F433203

General Info

Members Datasets Scaffolds Average Seq Length
395 200 790 304

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10142695|Ga0105237_101426952
Length 339
Sequence MVRNKVSRCISVRSMQSRLHIAHQIDRLMPMMTRRSFSMALTTAMGTLPVFGAKKLTSHIGHTGLTWIPLGGPAPKPPALSPMVDPQYVEAAIRDVASLGFYGLELFGNQIEAMETQGGIGPLLEKHKLPLVSAYCGTNLSDPAERKASIEKTLGWAKLVKKYKGKIVVVGPNGVRRNAWDFKAHKDDILTTLNELGKAVSDLGLTAVLHQHTGTCVETRDETYAVMEAVDTKVLKFGPDIGQLQKGGSDPVQVVKDFLPLVQHMHLKDYVGGPNYLGYCPLGEGKVDIPAILNLMEGRKTDGLIMVELDSPPPQPATALENAKIAKAYLEKQGISFRG

Samples

Sample ID Description Type Environment
1 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
75 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
112 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
113 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
114 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
115 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
116 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
117 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
118 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
119 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
120 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
122 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
125 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
126 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
127 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
128 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
129 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
130 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
131 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
132 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
133 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
134 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
135 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
136 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
137 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
138 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
139 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
140 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
141 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
142 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
143 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
144 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
145 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
146 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
147 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
148 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
149 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
150 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
151 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
152 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
155 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
156 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
157 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
170 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
171 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
172 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
173 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
174 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
177 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
178 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
179 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
180 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
181 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
182 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
183 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
184 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
185 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
186 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
187 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
188 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
189 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
190 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
191 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
192 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
193 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
194 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
195 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
196 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
197 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
198 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
199 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
200 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0
Isolates 0.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.33
Nodule 0
Rhizoplane 1.01
Rhizosphere 90.38
Stem 0
Stem Tuber 0
Unclassified 18.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105237_10142695 3300009545 Unclassified 2389
2 Ga0065715_10213257 3300005293 Bacteria 1304
3 Ga0070658_10031269 3300005327 Bacteria 4274
4 Ga0070658_10059870 3300005327 Bacteria 3101
5 Ga0070658_10233505 3300005327 Unclassified 1558
6 Ga0070683_100000005 3300005329 Bacteria 361724
7 Ga0070666_10161295 3300005335 Bacteria 1567
8 Ga0070680_100002280 3300005336 Bacteria 14190
9 Ga0070680_100005542 3300005336 Bacteria 9553
10 Ga0070680_100016453 3300005336 Bacteria 5820
11 Ga0070680_100074933 3300005336 Bacteria 2785
12 Ga0070660_100007086 3300005339 Bacteria 7790
13 Ga0070660_100056547 3300005339 Unclassified 3036
14 Ga0070660_100116656 3300005339 Unclassified 2129
15 Ga0070661_100149199 3300005344 Bacteria 1767
16 Ga0070668_100481301 3300005347 Bacteria 1072
17 Ga0070659_100065800 3300005366 Bacteria 2871
18 Ga0070659_100357463 3300005366 Unclassified 1226
19 Ga0070708_100437401 3300005445 Bacteria 1234
20 Ga0070663_100006241 3300005455 Bacteria 7148
21 Ga0070678_100203728 3300005456 Unclassified 1635
22 Ga0070662_100158849 3300005457 Unclassified 1767
23 Ga0070681_10002339 3300005458 Bacteria 17317
24 Ga0070681_10054091 3300005458 Bacteria 3999
25 Ga0070706_100159301 3300005467 Bacteria 2107
26 Ga0070679_100006351 3300005530 Bacteria 11004
27 Ga0070679_100024242 3300005530 Bacteria 5945
28 Ga0070679_100034008 3300005530 Bacteria 5050
29 Ga0070679_100140155 3300005530 Bacteria 2398
30 Ga0070684_100000019 3300005535 Bacteria 135518
31 Ga0070684_100027477 3300005535 Unclassified 4804
32 Ga0070684_100163269 3300005535 Bacteria 2021
33 Ga0068853_100057135 3300005539 Unclassified 3366
34 Ga0070672_100208289 3300005543 Unclassified 1637
35 Ga0070686_100339129 3300005544 Bacteria 1126
36 Ga0070665_100019891 3300005548 Bacteria 6741
37 Ga0070665_100096045 3300005548 Bacteria 2969
38 Ga0068855_100014467 3300005563 Bacteria 9501
39 Ga0068855_100017450 3300005563 Bacteria 8634
40 Ga0068855_100033903 3300005563 Bacteria 6090
41 Ga0068855_100042018 3300005563 Bacteria 5417
42 Ga0068855_100075514 3300005563 Bacteria 3913
43 Ga0070664_100241650 3300005564 Bacteria 1621
44 Ga0068857_100186691 3300005577 Bacteria 1887
45 Ga0068854_100071309 3300005578 Bacteria 2541
46 Ga0068856_100015404 3300005614 Bacteria 7388
47 Ga0068856_100020102 3300005614 Bacteria 6485
48 Ga0068856_100180150 3300005614 Unclassified 2126
49 Ga0068856_100412695 3300005614 Unclassified 1370
50 Ga0068852_100017818 3300005616 Bacteria 5582
51 Ga0068852_100018343 3300005616 Bacteria 5512
52 Ga0068852_100046351 3300005616 Unclassified 3704
53 Ga0068852_100055230 3300005616 Bacteria 3426
54 Ga0068861_100431115 3300005719 Unclassified 1177
55 Ga0068863_100029708 3300005841 Bacteria 5218
56 Ga0068858_100667720 3300005842 Unclassified 1010
57 Ga0068862_100029461 3300005844 Bacteria 4626
58 Ga0081455_10090141 3300005937 Bacteria 2487
59 Ga0081539_10016368 3300005985 Bacteria 5300
60 Ga0081539_10017078 3300005985 Bacteria 5123
61 Ga0075368_10032029 3300006042 Bacteria 2040
62 Ga0075364_10045605 3300006051 Bacteria 2853
63 Ga0075364_10147620 3300006051 Bacteria 1584
64 Ga0075432_10004299 3300006058 Bacteria 4850
65 Ga0075367_10009410 3300006178 Bacteria 5106
66 Ga0075367_10022327 3300006178 Bacteria 3548
67 Ga0075369_10084471 3300006186 Bacteria 1411
68 Ga0075366_10071168 3300006195 Bacteria 2072
69 Ga0075366_10192742 3300006195 Bacteria 1239
70 Ga0097621_100010411 3300006237 Bacteria 6805
71 Ga0097621_100351590 3300006237 Unclassified 1311
72 Ga0075370_10005332 3300006353 Bacteria 6376
73 Ga0068871_100096899 3300006358 Bacteria 2465
74 Ga0068871_100379204 3300006358 Bacteria 1256
75 Ga0075428_100003094 3300006844 Bacteria 18153
76 Ga0075428_100051689 3300006844 Bacteria 4506
77 Ga0075428_100055023 3300006844 Bacteria 4361
78 Ga0075428_100072369 3300006844 Bacteria 3766
79 Ga0075430_100004418 3300006846 Bacteria 11866
80 Ga0075430_100044528 3300006846 Bacteria 3751
81 Ga0075430_100100629 3300006846 Bacteria 2414
82 Ga0075431_100035846 3300006847 Bacteria 5107
83 Ga0075431_100047821 3300006847 Bacteria 4411
84 Ga0075431_100238043 3300006847 Bacteria 1853
85 Ga0075433_10044943 3300006852 Bacteria 3838
86 Ga0075433_10119983 3300006852 Unclassified 2334
87 Ga0075433_10124298 3300006852 Bacteria 2292
88 Ga0075434_100012888 3300006871 Bacteria 7941
89 Ga0075434_100085929 3300006871 Unclassified 3145
90 Ga0075434_100124405 3300006871 Bacteria 2596
91 Ga0075429_100036051 3300006880 Bacteria 4302
92 Ga0075429_100054640 3300006880 Bacteria 3474
93 Ga0075429_100220793 3300006880 Unclassified 1660
94 Ga0075435_100012425 3300007076 Bacteria 6305
95 Ga0105240_10000980 3300009093 Bacteria 50924
96 Ga0105240_10001247 3300009093 Bacteria 44160
97 Ga0105240_10025128 3300009093 Bacteria 7834
98 Ga0105240_10039903 3300009093 Bacteria 6009
99 Ga0105240_10055208 3300009093 Unclassified 4974
100 Ga0105240_10160777 3300009093 Unclassified 2667
101 Ga0105240_10259597 3300009093 Bacteria 2005
102 Ga0105240_10451230 3300009093 Bacteria 1439
103 Ga0111539_10000015 3300009094 Bacteria 296576
104 Ga0105245_10567004 3300009098 Bacteria 1159
105 Ga0105247_10033223 3300009101 Bacteria 3137
106 Ga0105247_10110953 3300009101 Bacteria 1766
107 Ga0105247_10148152 3300009101 Bacteria 1544
108 Ga0105247_10213760 3300009101 Bacteria 1302
109 Ga0114129_10002702 3300009147 Bacteria 24700
110 Ga0114129_10006424 3300009147 Bacteria 16668
111 Ga0114129_10010614 3300009147 Bacteria 13135
112 Ga0114129_10016935 3300009147 Bacteria 10378
113 Ga0114129_10043141 3300009147 Bacteria 6347
114 Ga0114129_10069789 3300009147 Bacteria 4899
115 Ga0114129_10077809 3300009147 Bacteria 4614
116 Ga0105243_10120957 3300009148 Unclassified 2207
117 Ga0105241_10302604 3300009174 Bacteria 1373
118 Ga0105248_10066973 3300009177 Bacteria 4032
119 Ga0105248_10112386 3300009177 Bacteria 3072
120 Ga0105248_10150202 3300009177 Bacteria 2628
121 Ga0105248_10335861 3300009177 Unclassified 1701
122 Ga0105237_10004818 3300009545 Bacteria 15499
123 Ga0105237_10005250 3300009545 Bacteria 14660
124 Ga0105237_10022251 3300009545 Bacteria 6504
125 Ga0105237_10118729 3300009545 Bacteria 2638
126 Ga0105237_10561427 3300009545 Bacteria 1148
127 Ga0105238_10024350 3300009551 Bacteria 6170
128 Ga0105238_10024788 3300009551 Bacteria 6113
129 Ga0105238_10259427 3300009551 Bacteria 1717
130 Ga0105238_10287078 3300009551 Bacteria 1627
131 Ga0105249_10063221 3300009553 Bacteria 3400
132 Ga0105249_10070521 3300009553 Bacteria 3226
133 Ga0105239_10031139 3300010375 Bacteria 5869
134 Ga0105239_10052677 3300010375 Bacteria 4463
135 Ga0105239_10167713 3300010375 Bacteria 2455
136 Ga0105239_10179022 3300010375 Unclassified 2372
137 Ga0105239_10186573 3300010375 Unclassified 2321
138 Ga0157373_10072801 3300013100 Bacteria 2425
139 Ga0157371_10043451 3300013102 Bacteria 3201
140 Ga0157371_10049692 3300013102 Bacteria 2979
141 Ga0157370_10006268 3300013104 Bacteria 13168
142 Ga0157370_10016185 3300013104 Bacteria 7559
143 Ga0157370_10027529 3300013104 Bacteria 5605
144 Ga0157370_10028306 3300013104 Bacteria 5514
145 Ga0157370_10039380 3300013104 Bacteria 4568
146 Ga0157370_10133626 3300013104 Bacteria 2314
147 Ga0157370_10259461 3300013104 Bacteria 1606
148 Ga0157369_10002857 3300013105 Bacteria 20629
149 Ga0157369_10009256 3300013105 Bacteria 11269
150 Ga0157369_10026155 3300013105 Bacteria 6475
151 Ga0157369_10057886 3300013105 Unclassified 4181
152 Ga0157369_10059500 3300013105 Bacteria 4120
153 Ga0157369_10124373 3300013105 Unclassified 2735
154 Ga0157369_10154691 3300013105 Bacteria 2423
155 Ga0157369_10163256 3300013105 Bacteria 2350
156 Ga0157369_10218907 3300013105 Bacteria 1993
157 Ga0157369_10264139 3300013105 Bacteria 1795
158 Ga0157374_10004237 3300013296 Bacteria 12056
159 Ga0157374_10020952 3300013296 Bacteria 5809
160 Ga0157374_10245428 3300013296 Bacteria 1761
161 Ga0157374_10266278 3300013296 Unclassified 1689
162 Ga0157374_10315345 3300013296 Bacteria 1549
163 Ga0157374_10354129 3300013296 Unclassified 1459
164 Ga0163162_10314792 3300013306 Unclassified 1698
165 Ga0163162_10315643 3300013306 Unclassified 1695
166 Ga0163162_10317221 3300013306 Unclassified 1691
167 Ga0157372_10026675 3300013307 Bacteria 6287
168 Ga0157372_10033504 3300013307 Bacteria 5643
169 Ga0157372_10069126 3300013307 Unclassified 3972
170 Ga0157372_10077012 3300013307 Bacteria 3766
171 Ga0157372_10091955 3300013307 Unclassified 3450
172 Ga0157372_10176808 3300013307 Unclassified 2470
173 Ga0157372_10206636 3300013307 Unclassified 2275
174 Ga0157372_10507393 3300013307 Bacteria 1406
175 Ga0157375_10301423 3300013308 Unclassified 1766
176 Ga0157375_10679914 3300013308 Unclassified 1184
177 Ga0163163_10048360 3300014325 Unclassified 4182
178 Ga0163163_10236129 3300014325 Unclassified 1877
179 Ga0157380_10042862 3300014326 Bacteria 3540
180 Ga0157379_10042155 3300014968 Bacteria 4074
181 Ga0157376_10053935 3300014969 Bacteria 3350
182 Ga0209233_1001259 3300025261 Bacteria 10180
183 Ga0207656_10016755 3300025321 Bacteria 2858
184 Ga0207710_10041307 3300025900 Bacteria 2045
185 Ga0207647_10001908 3300025904 Bacteria 15976
186 Ga0207699_10118974 3300025906 Bacteria 1705
187 Ga0207705_10156022 3300025909 Bacteria 1713
188 Ga0207705_10227782 3300025909 Unclassified 1417
189 Ga0207707_10050052 3300025912 Bacteria 3641
190 Ga0207707_10078379 3300025912 Bacteria 2885
191 Ga0207695_10000374 3300025913 Bacteria 101673
192 Ga0207695_10001495 3300025913 Bacteria 38982
193 Ga0207695_10018476 3300025913 Bacteria 8061
194 Ga0207695_10082683 3300025913 Unclassified 3245
195 Ga0207695_10124356 3300025913 Bacteria 2543
196 Ga0207695_10185963 3300025913 Bacteria 1996
197 Ga0207695_10205183 3300025913 Bacteria 1884
198 Ga0207671_10010112 3300025914 Bacteria 7819
199 Ga0207671_10043920 3300025914 Bacteria 3304
200 Ga0207660_10009456 3300025917 Bacteria 6309
201 Ga0207660_10010571 3300025917 Bacteria 5993
202 Ga0207660_10053765 3300025917 Bacteria 2872
203 Ga0207657_10008427 3300025919 Bacteria 10461
204 Ga0207657_10029880 3300025919 Unclassified 4954
205 Ga0207657_10196791 3300025919 Unclassified 1623
206 Ga0207649_10036437 3300025920 Bacteria 2963
207 Ga0207652_10002220 3300025921 Bacteria 16562
208 Ga0207652_10186486 3300025921 Bacteria 1865
209 Ga0207694_10004352 3300025924 Bacteria 11063
210 Ga0207694_10007697 3300025924 Bacteria 8163
211 Ga0207694_10161871 3300025924 Unclassified 1808
212 Ga0207650_10167580 3300025925 Bacteria 1744
213 Ga0207687_10007153 3300025927 Bacteria 7359
214 Ga0207664_10033039 3300025929 Unclassified 3972
215 Ga0207664_10401227 3300025929 Unclassified 1219
216 Ga0207690_10021540 3300025932 Unclassified 3999
217 Ga0207690_10174325 3300025932 Bacteria 1614
218 Ga0207704_10292967 3300025938 Unclassified 1243
219 Ga0207711_10077998 3300025941 Bacteria 2889
220 Ga0207661_10000024 3300025944 Bacteria 197376
221 Ga0207661_10069949 3300025944 Bacteria 2863
222 Ga0207661_10092072 3300025944 Bacteria 2527
223 Ga0207661_10119770 3300025944 Bacteria 2239
224 Ga0207661_10255300 3300025944 Unclassified 1560
225 Ga0207667_10000199 3300025949 Bacteria 87200
226 Ga0207667_10023911 3300025949 Bacteria 6721
227 Ga0207667_10026054 3300025949 Bacteria 6394
228 Ga0207667_10057798 3300025949 Bacteria 4070
229 Ga0207667_10064310 3300025949 Bacteria 3830
230 Ga0207667_10164030 3300025949 Unclassified 2285
231 Ga0207712_10188717 3300025961 Bacteria 1625
232 Ga0207640_10016303 3300025981 Bacteria 4319
233 Ga0207658_10225478 3300025986 Unclassified 1579
234 Ga0207703_10027016 3300026035 Bacteria 4521
235 Ga0207639_10032211 3300026041 Unclassified 3857
236 Ga0207639_10136215 3300026041 Bacteria 2039
237 Ga0207639_10138805 3300026041 Bacteria 2023
238 Ga0207678_10000156 3300026067 Bacteria 56308
239 Ga0207678_10408266 3300026067 Bacteria 1177
240 Ga0207708_10129943 3300026075 Unclassified 1969
241 Ga0207708_10194535 3300026075 Bacteria 1616
242 Ga0207702_10013121 3300026078 Bacteria 6889
243 Ga0207702_10058222 3300026078 Unclassified 3288
244 Ga0207702_10061301 3300026078 Bacteria 3208
245 Ga0207702_10072035 3300026078 Bacteria 2977
246 Ga0207641_10009951 3300026088 Bacteria 7826
247 Ga0207641_10086055 3300026088 Bacteria 2740
248 Ga0207648_10381105 3300026089 Unclassified 1275
249 Ga0207674_10047556 3300026116 Bacteria 4396
250 Ga0207683_10124888 3300026121 Unclassified 2312
251 Ga0207683_10318029 3300026121 Unclassified 1425
252 Ga0207698_10005195 3300026142 Bacteria 8004
253 Ga0207698_10131851 3300026142 Bacteria 2137
254 Ga0207428_10000048 3300027907 Bacteria 180760
255 Ga0268266_10001808 3300028379 Bacteria 24206
256 Ga0268266_10003682 3300028379 Bacteria 15135
257 Ga0265336_10004378 3300028666 Bacteria 5350
258 Ga0265338_10005735 3300028800 Bacteria 16058
259 Ga0265330_10005174 3300031235 Bacteria 6523
260 Ga0265325_10090225 3300031241 Bacteria 1512
261 Ga0265340_10046087 3300031247 Bacteria 2127
262 Ga0265314_10000375 3300031711 Bacteria 61300
263 Ga0265342_10037786 3300031712 Bacteria 2942
264 Ga0307405_10068028 3300031731 Bacteria 2278
265 Ga0307412_10275236 3300031911 Bacteria 1319
266 Ga0307412_10305167 3300031911 Bacteria 1260
267 Ga0373925_0069154 3300037068 Bacteria 2667
268 Ga0395898_0316179 3300037466 Bacteria 1490
269 Ga0395898_0445858 3300037466 Unclassified 1233
270 Ga0436364_0454060 3300037853 Bacteria 2714
271 Ga0436364_1090045 3300037853 Bacteria 4160
272 Ga0395901_0212265 3300038443 Bacteria 2026
273 Ga0436365_0532321 3300039437 Unclassified 1692
274 Ga0436365_1702046 3300039437 Bacteria 1286
275 Ga0436363_0321152 3300039450 Bacteria 1264
276 Ga0451576_0174061 3300045051 Unclassified 2247
277 Ga0466967_0127938 3300045976 Bacteria 2355
278 Ga0495638_0002216 3300046460 Bacteria 16185
279 Ga0495638_0010312 3300046460 Bacteria 6499
280 Ga0495638_0086931 3300046460 Bacteria 1889
281 Ga0495651_0006696 3300046462 Bacteria 8807
282 Ga0495650_0000006 3300046471 Bacteria 721347
283 Ga0495650_0004689 3300046471 Bacteria 9226
284 Ga0495580_0000668 3300046472 Bacteria 29195
285 Ga0495580_0011158 3300046472 Bacteria 6961
286 Ga0495664_0004868 3300046477 Bacteria 7342
287 Ga0495594_0020630 3300046499 Bacteria 3511
288 Ga0495606_0054979 3300046507 Bacteria 2576
289 Ga0495606_0097262 3300046507 Bacteria 1799
290 Ga0495606_0156923 3300046507 Bacteria 1331
291 Ga0495618_0261267 3300046514 Bacteria 1084
292 Ga0495628_0235900 3300046516 Bacteria 1370
293 Ga0495665_0009900 3300046531 Bacteria 5162
294 Ga0495665_0031063 3300046531 Bacteria 2859
295 Ga0495640_0015713 3300046533 Bacteria 5686
296 Ga0495640_0123580 3300046533 Bacteria 1680
297 Ga0495587_0046485 3300046536 Bacteria 2577
298 Ga0495645_0002409 3300046543 Bacteria 12695
299 Ga0495645_0096867 3300046543 Unclassified 2102
300 Ga0495667_0008541 3300046559 Bacteria 6953
301 Ga0495667_0068520 3300046559 Bacteria 2317
302 Ga0495625_0000156 3300046660 Bacteria 104915
303 Ga0495625_0093251 3300046660 Bacteria 2079
304 Ga0495599_0081223 3300046678 Unclassified 2025
305 Ga0495623_0006195 3300046679 Bacteria 7775
306 Ga0495623_0054426 3300046679 Bacteria 2525
307 Ga0495623_0110199 3300046679 Unclassified 1669
308 Ga0495649_0018521 3300046694 Bacteria 3916
309 Ga0495604_0074563 3300047317 Bacteria 2557
310 Ga0495604_0112525 3300047317 Unclassified 1983
311 Ga0495674_0002447 3300047319 Bacteria 18146
312 Ga0495674_0004669 3300047319 Bacteria 13171
313 Ga0495674_0017781 3300047319 Bacteria 6620
314 Ga0495672_0005935 3300047320 Bacteria 9572
315 Ga0495675_0078630 3300047444 Bacteria 2077
316 Ga0495675_0141781 3300047444 Bacteria 1489
317 Ga0495684_0001965 3300047471 Bacteria 16517
318 Ga0495684_0002258 3300047471 Bacteria 15442
319 Ga0495684_0013884 3300047471 Bacteria 6195
320 Ga0495684_0016878 3300047471 Bacteria 5625
321 Ga0495686_0026509 3300047472 Bacteria 3791
322 Ga0495602_0008652 3300048088 Bacteria 10632
323 Ga0496104_0001208 3300048907 Bacteria 22234
324 Ga0496104_0267796 3300048907 Bacteria 1621
325 Ga0496112_0046618 3300048915 Unclassified 4252
326 Ga0496115_0082424 3300048918 Bacteria 2621
327 Ga0496126_0000010 3300048929 Bacteria 744888
328 Ga0496126_0000063 3300048929 Bacteria 256841
329 Ga0496126_0000560 3300048929 Bacteria 71370
330 Ga0496126_0002467 3300048929 Bacteria 24929
331 Ga0501031_0119069 3300049568 Bacteria 1725
332 Ga0501032_0063736 3300049569 Bacteria 2467
333 Ga0501033_0009583 3300049570 Bacteria 7450
334 Ga0501034_0006307 3300049571 Bacteria 12765
335 Ga0501036_0004620 3300049572 Bacteria 11127
336 Ga0501036_0177087 3300049572 Unclassified 1796
337 Ga0501037_0046716 3300049573 Bacteria 3175
338 Ga0501038_0001587 3300049574 Bacteria 21087
339 Ga0501039_0035005 3300049575 Bacteria 3876
340 Ga0501041_0036431 3300049577 Bacteria 2981
341 Ga0501043_0018925 3300049579 Bacteria 5404
342 Ga0501046_0000062 3300049580 Bacteria 118786
343 Ga0501047_0018871 3300049581 Bacteria 6614
344 Ga0501070_0151278 3300049586 Unclassified 1915
345 Ga0501072_0144480 3300049588 Unclassified 1897
346 Ga0501073_0047294 3300049589 Bacteria 3024
347 Ga0501075_0069708 3300049591 Unclassified 2657
348 Ga0501076_0081246 3300049592 Bacteria 2602
349 Ga0501076_0101302 3300049592 Unclassified 2321
350 Ga0501035_0037233 3300049822 Bacteria 4406
351 Ga0501035_0051321 3300049822 Bacteria 3693
352 Ga0501044_0049955 3300049823 Bacteria 4317
353 Ga0501045_0015064 3300049824 Bacteria 5488
354 nmdc:mga00v17_84749_c1 3300050491 Bacteria 1984
355 nmdc:mga0k408_2038_c1 3300050493 Bacteria 10815
356 nmdc:mga0k408_25738_c1 3300050493 Bacteria 3334
357 nmdc:mga0k408_34997_c1 3300050493 Bacteria 2878
358 nmdc:mga04h51_8227_c1 3300050495 Bacteria 2785
359 nmdc:mga07m45_10414_c1 3300050496 Bacteria 4857
360 nmdc:mga05p37_109508_c1 3300050507 Bacteria 3398
361 nmdc:mga05p37_12159_c1 3300050507 Bacteria 10278
362 nmdc:mga05p37_13940_c1 3300050507 Bacteria 9637
363 nmdc:mga05p37_306376_c1 3300050507 Bacteria 1885
364 nmdc:mga05p37_368964_c1 3300050507 Bacteria 1685
365 nmdc:mga05p37_82542_c1 3300050507 Unclassified 3960
366 nmdc:mga09592_31887_c1 3300050508 Bacteria 4392
367 nmdc:mga09592_82085_c1 3300050508 Bacteria 2747
368 nmdc:mga0qj67_139528_c1 3300050509 Unclassified 1965
369 nmdc:mga0qj67_36296_c1 3300050509 Bacteria 3856
370 nmdc:mga0qj67_6097_c1 3300050509 Bacteria 8834
371 nmdc:mga06r32_20731_c1 3300050510 Bacteria 6055
372 nmdc:mga06r32_354663_c1 3300050510 Bacteria 1451
373 nmdc:mga08y16_55771_c1 3300050511 Bacteria 4129
374 nmdc:mga08y16_8_c1 3300050511 Bacteria 571177
375 nmdc:mga0n895_116148_c1 3300050512 Bacteria 2695
376 nmdc:mga0n895_2851_c1 3300050512 Bacteria 13697
377 nmdc:mga0n895_4905_c1 3300050512 Bacteria 11090
378 nmdc:mga0rr50_8022_c1 3300050513 Bacteria 6549
379 nmdc:mga0a205_17753_c1 3300050515 Bacteria 6678
380 nmdc:mga0a205_41620_c1 3300050515 Bacteria 4425
381 nmdc:mga0a205_92836_c1 3300050515 Bacteria 2916
382 nmdc:mga0sz30_75824_c1 3300050516 Bacteria 1451
383 Ga0500555_000037 3300053103 Bacteria 73513
384 Ga0500595_000014 3300053119 Bacteria 247996
385 Ga0500595_027977 3300053119 Bacteria 1925
386 Ga0500568_0001127 3300053139 Bacteria 17953
387 Ga0500611_001101 3300053727 Bacteria 2875
388 Ga0500645_000301 3300053730 Bacteria 35352
389 Ga0500599_008697 3300053736 Bacteria 1322
390 Ga0501084_0403525 3300054114 Unclassified 1155
391 Ga0500661_006972 3300055283 Bacteria 2097
392 Ga0501082_0081367 3300060353 Bacteria 2795
393 Ga0501082_0137988 3300060353 Bacteria 2116
394 Ga0530510_0042790 3300061734 Bacteria 3272
395 2884218164 2884215851 Bacteria 4554841
396 Ga0105237_10142695
397 Ga0065715_10213257
398 Ga0070658_10031269
399 Ga0070658_10059870
400 Ga0070658_10233505
401 Ga0070683_100000005
402 Ga0070666_10161295
403 Ga0070680_100002280
404 Ga0070680_100005542
405 Ga0070680_100016453
406 Ga0070680_100074933
407 Ga0070660_100007086
408 Ga0070660_100056547
409 Ga0070660_100116656
410 Ga0070661_100149199
411 Ga0070668_100481301
412 Ga0070659_100065800
413 Ga0070659_100357463
414 Ga0070708_100437401
415 Ga0070663_100006241
416 Ga0070678_100203728
417 Ga0070662_100158849
418 Ga0070681_10002339
419 Ga0070681_10054091
420 Ga0070706_100159301
421 Ga0070679_100006351
422 Ga0070679_100024242
423 Ga0070679_100034008
424 Ga0070679_100140155
425 Ga0070684_100000019
426 Ga0070684_100027477
427 Ga0070684_100163269
428 Ga0068853_100057135
429 Ga0070672_100208289
430 Ga0070686_100339129
431 Ga0070665_100019891
432 Ga0070665_100096045
433 Ga0068855_100014467
434 Ga0068855_100017450
435 Ga0068855_100033903
436 Ga0068855_100042018
437 Ga0068855_100075514
438 Ga0070664_100241650
439 Ga0068857_100186691
440 Ga0068854_100071309
441 Ga0068856_100015404
442 Ga0068856_100020102
443 Ga0068856_100180150
444 Ga0068856_100412695
445 Ga0068852_100017818
446 Ga0068852_100018343
447 Ga0068852_100046351
448 Ga0068852_100055230
449 Ga0068861_100431115
450 Ga0068863_100029708
451 Ga0068858_100667720
452 Ga0068862_100029461
453 Ga0081455_10090141
454 Ga0081539_10016368
455 Ga0081539_10017078
456 Ga0075368_10032029
457 Ga0075364_10045605
458 Ga0075364_10147620
459 Ga0075432_10004299
460 Ga0075367_10009410
461 Ga0075367_10022327
462 Ga0075369_10084471
463 Ga0075366_10071168
464 Ga0075366_10192742
465 Ga0097621_100010411
466 Ga0097621_100351590
467 Ga0075370_10005332
468 Ga0068871_100096899
469 Ga0068871_100379204
470 Ga0075428_100003094
471 Ga0075428_100051689
472 Ga0075428_100055023
473 Ga0075428_100072369
474 Ga0075430_100004418
475 Ga0075430_100044528
476 Ga0075430_100100629
477 Ga0075431_100035846
478 Ga0075431_100047821
479 Ga0075431_100238043
480 Ga0075433_10044943
481 Ga0075433_10119983
482 Ga0075433_10124298
483 Ga0075434_100012888
484 Ga0075434_100085929
485 Ga0075434_100124405
486 Ga0075429_100036051
487 Ga0075429_100054640
488 Ga0075429_100220793
489 Ga0075435_100012425
490 Ga0105240_10000980
491 Ga0105240_10001247
492 Ga0105240_10025128
493 Ga0105240_10039903
494 Ga0105240_10055208
495 Ga0105240_10160777
496 Ga0105240_10259597
497 Ga0105240_10451230
498 Ga0111539_10000015
499 Ga0105245_10567004
500 Ga0105247_10033223
501 Ga0105247_10110953
502 Ga0105247_10148152
503 Ga0105247_10213760
504 Ga0114129_10002702
505 Ga0114129_10006424
506 Ga0114129_10010614
507 Ga0114129_10016935
508 Ga0114129_10043141
509 Ga0114129_10069789
510 Ga0114129_10077809
511 Ga0105243_10120957
512 Ga0105241_10302604
513 Ga0105248_10066973
514 Ga0105248_10112386
515 Ga0105248_10150202
516 Ga0105248_10335861
517 Ga0105237_10004818
518 Ga0105237_10005250
519 Ga0105237_10022251
520 Ga0105237_10118729
521 Ga0105237_10561427
522 Ga0105238_10024350
523 Ga0105238_10024788
524 Ga0105238_10259427
525 Ga0105238_10287078
526 Ga0105249_10063221
527 Ga0105249_10070521
528 Ga0105239_10031139
529 Ga0105239_10052677
530 Ga0105239_10167713
531 Ga0105239_10179022
532 Ga0105239_10186573
533 Ga0157373_10072801
534 Ga0157371_10043451
535 Ga0157371_10049692
536 Ga0157370_10006268
537 Ga0157370_10016185
538 Ga0157370_10027529
539 Ga0157370_10028306
540 Ga0157370_10039380
541 Ga0157370_10133626
542 Ga0157370_10259461
543 Ga0157369_10002857
544 Ga0157369_10009256
545 Ga0157369_10026155
546 Ga0157369_10057886
547 Ga0157369_10059500
548 Ga0157369_10124373
549 Ga0157369_10154691
550 Ga0157369_10163256
551 Ga0157369_10218907
552 Ga0157369_10264139
553 Ga0157374_10004237
554 Ga0157374_10020952
555 Ga0157374_10245428
556 Ga0157374_10266278
557 Ga0157374_10315345
558 Ga0157374_10354129
559 Ga0163162_10314792
560 Ga0163162_10315643
561 Ga0163162_10317221
562 Ga0157372_10026675
563 Ga0157372_10033504
564 Ga0157372_10069126
565 Ga0157372_10077012
566 Ga0157372_10091955
567 Ga0157372_10176808
568 Ga0157372_10206636
569 Ga0157372_10507393
570 Ga0157375_10301423
571 Ga0157375_10679914
572 Ga0163163_10048360
573 Ga0163163_10236129
574 Ga0157380_10042862
575 Ga0157379_10042155
576 Ga0157376_10053935
577 Ga0209233_1001259
578 Ga0207656_10016755
579 Ga0207710_10041307
580 Ga0207647_10001908
581 Ga0207699_10118974
582 Ga0207705_10156022
583 Ga0207705_10227782
584 Ga0207707_10050052
585 Ga0207707_10078379
586 Ga0207695_10000374
587 Ga0207695_10001495
588 Ga0207695_10018476
589 Ga0207695_10082683
590 Ga0207695_10124356
591 Ga0207695_10185963
592 Ga0207695_10205183
593 Ga0207671_10010112
594 Ga0207671_10043920
595 Ga0207660_10009456
596 Ga0207660_10010571
597 Ga0207660_10053765
598 Ga0207657_10008427
599 Ga0207657_10029880
600 Ga0207657_10196791
601 Ga0207649_10036437
602 Ga0207652_10002220
603 Ga0207652_10186486
604 Ga0207694_10004352
605 Ga0207694_10007697
606 Ga0207694_10161871
607 Ga0207650_10167580
608 Ga0207687_10007153
609 Ga0207664_10033039
610 Ga0207664_10401227
611 Ga0207690_10021540
612 Ga0207690_10174325
613 Ga0207704_10292967
614 Ga0207711_10077998
615 Ga0207661_10000024
616 Ga0207661_10069949
617 Ga0207661_10092072
618 Ga0207661_10119770
619 Ga0207661_10255300
620 Ga0207667_10000199
621 Ga0207667_10023911
622 Ga0207667_10026054
623 Ga0207667_10057798
624 Ga0207667_10064310
625 Ga0207667_10164030
626 Ga0207712_10188717
627 Ga0207640_10016303
628 Ga0207658_10225478
629 Ga0207703_10027016
630 Ga0207639_10032211
631 Ga0207639_10136215
632 Ga0207639_10138805
633 Ga0207678_10000156
634 Ga0207678_10408266
635 Ga0207708_10129943
636 Ga0207708_10194535
637 Ga0207702_10013121
638 Ga0207702_10058222
639 Ga0207702_10061301
640 Ga0207702_10072035
641 Ga0207641_10009951
642 Ga0207641_10086055
643 Ga0207648_10381105
644 Ga0207674_10047556
645 Ga0207683_10124888
646 Ga0207683_10318029
647 Ga0207698_10005195
648 Ga0207698_10131851
649 Ga0207428_10000048
650 Ga0268266_10001808
651 Ga0268266_10003682
652 Ga0265336_10004378
653 Ga0265338_10005735
654 Ga0265330_10005174
655 Ga0265325_10090225
656 Ga0265340_10046087
657 Ga0265314_10000375
658 Ga0265342_10037786
659 Ga0307405_10068028
660 Ga0307412_10275236
661 Ga0307412_10305167
662 Ga0373925_0069154
663 Ga0395898_0316179
664 Ga0395898_0445858
665 Ga0436364_0454060
666 Ga0436364_1090045
667 Ga0395901_0212265
668 Ga0436365_0532321
669 Ga0436365_1702046
670 Ga0436363_0321152
671 Ga0451576_0174061
672 Ga0466967_0127938
673 Ga0495638_0002216
674 Ga0495638_0010312
675 Ga0495638_0086931
676 Ga0495651_0006696
677 Ga0495650_0000006
678 Ga0495650_0004689
679 Ga0495580_0000668
680 Ga0495580_0011158
681 Ga0495664_0004868
682 Ga0495594_0020630
683 Ga0495606_0054979
684 Ga0495606_0097262
685 Ga0495606_0156923
686 Ga0495618_0261267
687 Ga0495628_0235900
688 Ga0495665_0009900
689 Ga0495665_0031063
690 Ga0495640_0015713
691 Ga0495640_0123580
692 Ga0495587_0046485
693 Ga0495645_0002409
694 Ga0495645_0096867
695 Ga0495667_0008541
696 Ga0495667_0068520
697 Ga0495625_0000156
698 Ga0495625_0093251
699 Ga0495599_0081223
700 Ga0495623_0006195
701 Ga0495623_0054426
702 Ga0495623_0110199
703 Ga0495649_0018521
704 Ga0495604_0074563
705 Ga0495604_0112525
706 Ga0495674_0002447
707 Ga0495674_0004669
708 Ga0495674_0017781
709 Ga0495672_0005935
710 Ga0495675_0078630
711 Ga0495675_0141781
712 Ga0495684_0001965
713 Ga0495684_0002258
714 Ga0495684_0013884
715 Ga0495684_0016878
716 Ga0495686_0026509
717 Ga0495602_0008652
718 Ga0496104_0001208
719 Ga0496104_0267796
720 Ga0496112_0046618
721 Ga0496115_0082424
722 Ga0496126_0000010
723 Ga0496126_0000063
724 Ga0496126_0000560
725 Ga0496126_0002467
726 Ga0501031_0119069
727 Ga0501032_0063736
728 Ga0501033_0009583
729 Ga0501034_0006307
730 Ga0501036_0004620
731 Ga0501036_0177087
732 Ga0501037_0046716
733 Ga0501038_0001587
734 Ga0501039_0035005
735 Ga0501041_0036431
736 Ga0501043_0018925
737 Ga0501046_0000062
738 Ga0501047_0018871
739 Ga0501070_0151278
740 Ga0501072_0144480
741 Ga0501073_0047294
742 Ga0501075_0069708
743 Ga0501076_0081246
744 Ga0501076_0101302
745 Ga0501035_0037233
746 Ga0501035_0051321
747 Ga0501044_0049955
748 Ga0501045_0015064
749 nmdc:mga00v17_84749_c1
750 nmdc:mga0k408_2038_c1
751 nmdc:mga0k408_25738_c1
752 nmdc:mga0k408_34997_c1
753 nmdc:mga04h51_8227_c1
754 nmdc:mga07m45_10414_c1
755 nmdc:mga05p37_109508_c1
756 nmdc:mga05p37_12159_c1
757 nmdc:mga05p37_13940_c1
758 nmdc:mga05p37_306376_c1
759 nmdc:mga05p37_368964_c1
760 nmdc:mga05p37_82542_c1
761 nmdc:mga09592_31887_c1
762 nmdc:mga09592_82085_c1
763 nmdc:mga0qj67_139528_c1
764 nmdc:mga0qj67_36296_c1
765 nmdc:mga0qj67_6097_c1
766 nmdc:mga06r32_20731_c1
767 nmdc:mga06r32_354663_c1
768 nmdc:mga08y16_55771_c1
769 nmdc:mga08y16_8_c1
770 nmdc:mga0n895_116148_c1
771 nmdc:mga0n895_2851_c1
772 nmdc:mga0n895_4905_c1
773 nmdc:mga0rr50_8022_c1
774 nmdc:mga0a205_17753_c1
775 nmdc:mga0a205_41620_c1
776 nmdc:mga0a205_92836_c1
777 nmdc:mga0sz30_75824_c1
778 Ga0500555_000037
779 Ga0500595_000014
780 Ga0500595_027977
781 Ga0500568_0001127
782 Ga0500611_001101
783 Ga0500645_000301
784 Ga0500599_008697
785 Ga0501084_0403525
786 Ga0500661_006972
787 Ga0501082_0081367
788 Ga0501082_0137988
789 Ga0530510_0042790
790 2884218164

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

93

329

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cny-assembly2.cif.gz_B crystal structure of a putative inositol catabolism protein iole (iole, lp_3607) from lactobacillus plantarum wcfs1 at 1.85 a resolution 0.8351 33 290
3u0h-assembly1.cif.gz_A the structure of a xylose isomerase domain protein from alicyclobacillus acidocaldarius subsp. acidocaldarius. 0.8306 49 293
1i6n-assembly1.cif.gz_A 1.8 a crystal structure of ioli protein with a binding zinc atom 0.815 32 292
4q7i-assembly1.cif.gz_A crystal structure of engineered thermostable d-tagatose 3-epimerase pcdte-var8 0.8129 31 292
2qum-assembly1.cif.gz_B crystal structure of d-tagatose 3-epimerase from pseudomonas cichorii with d-tagatose 0.808 31 292
ID Description Score Start End Superfamily
af_P45541_1_270_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8214 32 290 3.20.20.150
3cnyA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8118 33 292 3.20.20.150
1i60A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8005 36 292 3.20.20.150
1didA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8005 48 293 3.20.20.150
af_Q7T3H9_4_269_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7986 34 290 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A6A7L3N4-F1-model_v4 TIM barrel protein 0.972 18 298
AF-Q026Y0-F1-model_v4 Xylose isomerase domain protein TIM barrel 0.964 18 298 GO:0016853
AF-A0A2V8BQ08-F1-model_v4 Xylose isomerase 0.9547 185 298 GO:0016853
AF-A0A831TP28-F1-model_v4 Xylose isomerase-like TIM barrel domain-containing protein 0.9542 30 298
AF-A0A316NFV0-F1-model_v4 Xylose isomerase-like TIM barrel domain-containing protein 0.9539 31 295 GO:0016829

Map