329 Bacteria 3810
5 Ga0070683_100084470 3300005329 Bacteria 2974
6 Ga0070690_100009252 3300005330 Bacteria 5701
7 Ga0070670_100096234 3300005331 Bacteria 2547
8 Ga0068869_100194122 3300005334 Bacteria 1598
9 Ga0070680_100000033 3300005336 Bacteria 70320
10 Ga0068868_100121263 3300005338 Bacteria 2133
11 Ga0068868_100240706 3300005338 Bacteria 1520
12 Ga0070660_100032632 3300005339 Bacteria 3920
13 Ga0070660_100091954 3300005339 Bacteria 2394
14 Ga0070691_10000472 3300005341 Bacteria 15009
15 Ga0070675_100233802 3300005354 Bacteria 1604
16 Ga0070673_100007134 3300005364 Bacteria 7339
17 Ga0070673_100084553 3300005364 Bacteria 2581
18 Ga0070667_100070491 3300005367 Bacteria 2975
19 Ga0070667_100188107 3300005367 Bacteria 1828
20 Ga0070709_10000425 3300005434 Bacteria 25583
21 Ga0070713_100003972 3300005436 Bacteria 9836
22 Ga0070713_100191200 3300005436 Bacteria 1844
23 Ga0070713_100385147 3300005436 Bacteria 1307
24 Ga0070710_10108653 3300005437 Bacteria 1663
25 Ga0070711_100029916 3300005439 Bacteria 3599
26 Ga0070711_100033441 3300005439 Bacteria 3424
27 Ga0070678_100018078 3300005456 Bacteria 4560
28 Ga0070678_100043533 3300005456 Bacteria 3199
29 Ga0070681_10000002 3300005458 Bacteria 821814
30 Ga0070681_10042284 3300005458 Bacteria 4567
31 Ga0070681_10086399 3300005458 Bacteria 3090
32 Ga0070681_10328042 3300005458 Bacteria 1440
33 Ga0070681_10352593 3300005458 Bacteria 1382
34 Ga0068867_100002010 3300005459 Bacteria 14200
35 Ga0068867_100143474 3300005459 Bacteria 1869
36 Ga0068867_100326332 3300005459 Bacteria 1273
37 Ga0070679_100000132 3300005530 Bacteria 59984
38 Ga0070679_100030259 3300005530 Bacteria 5345
39 Ga0070679_100080876 3300005530 Bacteria 3238
40 Ga0070679_100092077 3300005530 Bacteria 3019
41 Ga0070679_100144407 3300005530 Bacteria 2358
42 Ga0070684_100072542 3300005535 Bacteria 3031
43 Ga0070684_100088282 3300005535 Bacteria 2754
44 Ga0070665_100005488 3300005548 Bacteria 13067
45 Ga0070665_100047014 3300005548 Bacteria 4332
46 Ga0070665_100060204 3300005548 Bacteria 3806
47 Ga0070665_100167493 3300005548 Bacteria 2199
48 Ga0070665_100294241 3300005548 Bacteria 1626
49 Ga0068855_100001071 3300005563 Bacteria 33976
50 Ga0068855_100058445 3300005563 Bacteria 4516
51 Ga0068855_100066779 3300005563 Bacteria 4193
52 Ga0068855_100506318 3300005563 Bacteria 1311
53 Ga0068857_100000460 3300005577 Bacteria 28997
54 Ga0068857_100127875 3300005577 Bacteria 2290
55 Ga0068856_100001033 3300005614 Bacteria 29595
56 Ga0068856_100005319 3300005614 Bacteria 12709
57 Ga0068852_100009931 3300005616 Bacteria 7087
58 Ga0068863_100086478 3300005841 Bacteria 2971
59 Ga0068858_100006351 3300005842 Bacteria 11509
60 Ga0068858_100058322 3300005842 Bacteria 3569
61 Ga0070716_100056890 3300006173 Bacteria 2245
62 Ga0070712_100000771 3300006175 Bacteria 18893
63 Ga0070712_100008499 3300006175 Bacteria 6457
64 Ga0097621_100001594 3300006237 Bacteria 15517
65 Ga0097621_100054970 3300006237 Bacteria 3250
66 Ga0068871_100000187 3300006358 Bacteria 42079
67 Ga0068871_100027581 3300006358 Bacteria 4443
68 Ga0068865_100002404 3300006881 Bacteria 11044
69 Ga0075436_100000024 3300006914 Bacteria 115057
70 Ga0099795_10045709 3300007788 Bacteria 1575
71 Ga0105240_10000582 3300009093 Bacteria 67645
72 Ga0105240_10005535 3300009093 Bacteria 18812
73 Ga0105240_10008320 3300009093 Bacteria 14846
74 Ga0105240_10017299 3300009093 Bacteria 9720
75 Ga0105240_10030629 3300009093 Bacteria 6991
76 Ga0105240_10046427 3300009093 Bacteria 5503
77 Ga0105240_10066096 3300009093 Bacteria 4487
78 Ga0105240_10141984 3300009093 Bacteria 2870
79 Ga0105240_10183183 3300009093 Bacteria 2470
80 Ga0105240_10191230 3300009093 Bacteria 2407
81 Ga0105240_10319316 3300009093 Bacteria 1771
82 Ga0105245_10011046 3300009098 Bacteria 7862
83 Ga0105243_10004989 3300009148 Bacteria 10401
84 Ga0105241_10013448 3300009174 Bacteria 5999
85 Ga0105241_10022987 3300009174 Bacteria 4622
86 Ga0105241_10054231 3300009174 Bacteria 3068
87 Ga0105241_10056264 3300009174 Bacteria 3016
88 Ga0105241_10262132 3300009174 Bacteria 1469
89 Ga0105242_10012270 3300009176 Bacteria 6596
90 Ga0105248_10000015 3300009177 Bacteria 322959
91 Ga0105248_10062159 3300009177 Bacteria 4194
92 Ga0105237_10094918 3300009545 Bacteria 2972
93 Ga0105237_10095577 3300009545 Bacteria 2961
94 Ga0105237_10153699 3300009545 Bacteria 2297
95 Ga0105237_10280892 3300009545 Bacteria 1667
96 Ga0105238_10001006 3300009551 Bacteria 28764
97 Ga0105238_10073632 3300009551 Bacteria 3410
98 Ga0105238_10087979 3300009551 Bacteria 3093
99 Ga0105238_10140595 3300009551 Bacteria 2391
100 Ga0105238_10163785 3300009551 Bacteria 2199
101 Ga0105239_10005765 3300010375 Bacteria 14448
102 Ga0105239_10009991 3300010375 Bacteria 10651
103 Ga0105239_10021245 3300010375 Bacteria 7157
104 Ga0105246_10012293 3300011119 Bacteria 5338
105 Ga0105246_10029568 3300011119 Bacteria 3610
106 Ga0157373_10006707 3300013100 Bacteria 8570
107 Ga0157370_10005161 3300013104 Bacteria 14724
108 Ga0157370_10025266 3300013104 Bacteria 5880
109 Ga0157369_10020301 3300013105 Bacteria 7425
110 Ga0157369_10093799 3300013105 Bacteria 3204
111 Ga0157369_10136464 3300013105 Bacteria 2597
112 Ga0157378_10013080 3300013297 Bacteria 7260
113 Ga0157378_10114700 3300013297 Bacteria 2475
114 Ga0157378_10154905 3300013297 Bacteria 2138
115 Ga0157378_10267588 3300013297 Bacteria 1642
116 Ga0163162_10161352 3300013306 Bacteria 2363
117 Ga0157372_10003944 3300013307 Bacteria 15940
118 Ga0157372_10103479 3300013307 Bacteria 3254
119 Ga0157375_10084490 3300013308 Bacteria 3223
120 Ga0163163_10000150 3300014325 Bacteria 72638
121 Ga0163163_10025474 3300014325 Bacteria 5639
122 Ga0163163_10177865 3300014325 Bacteria 2174
123 Ga0157380_10247252 3300014326 Bacteria 1612
124 Ga0157379_10001081 3300014968 Bacteria 22242
125 Ga0157379_10002727 3300014968 Bacteria 14903
126 Ga0157379_10008993 3300014968 Bacteria 8707
127 Ga0157376_10028653 3300014969 Bacteria 4428
128 Ga0213874_10000813 3300021377 Bacteria 6367
129 Ga0213874_10002883 3300021377 Bacteria 3750
130 Ga0213876_10001035 3300021384 Bacteria 17965
131 Ga0213876_10003451 3300021384 Bacteria 9038
132 Ga0213876_10077688 3300021384 Bacteria 1753
133 Ga0209233_1000006 3300025261 Bacteria 1473685
134 Ga0209233_1013325 3300025261 Bacteria 2351
135 Ga0209758_1000032 3300025297 Bacteria 481623
136 Ga0209758_1025559 3300025297 Bacteria 2587
137 Ga0207692_10107008 3300025898 Bacteria 1545
138 Ga0207642_10113467 3300025899 Bacteria 1384
139 Ga0207699_10000188 3300025906 Bacteria 37593
140 Ga0207705_10025001 3300025909 Bacteria 4263
141 Ga0207705_10165879 3300025909 Bacteria 1661
142 Ga0207654_10010868 3300025911 Bacteria 4633
143 Ga0207654_10010929 3300025911 Bacteria 4622
144 Ga0207654_10060464 3300025911 Bacteria 2213
145 Ga0207707_10000002 3300025912 Bacteria 1142054
146 Ga0207707_10218463 3300025912 Bacteria 1659
147 Ga0207695_10000004 3300025913 Bacteria 1288665
148 Ga0207695_10003813 3300025913 Bacteria 20893
149 Ga0207695_10034298 3300025913 Bacteria 5522
150 Ga0207695_10036901 3300025913 Bacteria 5278
151 Ga0207695_10055567 3300025913 Bacteria 4125
152 Ga0207695_10084333 3300025913 Bacteria 3208
153 Ga0207695_10142570 3300025913 Bacteria 2343
154 Ga0207695_10227327 3300025913 Bacteria 1771
155 Ga0207695_10258160 3300025913 Bacteria 1641
156 Ga0207671_10013066 3300025914 Bacteria 6636
157 Ga0207671_10078992 3300025914 Bacteria 2465
158 Ga0207671_10116496 3300025914 Bacteria 2038
159 Ga0207693_10002656 3300025915 Bacteria 15531
160 Ga0207693_10013938 3300025915 Bacteria 6473
161 Ga0207663_10010363 3300025916 Bacteria 4959
162 Ga0207663_10028054 3300025916 Bacteria 3290
163 Ga0207660_10000010 3300025917 Bacteria 92859
164 Ga0207657_10016622 3300025919 Bacteria 7089
165 Ga0207657_10019332 3300025919 Bacteria 6473
166 Ga0207657_10203147 3300025919 Bacteria 1593
167 Ga0207649_10123955 3300025920 Bacteria 1746
168 Ga0207652_10000053 3300025921 Bacteria 118700
169 Ga0207652_10007780 3300025921 Bacteria 8612
170 Ga0207694_10000015 3300025924 Bacteria 363898
171 Ga0207694_10039268 3300025924 Bacteria 3642
172 Ga0207694_10043895 3300025924 Bacteria 3450
173 Ga0207694_10177647 3300025924 Bacteria 1725
174 Ga0207650_10074245 3300025925 Bacteria 2563
175 Ga0207687_10015623 3300025927 Bacteria 4980
176 Ga0207700_10000014 3300025928 Bacteria 229475
177 Ga0207700_10140686 3300025928 Bacteria 1983
178 Ga0207700_10256409 3300025928 Bacteria 1496
179 Ga0207664_10014460 3300025929 Bacteria 5699
180 Ga0207644_10183300 3300025931 Bacteria 1642
181 Ga0207690_10068039 3300025932 Bacteria 2445
182 Ga0207686_10005856 3300025934 Bacteria 6596
183 Ga0207686_10120200 3300025934 Bacteria 1787
184 Ga0207704_10006475 3300025938 Bacteria 5463
185 Ga0207704_10247180 3300025938 Bacteria 1337
186 Ga0207691_10133428 3300025940 Bacteria 2192
187 Ga0207711_10000003 3300025941 Bacteria 1042791
188 Ga0207711_10000005 3300025941 Bacteria 822972
189 Ga0207711_10000009 3300025941 Bacteria 580864
190 Ga0207711_10036178 3300025941 Bacteria 4188
191 Ga0207689_10002312 3300025942 Bacteria 17850
192 Ga0207689_10013425 3300025942 Bacteria 6993
193 Ga0207689_10171640 3300025942 Bacteria 1788
194 Ga0207661_10070601 3300025944 Bacteria 2852
195 Ga0207661_10119757 3300025944 Bacteria 2239
196 Ga0207667_10000226 3300025949 Bacteria 79075
197 Ga0207667_10005475 3300025949 Bacteria 15477
198 Ga0207667_10051420 3300025949 Bacteria 4344
199 Ga0207667_10204152 3300025949 Bacteria 2027
200 Ga0207651_10031380 3300025960 Bacteria 3396
201 Ga0207651_10115505 3300025960 Bacteria 2024
202 Ga0207712_10051705 3300025961 Bacteria 2875
203 Ga0207658_10151849 3300025986 Bacteria 1888
204 Ga0207677_10050524 3300026023 Bacteria 2813
205 Ga0207703_10030870 3300026035 Bacteria 4236
206 Ga0207703_10043502 3300026035 Bacteria 3605
207 Ga0207678_10088775 3300026067 Bacteria 2642
208 Ga0207702_10000011 3300026078 Bacteria 284514
209 Ga0207648_10008985 3300026089 Bacteria 9610
210 Ga0207648_10009057 3300026089 Bacteria 9575
211 Ga0207674_10000002 3300026116 Bacteria 279738
212 Ga0207674_10167070 3300026116 Bacteria 2154
213 Ga0207683_10013175 3300026121 Bacteria 7055
214 Ga0207683_10053957 3300026121 Bacteria 3525
215 Ga0207683_10124811 3300026121 Bacteria 2313
216 Ga0207698_10003037 3300026142 Bacteria 10059
217 Ga0207698_10030875 3300026142 Bacteria 3860
218 Ga0207698_10051816 3300026142 Bacteria 3140
219 Ga0268266_10001115 3300028379 Bacteria 33566
220 Ga0268266_10104420 3300028379 Bacteria 2502
221 Ga0268266_10114856 3300028379 Bacteria 2389
222 Ga0268266_10147553 3300028379 Bacteria 2116
223 Ga0268264_10089924 3300028381 Bacteria 2645
224 Ga0265337_1003396 3300028556 Bacteria 6915
225 Ga0265334_10001843 3300028573 Bacteria 10083
226 Ga0265318_10000025 3300028577 Bacteria 159237
227 Ga0265318_10007334 3300028577 Bacteria 4992
228 Ga0265338_10000007 3300028800 Bacteria 498229
229 Ga0265338_10007502 3300028800 Bacteria 13509
230 Ga0265338_10008377 3300028800 Bacteria 12560
231 Ga0265338_10012713 3300028800 Bacteria 9577
232 Ga0265338_10036628 3300028800 Bacteria 4691
233 Ga0265338_10106686 3300028800 Bacteria 2267
234 Ga0265330_10067020 3300031235 Bacteria 1556
235 Ga0265332_10006311 3300031238 Bacteria 5389
236 Ga0265332_10012038 3300031238 Bacteria 3840
237 Ga0265332_10056503 3300031238 Bacteria 1682
238 Ga0265328_10043915 3300031239 Bacteria 1644
239 Ga0265320_10000209 3300031240 Bacteria 47757
240 Ga0265320_10056268 3300031240 Bacteria 1890
241 Ga0265325_10000001 3300031241 Bacteria 726814
242 Ga0265325_10000451 3300031241 Bacteria 29659
243 Ga0265325_10000845 3300031241 Bacteria 22173
244 Ga0265325_10003046 3300031241 Bacteria 11083
245 Ga0265325_10013215 3300031241 Bacteria 4704
246 Ga0265340_10000052 3300031247 Bacteria 54270
247 Ga0265340_10000319 3300031247 Bacteria 25435
248 Ga0265340_10035846 3300031247 Bacteria 2462
249 Ga0265340_10098823 3300031247 Bacteria 1358
250 Ga0265339_10001432 3300031249 Bacteria 17696
251 Ga0265339_10002951 3300031249 Bacteria 12022
252 Ga0265339_10044751 3300031249 Bacteria 2440
253 Ga0265331_10000037 3300031250 Bacteria 197251
254 Ga0265331_10002902 3300031250 Bacteria 11329
255 Ga0265331_10045339 3300031250 Bacteria 2123
256 Ga0265316_10000747 3300031344 Bacteria 35907
257 Ga0265316_10052570 3300031344 Bacteria 3195
258 Ga0265313_10000650 3300031595 Bacteria 35724
259 Ga0265313_10001440 3300031595 Bacteria 22235
260 Ga0265313_10001587 3300031595 Bacteria 21094
261 Ga0265313_10017588 3300031595 Bacteria 4054
262 Ga0265313_10026782 3300031595 Bacteria 3030
263 Ga0265313_10028635 3300031595 Bacteria 2892
264 Ga0265314_10003160 3300031711 Bacteria 16144
265 Ga0265314_10007122 3300031711 Bacteria 9747
266 Ga0265314_10008337 3300031711 Bacteria 8883
267 Ga0265314_10023936 3300031711 Bacteria 4642
268 Ga0265314_10044906 3300031711 Bacteria 3128
269 Ga0265314_10066658 3300031711 Bacteria 2427
270 Ga0265314_10069791 3300031711 Bacteria 2357
271 Ga0265342_10005564 3300031712 Bacteria 9557
272 Ga0265342_10031866 3300031712 Bacteria 3254
273 Ga0265342_10107958 3300031712 Bacteria 1578
274 Ga0307516_10014810 3300031730 Bacteria 8233
275 Ga0307516_10029921 3300031730 Bacteria 5501
276 Ga0373926_0052226 3300035083 Bacteria 1477
277 Ga0373954_0059982 3300035118 Bacteria 1794
278 Ga0373955_0041849 3300035172 Bacteria 2458
279 Ga0373955_0099027 3300035172 Bacteria 1671
280 Ga0373931_0039558 3300035691 Bacteria 2471
281 Ga0373931_0079449 3300035691 Bacteria 1807
282 Ga0373927_0028046 3300035695 Bacteria 3674
283 Ga0373937_0009654 3300036401 Bacteria 8403
284 Ga0373937_0047900 3300036401 Bacteria 3911
285 Ga0373937_0134171 3300036401 Bacteria 2314
286 Ga0373937_0173907 3300036401 Bacteria 2021
287 Ga0373937_0274452 3300036401 Bacteria 1591
288 Ga0373925_0054697 3300037068 Bacteria 2986
289 Ga0395900_0051849 3300037418 Bacteria 4225
290 Ga0395901_0036923 3300038443 Bacteria 5052
291 Ga0436365_0935666 3300039437 Bacteria 1913
292 Ga0436365_1712708 3300039437 Bacteria 68148
293 Ga0436365_1797404 3300039437 Bacteria 129057
294 Ga0436363_0215436 3300039450 Bacteria 12449
295 Ga0436363_0410036 3300039450 Bacteria 3862
296 Ga0436362_0762902 3300039453 Bacteria 1618
297 Ga0495651_0196779 3300046462 Bacteria 1414
298 Ga0495594_0192217 3300046499 Bacteria 1163
299 Ga0495606_0102062 3300046507 Bacteria 1745
300 Ga0495640_0078089 3300046533 Bacteria 2206
301 Ga0495586_0002921 3300046535 Bacteria 9221
302 Ga0495587_0021320 3300046536 Bacteria 3996
303 Ga0495609_0059776 3300046538 Bacteria 1685
304 Ga0495621_0015160 3300046539 Bacteria 2454
305 Ga0495645_0022193 3300046543 Bacteria 4591
306 Ga0495622_0015488 3300046557 Bacteria 3544
307 Ga0495624_0171666 3300046690 Bacteria 1323
308 Ga0495600_0028662 3300046809 Bacteria 3603
309 Ga0495674_0040295 3300047319 Bacteria 4179
310 Ga0495675_0032430 3300047444 Bacteria 3334
311 Ga0495684_0074018 3300047471 Bacteria 2588
312 Ga0496106_0270258 3300048909 Bacteria 1361
313 Ga0496121_0000701 3300048924 Bacteria 62310
314 Ga0496126_0000406 3300048929 Bacteria 87599
315 Ga0495682_0000834 3300049460 Bacteria 19318
316 Ga0501031_0166469 3300049568 Bacteria 1441
317 Ga0501032_0019423 3300049569 Bacteria 4754
318 Ga0501032_0039223 3300049569 Bacteria 3222
319 Ga0501033_0010391 3300049570 Bacteria 7139
320 Ga0501033_0020194 3300049570 Bacteria 5036
321 Ga0501033_0134359 3300049570 Bacteria 1790
322 Ga0501033_0220440 3300049570 Bacteria 1350
323 Ga0501034_0013092 3300049571 Bacteria 8549
324 Ga0501034_0046901 3300049571 Bacteria 4365
325 Ga0501036_0035433 3300049572 Bacteria 4224
326 Ga0501037_0045186 3300049573 Bacteria 3233
327 Ga0501038_0008300 3300049574 Bacteria 9560
328 Ga0501038_0273940 3300049574 Bacteria 1330
329 Ga0501039_0008408 3300049575 Bacteria 7865
330 Ga0501042_0166137 3300049578 Bacteria 1592
331 Ga0501043_0033739 3300049579 Bacteria 4027
332 Ga0501043_0113175 3300049579 Bacteria 2131
333 Ga0501046_0006668 3300049580 Bacteria 10196
334 Ga0501046_0007702 3300049580 Bacteria 9443
335 Ga0501047_0003622 3300049581 Bacteria 14557
336 Ga0501047_0007721 3300049581 Bacteria 10129
337 Ga0501047_0008418 3300049581 Bacteria 9731
338 Ga0501047_0008670 3300049581 Bacteria 9601
339 Ga0501047_0009275 3300049581 Bacteria 9294
340 Ga0501047_0064943 3300049581 Bacteria 3519
341 Ga0501047_0124032 3300049581 Bacteria 2463
342 Ga0501048_0069941 3300049582 Bacteria 2479
343 Ga0501067_0002186 3300049583 Bacteria 10787
344 Ga0501067_0018023 3300049583 Bacteria 3909
345 Ga0501067_0059510 3300049583 Bacteria 2114
346 Ga0501069_0007809 3300049585 Bacteria 5617
347 Ga0501069_0016806 3300049585 Bacteria 3931
348 Ga0501070_0021738 3300049586 Bacteria 5377
349 Ga0501070_0235726 3300049586 Bacteria 1499
350 Ga0501072_0046283 3300049588 Bacteria 3423
351 Ga0501073_0015757 3300049589 Bacteria 5478
352 Ga0501073_0029033 3300049589 Bacteria 3952
353 Ga0501074_0003663 3300049590 Bacteria 10901
354 Ga0501074_0045333 3300049590 Bacteria 3181
355 Ga0501079_0007807 3300049741 Bacteria 8100
356 Ga0501079_0057304 3300049741 Bacteria 3006
357 Ga0501079_0121962 3300049741 Bacteria 2027
358 Ga0501079_0192469 3300049741 Bacteria 1592
359 Ga0501080_0015692 3300049742 Bacteria 6984
360 Ga0501080_0026251 3300049742 Bacteria 5412
361 Ga0501080_0114441 3300049742 Bacteria 2501
362 Ga0501083_0000426 3300049744 Bacteria 27116
363 Ga0501035_0003779 3300049822 Bacteria 14432
364 Ga0501035_0012815 3300049822 Bacteria 7743
365 Ga0501035_0018794 3300049822 Bacteria 6366
366 Ga0501035_0023096 3300049822 Bacteria 5708
367 Ga0501035_0028857 3300049822 Bacteria 5062
368 Ga0501035_0081587 3300049822 Bacteria 2854
369 Ga0501035_0083474 3300049822 Bacteria 2818
370 Ga0501035_0213378 3300049822 Bacteria 1651
371 Ga0501044_0008013 3300049823 Bacteria 11609
372 Ga0501044_0009729 3300049823 Bacteria 10460
373 Ga0501044_0010182 3300049823 Bacteria 10213
374 Ga0501044_0017288 3300049823 Bacteria 7736
375 Ga0501044_0021988 3300049823 Bacteria 6801
376 Ga0501044_0141614 3300049823 Bacteria 2393
377 Ga0501044_0207964 3300049823 Bacteria 1912
378 Ga0501044_0257672 3300049823 Bacteria 1683
379 Ga0501044_0353581 3300049823 Bacteria 1388
380 Ga0501044_0366257 3300049823 Bacteria 1358
381 nmdc:mga06r32_108802_c1 3300050510 Bacteria 2725
382 nmdc:mga08x19_86_c1 3300050514 Bacteria 83486
383 Ga0500643_000008 3300053087 Bacteria 457931
384 Ga0500595_000827 3300053119 Bacteria 17705
385 Ga0500595_004077 3300053119 Bacteria 6639
386 Ga0500573_0000062 3300053140 Bacteria 67407
387 Ga0500619_001654 3300053154 Bacteria 4022
388 Ga0501084_0000074 3300054114 Bacteria 72522
389 Ga0501084_0019849 3300054114 Bacteria 5601
390 Ga0501084_0036838 3300054114 Bacteria 4087
391 Ga0501084_0113653 3300054114 Bacteria 2276
392 Ga0501084_0311847 3300054114 Bacteria 1329
393 Ga0501082_0018962 3300060353 Bacteria 5927
394 Ga0501082_0056468 3300060353 Bacteria 3382
395 Ga0501082_0070082 3300060353 Bacteria 3019

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049568 Ga0501031_0166469 Ga0501031_0166469_10_1035 314
2 3300049823 Ga0501044_0353581 Ga0501044_0353581_19_1020 316
3 3300046543 Ga0495645_0022193 Ga0495645_0022193_14_1117 324
4 3300046462 Ga0495651_0196779 Ga0495651_0196779_37_1185 338
5 3300046809 Ga0495600_0028662 Ga0495600_0028662_531_1679 338
6 3300047444 Ga0495675_0032430 Ga0495675_0032430_264_1412 338
7 3300046499 Ga0495594_0192217 Ga0495594_0192217_17_1048 341
8 3300054114 Ga0501084_0113653 Ga0501084_0113653_1202_2248 346
9 3300005563 Ga0068855_100058445 Ga0068855_1000584452 348
10 3300009093 Ga0105240_10005535 Ga0105240_100055358 348
11 3300009093 Ga0105240_10017299 Ga0105240_100172995 348
12 3300009093 Ga0105240_10030629 Ga0105240_100306293 348
13 3300009093 Ga0105240_10141984 Ga0105240_101419842 348
14 3300009093 Ga0105240_10191230 Ga0105240_101912301 348
15 3300009174 Ga0105241_10054231 Ga0105241_100542313 348
16 3300009174 Ga0105241_10056264 Ga0105241_100562643 348
17 3300009545 Ga0105237_10094918 Ga0105237_100949182 348
18 3300009545 Ga0105237_10095577 Ga0105237_100955772 348
19 3300009551 Ga0105238_10087979 Ga0105238_100879793 348
20 3300025909 Ga0207705_10165879 Ga0207705_101658792 348
21 3300025911 Ga0207654_10060464 Ga0207654_100604642 348
22 3300025913 Ga0207695_10003813 Ga0207695_1000381310 348
23 3300025913 Ga0207695_10034298 Ga0207695_100342983 348
24 3300025913 Ga0207695_10036901 Ga0207695_100369013 348
25 3300025914 Ga0207671_10013066 Ga0207671_100130666 348
26 3300025919 Ga0207657_10203147 Ga0207657_102031472 348
27 3300025924 Ga0207694_10039268 Ga0207694_100392682 348
28 3300025924 Ga0207694_10043895 Ga0207694_100438953 348
29 3300025949 Ga0207667_10005475 Ga0207667_1000547513 348
30 3300031250 Ga0265331_10000037 Ga0265331_10000037139 348
31 3300031711 Ga0265314_10008337 Ga0265314_100083378 348
32 3300037418 Ga0395900_0051849 Ga0395900_0051849_1345_2496 348
33 3300038443 Ga0395901_0036923 Ga0395901_0036923_1185_2336 348
34 3300049570 Ga0501033_0010391 Ga0501033_0010391_1517_2668 348
35 3300049579 Ga0501043_0113175 Ga0501043_0113175_481_1632 348
36 3300049581 Ga0501047_0008670 Ga0501047_0008670_4536_5687 348
37 3300049822 Ga0501035_0012815 Ga0501035_0012815_3487_4638 348
38 3300049823 Ga0501044_0009729 Ga0501044_0009729_1866_3017 348
39 3300028800 Ga0265338_10106686 Ga0265338_101066862 351
40 3300031241 Ga0265325_10003046 Ga0265325_100030466 351
41 3300031595 Ga0265313_10026782 Ga0265313_100267822 351
42 3300005530 Ga0070679_100030259 Ga0070679_1000302592 356
43 3300007788 Ga0099795_10045709 Ga0099795_100457092 356
44 3300025912 Ga0207707_10218463 Ga0207707_102184632 356
45 3300025921 Ga0207652_10007780 Ga0207652_100077804 356
46 3300046536 Ga0495587_0021320 Ga0495587_0021320_2336_3487 356
47 3300049581 Ga0501047_0124032 Ga0501047_0124032_71_1222 356
48 3300049822 Ga0501035_0213378 Ga0501035_0213378_279_1430 356
49 3300049823 Ga0501044_0141614 Ga0501044_0141614_882_2033 356
50 3300025938 Ga0207704_10247180 Ga0207704_102471802 357
51 3300009174 Ga0105241_10013448 Ga0105241_100134483 358
52 3300049742 Ga0501080_0114441 Ga0501080_0114441_1383_2486 359
53 3300031238 Ga0265332_10006311 Ga0265332_100063112 360
54 3300005436 Ga0070713_100385147 Ga0070713_1003851471 361
55 3300025928 Ga0207700_10256409 Ga0207700_102564092 361
56 3300031730 Ga0307516_10014810 Ga0307516_100148102 361
57 3300036401 Ga0373937_0134171 Ga0373937_0134171_324_1436 361
58 3300048929 Ga0496126_0000406 Ga0496126_0000406_20547_21692 361
59 3300005436 Ga0070713_100191200 Ga0070713_1001912002 362
60 3300006175 Ga0070712_100008499 Ga0070712_1000084995 362
61 3300025915 Ga0207693_10013938 Ga0207693_100139385 362
62 3300025928 Ga0207700_10140686 Ga0207700_101406862 362
63 3300031241 Ga0265325_10000845 Ga0265325_1000084516 362
64 3300031730 Ga0307516_10029921 Ga0307516_100299215 362
65 3300035118 Ga0373954_0059982 Ga0373954_0059982_12_1130 362
66 3300046538 Ga0495609_0059776 Ga0495609_0059776_137_1288 362
67 3300053119 Ga0500595_000827 Ga0500595_000827_4506_5651 362
68 3300005439 Ga0070711_100029916 Ga0070711_1000299162 363
69 3300014968 Ga0157379_10008993 Ga0157379_100089935 363
70 3300025916 Ga0207663_10010363 Ga0207663_100103634 363
71 3300035172 Ga0373955_0041849 Ga0373955_0041849_733_1881 363
72 3300035695 Ga0373927_0028046 Ga0373927_0028046_1985_3133 363
73 3300037068 Ga0373925_0054697 Ga0373925_0054697_739_1887 363
74 3300049581 Ga0501047_0009275 Ga0501047_0009275_6973_8115 363
75 3300049822 Ga0501035_0003779 Ga0501035_0003779_12056_13198 363
76 3300049823 Ga0501044_0008013 Ga0501044_0008013_1220_2362 363
77 3300005334 Ga0068869_100194122 Ga0068869_1001941222 364
78 3300013297 Ga0157378_10013080 Ga0157378_100130806 364
79 3300025931 Ga0207644_10183300 Ga0207644_101833002 364
80 3300025942 Ga0207689_10171640 Ga0207689_101716402 364
81 3300035691 Ga0373931_0079449 Ga0373931_0079449_396_1544 364
82 3300005331 Ga0070670_100096234 Ga0070670_1000962342 365
83 3300005338 Ga0068868_100121263 Ga0068868_1001212632 365
84 3300005364 Ga0070673_100084553 Ga0070673_1000845533 365
85 3300005456 Ga0070678_100018078 Ga0070678_1000180781 365
86 3300005459 Ga0068867_100326332 Ga0068867_1003263321 365
87 3300011119 Ga0105246_10029568 Ga0105246_100295682 365
88 3300025925 Ga0207650_10074245 Ga0207650_100742452 365
89 3300025960 Ga0207651_10115505 Ga0207651_101155052 365
90 3300026023 Ga0207677_10050524 Ga0207677_100505243 365
91 3300026121 Ga0207683_10053957 Ga0207683_100539572 365
92 3300028800 Ga0265338_10000007 Ga0265338_1000000791 365
93 3300028800 Ga0265338_10008377 Ga0265338_100083774 365
94 3300031238 Ga0265332_10012038 Ga0265332_100120383 365
95 3300031238 Ga0265332_10056503 Ga0265332_100565032 365
96 3300031239 Ga0265328_10043915 Ga0265328_100439152 365
97 3300031241 Ga0265325_10000001 Ga0265325_10000001696 365
98 3300031249 Ga0265339_10001432 Ga0265339_1000143216 365
99 3300031249 Ga0265339_10044751 Ga0265339_100447512 365
100 3300031595 Ga0265313_10000650 Ga0265313_1000065019 365
101 3300031595 Ga0265313_10028635 Ga0265313_100286352 365
102 3300031711 Ga0265314_10003160 Ga0265314_100031606 365
103 3300031711 Ga0265314_10044906 Ga0265314_100449062 365
104 3300031711 Ga0265314_10066658 Ga0265314_100666582 365
105 3300031712 Ga0265342_10005564 Ga0265342_100055647 365
106 3300031712 Ga0265342_10031866 Ga0265342_100318662 365
107 3300014968 Ga0157379_10001081 Ga0157379_100010815 366
108 3300025911 Ga0207654_10010868 Ga0207654_100108683 366
109 3300026035 Ga0207703_10030870 Ga0207703_100308702 366
110 3300005339 Ga0070660_100091954 Ga0070660_1000919542 367
111 3300005458 Ga0070681_10328042 Ga0070681_103280421 367
112 3300009093 Ga0105240_10046427 Ga0105240_100464275 367
113 3300009174 Ga0105241_10262132 Ga0105241_102621321 367
114 3300009551 Ga0105238_10140595 Ga0105238_101405952 367
115 3300011119 Ga0105246_10012293 Ga0105246_100122932 367
116 3300013104 Ga0157370_10025266 Ga0157370_100252665 367
117 3300013297 Ga0157378_10267588 Ga0157378_102675882 367
118 3300013307 Ga0157372_10103479 Ga0157372_101034792 367
119 3300014325 Ga0163163_10025474 Ga0163163_100254744 367
120 3300025929 Ga0207664_10014460 Ga0207664_100144603 367
121 3300025932 Ga0207690_10068039 Ga0207690_100680392 367
122 3300025949 Ga0207667_10204152 Ga0207667_102041522 367
123 3300031241 Ga0265325_10000451 Ga0265325_100004516 367
124 3300031249 Ga0265339_10002951 Ga0265339_100029512 367
125 3300031344 Ga0265316_10052570 Ga0265316_100525702 367
126 3300049569 Ga0501032_0019423 Ga0501032_0019423_893_2044 367
127 3300049571 Ga0501034_0013092 Ga0501034_0013092_6513_7664 367
128 3300049573 Ga0501037_0045186 Ga0501037_0045186_2041_3192 367
129 3300049574 Ga0501038_0008300 Ga0501038_0008300_4595_5746 367
130 3300049575 Ga0501039_0008408 Ga0501039_0008408_4166_5317 367
131 3300049578 Ga0501042_0166137 Ga0501042_0166137_72_1223 367
132 3300049579 Ga0501043_0033739 Ga0501043_0033739_2711_3862 367
133 3300049580 Ga0501046_0007702 Ga0501046_0007702_211_1362 367
134 3300049581 Ga0501047_0008418 Ga0501047_0008418_6919_8070 367
135 3300049583 Ga0501067_0018023 Ga0501067_0018023_368_1519 367
136 3300049585 Ga0501069_0016806 Ga0501069_0016806_686_1837 367
137 3300049586 Ga0501070_0021738 Ga0501070_0021738_361_1512 367
138 3300049590 Ga0501074_0003663 Ga0501074_0003663_4790_5941 367
139 3300049741 Ga0501079_0057304 Ga0501079_0057304_1661_2812 367
140 3300049744 Ga0501083_0000426 Ga0501083_0000426_7941_9092 367
141 3300049822 Ga0501035_0083474 Ga0501035_0083474_361_1512 367
142 3300049823 Ga0501044_0366257 Ga0501044_0366257_42_1193 367
143 3300054114 Ga0501084_0036838 Ga0501084_0036838_2052_3203 367
144 3300060353 Ga0501082_0018962 Ga0501082_0018962_600_1751 367
145 3300005329 Ga0070683_100051559 Ga0070683_1000515593 368
146 3300005330 Ga0070690_100009252 Ga0070690_1000092523 368
147 3300005367 Ga0070667_100070491 Ga0070667_1000704912 368
148 3300005456 Ga0070678_100043533 Ga0070678_1000435332 368
149 3300005459 Ga0068867_100143474 Ga0068867_1001434742 368
150 3300005535 Ga0070684_100088282 Ga0070684_1000882822 368
151 3300005548 Ga0070665_100060204 Ga0070665_1000602043 368
152 3300005842 Ga0068858_100006351 Ga0068858_1000063518 368
153 3300006358 Ga0068871_100027581 Ga0068871_1000275812 368
154 3300006881 Ga0068865_100002404 Ga0068865_1000024048 368
155 3300014969 Ga0157376_10028653 Ga0157376_100286533 368
156 3300025914 Ga0207671_10078992 Ga0207671_100789922 368
157 3300025938 Ga0207704_10006475 Ga0207704_100064754 368
158 3300026089 Ga0207648_10009057 Ga0207648_100090574 368
159 3300026121 Ga0207683_10013175 Ga0207683_100131755 368
160 3300028379 Ga0268266_10104420 Ga0268266_101044202 368
161 3300028800 Ga0265338_10036628 Ga0265338_100366283 368
162 3300031235 Ga0265330_10067020 Ga0265330_100670202 368
163 3300031247 Ga0265340_10000052 Ga0265340_1000005229 368
164 3300031344 Ga0265316_10000747 Ga0265316_1000074737 368
165 3300035172 Ga0373955_0099027 Ga0373955_0099027_483_1595 368
166 3300035691 Ga0373931_0039558 Ga0373931_0039558_911_2023 368
167 3300036401 Ga0373937_0047900 Ga0373937_0047900_2106_3218 368
168 3300049570 Ga0501033_0134359 Ga0501033_0134359_10_1152 368
169 3300049589 Ga0501073_0029033 Ga0501073_0029033_2755_3894 368
170 3300049823 Ga0501044_0207964 Ga0501044_0207964_24_1163 368
171 3300049823 Ga0501044_0257672 Ga0501044_0257672_16_1158 368
172 3300005437 Ga0070710_10108653 Ga0070710_101086532 369
173 3300005458 Ga0070681_10042284 Ga0070681_100422842 369
174 3300005530 Ga0070679_100144407 Ga0070679_1001444072 369
175 3300013308 Ga0157375_10084490 Ga0157375_100844902 369
176 3300025297 Ga0209758_1000032 Ga0209758_1000032349 369
177 3300025898 Ga0207692_10107008 Ga0207692_101070081 369
178 3300028556 Ga0265337_1003396 Ga0265337_10033964 369
179 3300028573 Ga0265334_10001843 Ga0265334_100018437 369
180 3300028800 Ga0265338_10007502 Ga0265338_100075026 369
181 3300031595 Ga0265313_10017588 Ga0265313_100175883 369
182 3300035083 Ga0373926_0052226 Ga0373926_0052226_265_1383 369
183 3300036401 Ga0373937_0009654 Ga0373937_0009654_4888_6006 369
184 3300046507 Ga0495606_0102062 Ga0495606_0102062_522_1673 369
185 3300046533 Ga0495640_0078089 Ga0495640_0078089_714_1832 369
186 3300046535 Ga0495586_0002921 Ga0495586_0002921_5263_6381 369
187 3300046690 Ga0495624_0171666 Ga0495624_0171666_182_1300 369
188 3300047319 Ga0495674_0040295 Ga0495674_0040295_2167_3285 369
189 3300009093 Ga0105240_10066096 Ga0105240_100660964 370
190 3300009551 Ga0105238_10073632 Ga0105238_100736322 370
191 3300025913 Ga0207695_10142570 Ga0207695_101425702 370
192 3300046539 Ga0495621_0015160 Ga0495621_0015160_298_1449 370
193 3300049569 Ga0501032_0039223 Ga0501032_0039223_1512_2666 370
194 3300049571 Ga0501034_0046901 Ga0501034_0046901_2909_4063 370
195 3300049572 Ga0501036_0035433 Ga0501036_0035433_112_1266 370
196 3300049582 Ga0501048_0069941 Ga0501048_0069941_1158_2312 370
197 3300049583 Ga0501067_0002186 Ga0501067_0002186_1331_2485 370
198 3300049585 Ga0501069_0007809 Ga0501069_0007809_1940_3094 370
199 3300049589 Ga0501073_0015757 Ga0501073_0015757_1635_2789 370
200 3300049590 Ga0501074_0045333 Ga0501074_0045333_1198_2352 370
201 3300049741 Ga0501079_0007807 Ga0501079_0007807_1771_2925 370
202 3300049741 Ga0501079_0192469 Ga0501079_0192469_181_1302 370
203 3300049822 Ga0501035_0023096 Ga0501035_0023096_1365_2519 370
204 3300049823 Ga0501044_0017288 Ga0501044_0017288_2010_3164 370
205 3300050510 nmdc:mga06r32_108802_c1 nmdc:mga06r32_108802_c1_678_1799 370
206 3300053140 Ga0500573_0000062 Ga0500573_0000062_41254_42405 370
207 3300054114 Ga0501084_0019849 Ga0501084_0019849_191_1345 370
208 3300005548 Ga0070665_100294241 Ga0070665_1002942412 371
209 3300021384 Ga0213876_10077688 Ga0213876_100776882 371
210 3300025261 Ga0209233_1013325 Ga0209233_10133252 371
211 3300028577 Ga0265318_10007334 Ga0265318_100073344 371
212 3300031240 Ga0265320_10056268 Ga0265320_100562682 371
213 3300031250 Ga0265331_10002902 Ga0265331_100029023 371
214 3300031595 Ga0265313_10001440 Ga0265313_100014407 371
215 3300031595 Ga0265313_10001587 Ga0265313_1000158715 371
216 3300031711 Ga0265314_10007122 Ga0265314_100071226 371
217 3300031712 Ga0265342_10107958 Ga0265342_101079582 371
218 3300039437 Ga0436365_0935666 Ga0436365_0935666_93_1250 371
219 3300039453 Ga0436362_0762902 Ga0436362_0762902_428_1585 371
220 3300047471 Ga0495684_0074018 Ga0495684_0074018_1114_2262 371
221 3300049580 Ga0501046_0006668 Ga0501046_0006668_7734_8873 371
222 3300049581 Ga0501047_0007721 Ga0501047_0007721_2365_3504 371
223 3300009098 Ga0105245_10011046 Ga0105245_100110466 372
224 3300025297 Ga0209758_1025559 Ga0209758_10255592 372
225 3300025927 Ga0207687_10015623 Ga0207687_100156232 372
226 3300049574 Ga0501038_0273940 Ga0501038_0273940_150_1292 372
227 3300049822 Ga0501035_0081587 Ga0501035_0081587_464_1606 372
228 3300005327 Ga0070658_10014463 Ga0070658_100144634 373
229 3300005339 Ga0070660_100032632 Ga0070660_1000326324 373
230 3300005458 Ga0070681_10086399 Ga0070681_100863993 373
231 3300005530 Ga0070679_100080876 Ga0070679_1000808762 373
232 3300005548 Ga0070665_100005488 Ga0070665_10000548810 373
233 3300009551 Ga0105238_10163785 Ga0105238_101637852 373
234 3300014968 Ga0157379_10002727 Ga0157379_100027276 373
235 3300025909 Ga0207705_10025001 Ga0207705_100250014 373
236 3300025913 Ga0207695_10055567 Ga0207695_100555673 373
237 3300025919 Ga0207657_10019332 Ga0207657_100193324 373
238 3300028379 Ga0268266_10001115 Ga0268266_1000111519 373
239 3300049741 Ga0501079_0121962 Ga0501079_0121962_303_1433 373
240 3300013306 Ga0163162_10161352 Ga0163162_101613522 374
241 3300014325 Ga0163163_10000150 Ga0163163_1000015026 374
242 3300026142 Ga0207698_10051816 Ga0207698_100518162 374
243 3300031711 Ga0265314_10023936 Ga0265314_100239362 374
244 3300049742 Ga0501080_0015692 Ga0501080_0015692_5686_6843 374
245 3300005367 Ga0070667_100188107 Ga0070667_1001881072 375
246 3300005458 Ga0070681_10352593 Ga0070681_103525931 375
247 3300005563 Ga0068855_100066779 Ga0068855_1000667793 375
248 3300005841 Ga0068863_100086478 Ga0068863_1000864782 375
249 3300009177 Ga0105248_10000015 Ga0105248_10000015265 375
250 3300009177 Ga0105248_10062159 Ga0105248_100621592 375
251 3300009545 Ga0105237_10280892 Ga0105237_102808922 375
252 3300025913 Ga0207695_10084333 Ga0207695_100843333 375
253 3300025914 Ga0207671_10116496 Ga0207671_101164962 375
254 3300025920 Ga0207649_10123955 Ga0207649_101239552 375
255 3300025941 Ga0207711_10000003 Ga0207711_10000003863 375
256 3300025941 Ga0207711_10000005 Ga0207711_10000005271 375
257 3300025941 Ga0207711_10000009 Ga0207711_10000009385 375
258 3300025941 Ga0207711_10036178 Ga0207711_100361782 375
259 3300025961 Ga0207712_10051705 Ga0207712_100517052 375
260 3300025986 Ga0207658_10151849 Ga0207658_101518492 375
261 3300049586 Ga0501070_0235726 Ga0501070_0235726_109_1266 375
262 3300053119 Ga0500595_004077 Ga0500595_004077_5103_6248 375
263 3300053154 Ga0500619_001654 Ga0500619_001654_1233_2390 375
264 3300025940 Ga0207691_10133428 Ga0207691_101334282 376
265 3300028577 Ga0265318_10000025 Ga0265318_10000025145 376
266 3300005338 Ga0068868_100240706 Ga0068868_1002407062 377
267 3300005354 Ga0070675_100233802 Ga0070675_1002338021 377
268 3300005364 Ga0070673_100007134 Ga0070673_1000071347 377
269 3300005459 Ga0068867_100002010 Ga0068867_1000020104 377
270 3300005577 Ga0068857_100127875 Ga0068857_1001278752 377
271 3300006237 Ga0097621_100054970 Ga0097621_1000549703 377
272 3300009093 Ga0105240_10319316 Ga0105240_103193162 377
273 3300009148 Ga0105243_10004989 Ga0105243_100049895 377
274 3300025899 Ga0207642_10113467 Ga0207642_101134672 377
275 3300025913 Ga0207695_10227327 Ga0207695_102273272 377
276 3300025934 Ga0207686_10120200 Ga0207686_101202001 377
277 3300025942 Ga0207689_10002312 Ga0207689_1000231214 377
278 3300025960 Ga0207651_10031380 Ga0207651_100313803 377
279 3300026089 Ga0207648_10008985 Ga0207648_100089855 377
280 3300026116 Ga0207674_10167070 Ga0207674_101670702 377
281 3300028800 Ga0265338_10012713 Ga0265338_100127132 377
282 3300046557 Ga0495622_0015488 Ga0495622_0015488_288_1436 377
283 3300005842 Ga0068858_100058322 Ga0068858_1000583222 378
284 3300026035 Ga0207703_10043502 Ga0207703_100435022 378
285 3300048924 Ga0496121_0000701 Ga0496121_0000701_22880_24022 378
286 3300005336 Ga0070680_100000033 Ga0070680_10000003311 379
287 3300005458 Ga0070681_10000002 Ga0070681_10000002198 379
288 3300005530 Ga0070679_100000132 Ga0070679_1000001323 379
289 3300010375 Ga0105239_10009991 Ga0105239_100099915 379
290 3300025912 Ga0207707_10000002 Ga0207707_10000002754 379
291 3300025917 Ga0207660_10000010 Ga0207660_1000001052 379
292 3300025921 Ga0207652_10000053 Ga0207652_1000005310 379
293 3300031247 Ga0265340_10098823 Ga0265340_100988231 379
294 3300005341 Ga0070691_10000472 Ga0070691_1000047213 380
295 3300005434 Ga0070709_10000425 Ga0070709_100004258 380
296 3300005436 Ga0070713_100003972 Ga0070713_1000039728 380
297 3300005439 Ga0070711_100033441 Ga0070711_1000334413 380
298 3300005563 Ga0068855_100506318 Ga0068855_1005063181 380
299 3300005577 Ga0068857_100000460 Ga0068857_1000004605 380
300 3300005614 Ga0068856_100001033 Ga0068856_1000010338 380
301 3300005614 Ga0068856_100005319 Ga0068856_1000053199 380
302 3300006173 Ga0070716_100056890 Ga0070716_1000568901 380
303 3300006175 Ga0070712_100000771 Ga0070712_10000077110 380
304 3300006914 Ga0075436_100000024 Ga0075436_10000002424 380
305 3300009093 Ga0105240_10008320 Ga0105240_100083202 380
306 3300009174 Ga0105241_10022987 Ga0105241_100229873 380
307 3300009545 Ga0105237_10153699 Ga0105237_101536992 380
308 3300009551 Ga0105238_10001006 Ga0105238_1000100616 380
309 3300013100 Ga0157373_10006707 Ga0157373_100067076 380
310 3300013104 Ga0157370_10005161 Ga0157370_100051615 380
311 3300013297 Ga0157378_10114700 Ga0157378_101147002 380
312 3300014325 Ga0163163_10177865 Ga0163163_101778652 380
313 3300025906 Ga0207699_10000188 Ga0207699_1000018833 380
314 3300025911 Ga0207654_10010929 Ga0207654_100109293 380
315 3300025913 Ga0207695_10258160 Ga0207695_102581602 380
316 3300025915 Ga0207693_10002656 Ga0207693_1000265610 380
317 3300025916 Ga0207663_10028054 Ga0207663_100280542 380
318 3300025928 Ga0207700_10000014 Ga0207700_1000001442 380
319 3300025949 Ga0207667_10051420 Ga0207667_100514202 380
320 3300026078 Ga0207702_10000011 Ga0207702_10000011267 380
321 3300026116 Ga0207674_10000002 Ga0207674_10000002262 380
322 3300026142 Ga0207698_10030875 Ga0207698_100308753 380
323 3300031240 Ga0265320_10000209 Ga0265320_1000020926 380
324 3300031241 Ga0265325_10013215 Ga0265325_100132152 380
325 3300031250 Ga0265331_10045339 Ga0265331_100453392 380
326 3300036401 Ga0373937_0173907 Ga0373937_0173907_307_1455 380
327 3300036401 Ga0373937_0274452 Ga0373937_0274452_118_1266 380
328 3300048909 Ga0496106_0270258 Ga0496106_0270258_142_1290 380
329 3300049570 Ga0501033_0020194 Ga0501033_0020194_2003_3154 380
330 3300049581 Ga0501047_0003622 Ga0501047_0003622_4528_5679 380
331 3300049822 Ga0501035_0028857 Ga0501035_0028857_1939_3090 380
332 3300049823 Ga0501044_0021988 Ga0501044_0021988_3840_4991 380
333 3300050514 nmdc:mga08x19_86_c1 nmdc:mga08x19_86_c1_61691_62839 380
334 3300053087 Ga0500643_000008 Ga0500643_000008_362823_363965 380
335 3300054114 Ga0501084_0311847 Ga0501084_0311847_146_1288 380
336 3300060353 Ga0501082_0070082 Ga0501082_0070082_1277_2419 380
337 3300005563 Ga0068855_100001071 Ga0068855_10000107129 381
338 3300005616 Ga0068852_100009931 Ga0068852_1000099312 381
339 3300009093 Ga0105240_10000582 Ga0105240_1000058254 381
340 3300009176 Ga0105242_10012270 Ga0105242_100122703 381
341 3300010375 Ga0105239_10005765 Ga0105239_100057655 381
342 3300010375 Ga0105239_10021245 Ga0105239_100212455 381
343 3300013105 Ga0157369_10020301 Ga0157369_100203014 381
344 3300013105 Ga0157369_10136464 Ga0157369_101364642 381
345 3300021377 Ga0213874_10002883 Ga0213874_100028832 381
346 3300021384 Ga0213876_10003451 Ga0213876_100034512 381
347 3300025913 Ga0207695_10000004 Ga0207695_10000004156 381
348 3300025924 Ga0207694_10000015 Ga0207694_10000015209 381
349 3300025934 Ga0207686_10005856 Ga0207686_100058563 381
350 3300025949 Ga0207667_10000226 Ga0207667_1000022627 381
351 3300026067 Ga0207678_10088775 Ga0207678_100887752 381
352 3300026142 Ga0207698_10003037 Ga0207698_100030375 381
353 3300031247 Ga0265340_10000319 Ga0265340_1000031922 381
354 3300031247 Ga0265340_10035846 Ga0265340_100358462 381
355 3300039437 Ga0436365_1797404 Ga0436365_1797404_40633_41790 381
356 3300039450 Ga0436363_0410036 Ga0436363_0410036_1369_2523 381
357 3300049460 Ga0495682_0000834 Ga0495682_0000834_2659_3810 381
358 3300049583 Ga0501067_0059510 Ga0501067_0059510_426_1580 381
359 3300049588 Ga0501072_0046283 Ga0501072_0046283_1602_2756 381
360 3300049742 Ga0501080_0026251 Ga0501080_0026251_2374_3528 381
361 3300054114 Ga0501084_0000074 Ga0501084_0000074_52577_53731 381
362 3300060353 Ga0501082_0056468 Ga0501082_0056468_964_2118 381
363 3300005329 Ga0070683_100084470 Ga0070683_1000844702 382
364 3300005535 Ga0070684_100072542 Ga0070684_1000725423 382
365 3300005548 Ga0070665_100047014 Ga0070665_1000470142 382
366 3300009093 Ga0105240_10183183 Ga0105240_101831832 382
367 3300013105 Ga0157369_10093799 Ga0157369_100937992 382
368 3300014326 Ga0157380_10247252 Ga0157380_102472522 382
369 3300025924 Ga0207694_10177647 Ga0207694_101776472 382
370 3300025944 Ga0207661_10119757 Ga0207661_101197572 382
371 3300026121 Ga0207683_10124811 Ga0207683_101248112 382
372 3300028379 Ga0268266_10114856 Ga0268266_101148562 382
373 3300028381 Ga0268264_10089924 Ga0268264_100899242 382
374 3300031711 Ga0265314_10069791 Ga0265314_100697912 382
375 3300003214 JGI25165J46597_1000008 JGI25165J46597_1000008115 383
376 3300005327 Ga0070658_10022236 Ga0070658_100222363 383
377 3300005530 Ga0070679_100092077 Ga0070679_1000920772 383
378 3300005548 Ga0070665_100167493 Ga0070665_1001674932 383
379 3300006237 Ga0097621_100001594 Ga0097621_1000015948 383
380 3300006358 Ga0068871_100000187 Ga0068871_10000018727 383
381 3300013297 Ga0157378_10154905 Ga0157378_101549051 383
382 3300013307 Ga0157372_10003944 Ga0157372_1000394417 383
383 3300021377 Ga0213874_10000813 Ga0213874_100008134 383
384 3300021384 Ga0213876_10001035 Ga0213876_1000103512 383
385 3300025261 Ga0209233_1000006 Ga0209233_10000061063 383
386 3300025919 Ga0207657_10016622 Ga0207657_100166225 383
387 3300025942 Ga0207689_10013425 Ga0207689_100134252 383
388 3300025944 Ga0207661_10070601 Ga0207661_100706013 383
389 3300028379 Ga0268266_10147553 Ga0268266_101475531 383
390 3300039437 Ga0436365_1712708 Ga0436365_1712708_14676_15842 383
391 3300039450 Ga0436363_0215436 Ga0436363_0215436_2977_4143 383
392 3300049570 Ga0501033_0220440 Ga0501033_0220440_144_1295 383
393 3300049581 Ga0501047_0064943 Ga0501047_0064943_602_1753 383
394 3300049822 Ga0501035_0018794 Ga0501035_0018794_3107_4258 383
395 3300049823 Ga0501044_0010182 Ga0501044_0010182_9008_10159 383

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01098

FTSW_RODA_SPOVE

Cell cycle protein

18

359

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6pl5-assembly1.cif.gz_A structural coordination of polymerization and crosslinking by a peptidoglycan synthase complex 0.8221 14 366
6pl6-assembly1.cif.gz_A structural coordination of polymerization and crosslinking by a peptidoglycan synthase complex 0.8213 14 366
6bar-assembly1.cif.gz_A crystal structure of thermus thermophilus rod shape determining protein roda (q5six3_thet8) 0.8194 14 366
6pl5-assembly1.cif.gz_A structural coordination of polymerization and crosslinking by a peptidoglycan synthase complex 0.8177 14 366
6pl6-assembly1.cif.gz_A structural coordination of polymerization and crosslinking by a peptidoglycan synthase complex 0.8169 14 366
ID Description Score Start End Superfamily
af_Q9C540_5_220_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.2939 78 374 1.20.120.1770
5l0gA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.2918 224 363 1.20.120.230
af_Q9C540_5_220_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.2905 78 374 1.20.120.1770
af_Q54MH2_1_237_1.20.120.810 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Vinculin, Vh2 four-helix bundle 0.2857 79 360 1.20.120.810
af_Q54MH2_1_237_1.20.120.810 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Vinculin, Vh2 four-helix bundle 0.2776 79 360 1.20.120.810
ID Description Score Start End GO Terms
AF-A0A2D9LFF1-F1-model_v4 Probable peptidoglycan glycosyltransferase FtsW (EC 2.4.99.28) (Cell division protein FtsW) (Cell wall polymerase) (Peptidoglycan polymerase) 0.9179 1 365 GO:0005886
GO:0008360
GO:0009252
GO:0015648
GO:0016757
GO:0032153
GO:0051301
AF-A0A524HWE3-F1-model_v4 Probable peptidoglycan glycosyltransferase FtsW (EC 2.4.99.28) (Cell division protein FtsW) (Cell wall polymerase) (Peptidoglycan polymerase) 0.9167 1 366 GO:0005886
GO:0008360
GO:0009252
GO:0015648
GO:0016757
GO:0032153
GO:0051301
AF-A0A2H6B378-F1-model_v4 Probable peptidoglycan glycosyltransferase FtsW (EC 2.4.99.28) (Cell division protein FtsW) (Cell wall polymerase) (Peptidoglycan polymerase) 0.9145 1 363 GO:0005886
GO:0008360
GO:0008955
GO:0009252
GO:0015648
GO:0032153
GO:0051301
AF-A0A0F5FVV4-F1-model_v4 Probable peptidoglycan glycosyltransferase FtsW (EC 2.4.99.28) (Cell division protein FtsW) (Cell wall polymerase) (Peptidoglycan polymerase) 0.9088 1 371 GO:0005886
GO:0008360
GO:0009252
GO:0015648
GO:0016757
GO:0032153
GO:0051301
AF-H6SNF6-F1-model_v4 Probable peptidoglycan glycosyltransferase FtsW (EC 2.4.99.28) (Cell division protein FtsW) (Cell wall polymerase) (Peptidoglycan polymerase) 0.9082 1 364 GO:0005886
GO:0008360
GO:0009252
GO:0015648
GO:0016757
GO:0032153
GO:0051301
GO:0071555

Feature Viewer

pLDDT pTM Quality
75.27 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map