F433201
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 395 | 270 | 382 | 214 |
Family's Representative Sequence
| Representative Sequence | 3300009177|Ga0105248_10019877|Ga0105248_1001987710 |
| Length | 239 |
| Sequence | MNRRQRRKGVAFPPQAVEIAAMASKAGVRPTRVGRDFIARHGETVFNAAGRLQGDHPHTPLTRAGFAQADEMGAALRAELGVRPRLTLWASPTGRALQTLAVIAEHLELDWHAARTDARLVEIGMGGWGGRYYADLAAERGSVVDPAAGLLVPAPDGESYRAIAARVSGWLADTDDDSGDRLVIMHGISSRVMRGVMTGLPDLPGYDAPAATSLPQGSVVMIAGGVERLVHAGGGGTRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 2 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 3 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 4 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 5 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 6 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 7 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 8 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 9 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 10 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 11 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 12 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 13 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 14 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 15 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 16 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 17 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 18 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 19 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 20 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 21 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 22 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 23 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 25 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 28 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 29 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 30 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 31 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 32 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 33 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 34 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 68 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 69 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 72 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 93 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 94 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 95 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 96 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 97 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 98 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 101 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 104 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 106 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 113 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 153 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 154 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 155 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 156 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 157 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 158 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 159 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 160 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 161 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 162 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 163 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 164 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 165 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 166 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 167 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 168 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 169 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 170 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 171 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 172 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 173 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 174 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 175 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 176 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 177 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 178 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 179 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 180 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 181 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 220 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 221 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 222 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 223 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 224 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 225 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 226 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 227 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 228 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 229 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 230 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 231 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 232 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 233 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 234 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 235 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 236 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 237 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 238 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 239 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 240 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 241 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 243 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 245 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 246 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 247 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 248 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 249 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 250 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 251 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 252 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 253 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 254 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 255 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 256 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 257 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 258 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 259 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 260 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 261 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 262 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 263 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 264 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 265 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 266 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 267 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 268 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 269 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 270 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.7 |
| Metatranscriptomes | 1.01 |
| Isolates | 3.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.76 |
| Bulb | 0 |
| Endosphere | 24.3 |
| Nodule | 0 |
| Rhizoplane | 3.8 |
| Rhizosphere | 60.51 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.63 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARcpr5oldR_c004634 | 3300000041 | Bacteria | 1189 |
| 2 | ARcpr5yngRDRAFT_c008251 | 3300000043 | Bacteria | 902 |
| 3 | JGI24741J21665_1002127 | 3300001915 | Bacteria | 5274 |
| 4 | JGI24740J21852_10062956 | 3300001979 | Bacteria | 1017 |
| 5 | JGI24735J21928_10034764 | 3300002067 | Bacteria | 1484 |
| 6 | JGI25150J39212_1000128 | 3300002774 | Bacteria | 42771 |
| 7 | JGI25151J46595_10030545 | 3300003187 | Bacteria | 2117 |
| 8 | JGI25165J46597_1000166 | 3300003214 | Bacteria | 103861 |
| 9 | JGI25153J46596_10000027 | 3300003215 | Bacteria | 210760 |
| 10 | JGI25153J46596_10012056 | 3300003215 | Bacteria | 3769 |
| 11 | rootL2_10015964 | 3300003322 | Bacteria | 1335 |
| 12 | Ga0055525_1000119 | 3300003759 | Bacteria | 120272 |
| 13 | Ga0055542_1000076 | 3300003762 | Bacteria | 139662 |
| 14 | Ga0055529_1000004 | 3300003763 | Bacteria | 433331 |
| 15 | Ga0055526_1005136 | 3300003771 | Bacteria | 7628 |
| 16 | Ga0055537_1004563 | 3300003773 | Bacteria | 3935 |
| 17 | Ga0055537_1008861 | 3300003773 | Bacteria | 2275 |
| 18 | Ga0055524_1000324 | 3300003775 | Bacteria | 44924 |
| 19 | Ga0055536_1007840 | 3300003781 | Bacteria | 4704 |
| 20 | Ga0055530_10000202 | 3300003791 | Bacteria | 53648 |
| 21 | Ga0055530_10007920 | 3300003791 | Bacteria | 4357 |
| 22 | Ga0055540_1003208 | 3300003792 | Bacteria | 8032 |
| 23 | Ga0055540_1004149 | 3300003792 | Bacteria | 6694 |
| 24 | Ga0055531_10000090 | 3300003794 | Bacteria | 100342 |
| 25 | Ga0055531_10006935 | 3300003794 | Bacteria | 6309 |
| 26 | Ga0065165_1001918 | 3300005262 | Bacteria | 19856 |
| 27 | Ga0065165_1004381 | 3300005262 | Bacteria | 8814 |
| 28 | Ga0065165_1012524 | 3300005262 | Bacteria | 3448 |
| 29 | Ga0065165_1016150 | 3300005262 | Bacteria | 2809 |
| 30 | Ga0070658_10002454 | 3300005327 | Bacteria | 15511 |
| 31 | Ga0070658_10172368 | 3300005327 | Bacteria | 1818 |
| 32 | Ga0070683_100051395 | 3300005329 | Bacteria | 3816 |
| 33 | Ga0070670_100422294 | 3300005331 | Bacteria | 1179 |
| 34 | Ga0070660_100566229 | 3300005339 | Bacteria | 948 |
| 35 | Ga0070687_100124163 | 3300005343 | Bacteria | 1481 |
| 36 | Ga0070661_100000614 | 3300005344 | Bacteria | 26629 |
| 37 | Ga0070668_100193074 | 3300005347 | Bacteria | 1668 |
| 38 | Ga0070669_100165743 | 3300005353 | Bacteria | 1720 |
| 39 | Ga0070675_100379063 | 3300005354 | Unclassified | 1259 |
| 40 | Ga0070671_100137837 | 3300005355 | Bacteria | 2058 |
| 41 | Ga0070674_100016877 | 3300005356 | Bacteria | 4581 |
| 42 | Ga0070674_100039904 | 3300005356 | Bacteria | 3173 |
| 43 | Ga0070674_100154189 | 3300005356 | Bacteria | 1736 |
| 44 | Ga0070659_100556372 | 3300005366 | Bacteria | 982 |
| 45 | Ga0070667_100196203 | 3300005367 | Bacteria | 1790 |
| 46 | Ga0070678_100000786 | 3300005456 | Bacteria | 15935 |
| 47 | Ga0070662_100549005 | 3300005457 | Unclassified | 968 |
| 48 | Ga0068867_100037571 | 3300005459 | Bacteria | 3520 |
| 49 | Ga0070684_100579121 | 3300005535 | Bacteria | 1043 |
| 50 | Ga0068853_100828330 | 3300005539 | Bacteria | 887 |
| 51 | Ga0068853_100941239 | 3300005539 | Bacteria | 830 |
| 52 | Ga0070686_100000180 | 3300005544 | Bacteria | 44847 |
| 53 | Ga0070696_100459661 | 3300005546 | Bacteria | 1006 |
| 54 | Ga0070665_100000067 | 3300005548 | Bacteria | 204787 |
| 55 | Ga0070665_100000145 | 3300005548 | Bacteria | 131599 |
| 56 | Ga0070665_100000567 | 3300005548 | Bacteria | 51614 |
| 57 | Ga0068855_100466365 | 3300005563 | Bacteria | 1376 |
| 58 | Ga0068857_100009574 | 3300005577 | Bacteria | 8417 |
| 59 | Ga0068854_100067809 | 3300005578 | Bacteria | 2600 |
| 60 | Ga0068856_100073783 | 3300005614 | Bacteria | 3378 |
| 61 | Ga0068856_100191821 | 3300005614 | Bacteria | 2057 |
| 62 | Ga0068852_100082034 | 3300005616 | Bacteria | 2864 |
| 63 | Ga0068852_100097753 | 3300005616 | Bacteria | 2642 |
| 64 | Ga0068859_100015618 | 3300005617 | Bacteria | 7630 |
| 65 | Ga0068864_100000742 | 3300005618 | Bacteria | 27346 |
| 66 | Ga0068851_10324291 | 3300005834 | Bacteria | 890 |
| 67 | Ga0068863_100056131 | 3300005841 | Bacteria | 3729 |
| 68 | Ga0068858_100000275 | 3300005842 | Bacteria | 55318 |
| 69 | Ga0068858_100053878 | 3300005842 | Bacteria | 3720 |
| 70 | Ga0068860_100000680 | 3300005843 | Bacteria | 39339 |
| 71 | Ga0068862_100000193 | 3300005844 | Bacteria | 67697 |
| 72 | Ga0081539_10009013 | 3300005985 | Bacteria | 8477 |
| 73 | Ga0075369_10056906 | 3300006186 | Bacteria | 1700 |
| 74 | Ga0075366_10032737 | 3300006195 | Bacteria | 3060 |
| 75 | Ga0097621_100052631 | 3300006237 | Bacteria | 3317 |
| 76 | Ga0075434_100126641 | 3300006871 | Bacteria | 2571 |
| 77 | Ga0097620_100015617 | 3300006931 | Bacteria | 7630 |
| 78 | Ga0105245_10000232 | 3300009098 | Bacteria | 53204 |
| 79 | Ga0105245_10050673 | 3300009098 | Bacteria | 3721 |
| 80 | Ga0105245_10345395 | 3300009098 | Bacteria | 1473 |
| 81 | Ga0105247_10013641 | 3300009101 | Bacteria | 4873 |
| 82 | Ga0105243_10000812 | 3300009148 | Bacteria | 29753 |
| 83 | Ga0105243_10887812 | 3300009148 | Bacteria | 886 |
| 84 | Ga0105241_10003240 | 3300009174 | Bacteria | 12103 |
| 85 | Ga0105248_10019877 | 3300009177 | Bacteria | 7437 |
| 86 | Ga0105237_10021104 | 3300009545 | Bacteria | 6700 |
| 87 | Ga0105237_10961856 | 3300009545 | Bacteria | 861 |
| 88 | Ga0105238_10097095 | 3300009551 | Bacteria | 2933 |
| 89 | Ga0105249_10000002 | 3300009553 | Bacteria | 376207 |
| 90 | Ga0105239_10414169 | 3300010375 | Bacteria | 1526 |
| 91 | Ga0105239_10598372 | 3300010375 | Bacteria | 1258 |
| 92 | Ga0105246_10729161 | 3300011119 | Bacteria | 872 |
| 93 | Ga0157373_10586747 | 3300013100 | Bacteria | 810 |
| 94 | Ga0157371_10000197 | 3300013102 | Bacteria | 88423 |
| 95 | Ga0157369_10215304 | 3300013105 | Bacteria | 2012 |
| 96 | Ga0157374_10473210 | 3300013296 | Bacteria | 1255 |
| 97 | Ga0157378_10038176 | 3300013297 | Bacteria | 4256 |
| 98 | Ga0157378_10233332 | 3300013297 | Bacteria | 1754 |
| 99 | Ga0163162_10001358 | 3300013306 | Bacteria | 22795 |
| 100 | Ga0163162_10529054 | 3300013306 | Bacteria | 1308 |
| 101 | Ga0163162_10780614 | 3300013306 | Bacteria | 1074 |
| 102 | Ga0157372_10429520 | 3300013307 | Bacteria | 1540 |
| 103 | Ga0163163_10115281 | 3300014325 | Bacteria | 2718 |
| 104 | Ga0157380_10145241 | 3300014326 | Bacteria | 2044 |
| 105 | Ga0157380_10286260 | 3300014326 | Bacteria | 1511 |
| 106 | Ga0183363_1007 | 3300015690 | Bacteria | 315687 |
| 107 | Ga0206356_10944380 | 3300020070 | Bacteria | 2559 |
| 108 | Ga0206354_10538658 | 3300020081 | Bacteria | 4055 |
| 109 | Ga0206353_10762095 | 3300020082 | Bacteria | 2275 |
| 110 | Ga0206353_11732096 | 3300020082 | Bacteria | 3169 |
| 111 | Ga0213873_10000014 | 3300021358 | Bacteria | 139420 |
| 112 | Ga0213876_10000020 | 3300021384 | Bacteria | 268316 |
| 113 | Ga0213876_10003478 | 3300021384 | Bacteria | 9001 |
| 114 | Ga0213876_10041095 | 3300021384 | Bacteria | 2444 |
| 115 | Ga0209563_100024 | 3300025230 | Bacteria | 601155 |
| 116 | Ga0209437_111166 | 3300025233 | Bacteria | 1350 |
| 117 | Ga0207425_1000005 | 3300025245 | Bacteria | 900502 |
| 118 | Ga0207425_1034022 | 3300025245 | Bacteria | 1001 |
| 119 | Ga0209677_105926 | 3300025253 | Bacteria | 3045 |
| 120 | Ga0209148_1000008 | 3300025254 | Bacteria | 1504371 |
| 121 | Ga0209129_1004436 | 3300025258 | Bacteria | 5471 |
| 122 | Ga0209233_1000222 | 3300025261 | Bacteria | 103917 |
| 123 | Ga0209565_1000011 | 3300025263 | Bacteria | 637062 |
| 124 | Ga0209565_1000121 | 3300025263 | Bacteria | 111264 |
| 125 | Ga0209455_1000002 | 3300025272 | Bacteria | 1505459 |
| 126 | Ga0209455_1031187 | 3300025272 | Bacteria | 899 |
| 127 | Ga0209675_1006210 | 3300025291 | Bacteria | 4840 |
| 128 | Ga0209676_1012128 | 3300025292 | Bacteria | 3416 |
| 129 | Ga0209025_1001924 | 3300025294 | Bacteria | 24077 |
| 130 | Ga0209758_1000002 | 3300025297 | Bacteria | 1400310 |
| 131 | Ga0209758_1000007 | 3300025297 | Bacteria | 1270410 |
| 132 | Ga0209758_1008966 | 3300025297 | Bacteria | 6337 |
| 133 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 134 | Ga0209050_1000051 | 3300025298 | Bacteria | 353153 |
| 135 | Ga0209050_1009405 | 3300025298 | Bacteria | 5007 |
| 136 | Ga0209256_1000016 | 3300025299 | Bacteria | 599092 |
| 137 | Ga0209051_1000802 | 3300025303 | Bacteria | 33033 |
| 138 | Ga0209257_1000028 | 3300025304 | Bacteria | 699493 |
| 139 | Ga0209257_1000555 | 3300025304 | Bacteria | 64065 |
| 140 | Ga0209257_1000855 | 3300025304 | Bacteria | 43394 |
| 141 | Ga0209257_1010458 | 3300025304 | Bacteria | 4691 |
| 142 | Ga0207656_10003245 | 3300025321 | Bacteria | 5567 |
| 143 | Ga0207688_10040220 | 3300025901 | Bacteria | 2598 |
| 144 | Ga0207647_10327155 | 3300025904 | Bacteria | 870 |
| 145 | Ga0207705_10000489 | 3300025909 | Bacteria | 33785 |
| 146 | Ga0207654_10000273 | 3300025911 | Bacteria | 31494 |
| 147 | Ga0207707_10291264 | 3300025912 | Bacteria | 1412 |
| 148 | Ga0207695_10018525 | 3300025913 | Bacteria | 8048 |
| 149 | Ga0207671_10008023 | 3300025914 | Bacteria | 9033 |
| 150 | Ga0207671_10008263 | 3300025914 | Bacteria | 8855 |
| 151 | Ga0207649_10000443 | 3300025920 | Bacteria | 29944 |
| 152 | Ga0207649_10205475 | 3300025920 | Bacteria | 1394 |
| 153 | Ga0207681_10190384 | 3300025923 | Bacteria | 1569 |
| 154 | Ga0207694_10032672 | 3300025924 | Bacteria | 3984 |
| 155 | Ga0207694_10159567 | 3300025924 | Bacteria | 1821 |
| 156 | Ga0207694_10232578 | 3300025924 | Bacteria | 1505 |
| 157 | Ga0207659_10239277 | 3300025926 | Unclassified | 1468 |
| 158 | Ga0207687_10004119 | 3300025927 | Bacteria | 9735 |
| 159 | Ga0207687_10031413 | 3300025927 | Bacteria | 3588 |
| 160 | Ga0207687_10825766 | 3300025927 | Bacteria | 791 |
| 161 | Ga0207690_10011928 | 3300025932 | Bacteria | 5196 |
| 162 | Ga0207690_10623593 | 3300025932 | Bacteria | 882 |
| 163 | Ga0207706_10005757 | 3300025933 | Bacteria | 11532 |
| 164 | Ga0207709_10151375 | 3300025935 | Bacteria | 1607 |
| 165 | Ga0207669_10000251 | 3300025937 | Bacteria | 24482 |
| 166 | Ga0207669_10024854 | 3300025937 | Bacteria | 3226 |
| 167 | Ga0207711_10006789 | 3300025941 | Bacteria | 9616 |
| 168 | Ga0207661_10149643 | 3300025944 | Bacteria | 2017 |
| 169 | Ga0207667_10000001 | 3300025949 | Bacteria | 1178522 |
| 170 | Ga0207712_10000002 | 3300025961 | Bacteria | 706628 |
| 171 | Ga0207668_10100938 | 3300025972 | Bacteria | 2144 |
| 172 | Ga0207668_10484877 | 3300025972 | Bacteria | 1061 |
| 173 | Ga0207640_10001706 | 3300025981 | Bacteria | 11781 |
| 174 | Ga0207703_10000272 | 3300026035 | Bacteria | 57191 |
| 175 | Ga0207703_10000334 | 3300026035 | Bacteria | 51370 |
| 176 | Ga0207639_10013303 | 3300026041 | Bacteria | 5756 |
| 177 | Ga0207639_10044507 | 3300026041 | Bacteria | 3339 |
| 178 | Ga0207639_10108706 | 3300026041 | Bacteria | 2255 |
| 179 | Ga0207639_10295654 | 3300026041 | Bacteria | 1429 |
| 180 | Ga0207639_10546866 | 3300026041 | Bacteria | 1063 |
| 181 | Ga0207678_10015021 | 3300026067 | Bacteria | 6813 |
| 182 | Ga0207708_10260545 | 3300026075 | Bacteria | 1400 |
| 183 | Ga0207702_10003678 | 3300026078 | Bacteria | 13879 |
| 184 | Ga0207641_10063720 | 3300026088 | Bacteria | 3149 |
| 185 | Ga0207641_10100849 | 3300026088 | Bacteria | 2543 |
| 186 | Ga0207648_10093222 | 3300026089 | Bacteria | 2634 |
| 187 | Ga0207648_10125079 | 3300026089 | Bacteria | 2261 |
| 188 | Ga0207676_10000217 | 3300026095 | Bacteria | 49723 |
| 189 | Ga0207674_10008106 | 3300026116 | Bacteria | 12179 |
| 190 | Ga0207674_10226904 | 3300026116 | Bacteria | 1816 |
| 191 | Ga0207683_10008013 | 3300026121 | Bacteria | 9032 |
| 192 | Ga0207683_10384176 | 3300026121 | Bacteria | 1291 |
| 193 | Ga0207698_10012704 | 3300026142 | Bacteria | 5523 |
| 194 | Ga0207698_10109798 | 3300026142 | Bacteria | 2309 |
| 195 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 196 | Ga0268266_10000173 | 3300028379 | Bacteria | 117695 |
| 197 | Ga0268266_10001468 | 3300028379 | Bacteria | 28028 |
| 198 | Ga0268265_10000048 | 3300028380 | Bacteria | 178523 |
| 199 | Ga0268264_10000304 | 3300028381 | Bacteria | 79130 |
| 200 | Ga0307517_10001703 | 3300028786 | Bacteria | 36321 |
| 201 | Ga0307517_10023907 | 3300028786 | Bacteria | 7565 |
| 202 | Ga0307515_10463024 | 3300028794 | Bacteria | 882 |
| 203 | Ga0307513_10028207 | 3300031456 | Bacteria | 6422 |
| 204 | Ga0307513_10046629 | 3300031456 | Bacteria | 4722 |
| 205 | Ga0307513_10052123 | 3300031456 | Bacteria | 4408 |
| 206 | Ga0307508_10000251 | 3300031616 | Bacteria | 65275 |
| 207 | Ga0307410_10459707 | 3300031852 | Bacteria | 1040 |
| 208 | Ga0307412_10000160 | 3300031911 | Bacteria | 47459 |
| 209 | Ga0307412_10488305 | 3300031911 | Bacteria | 1023 |
| 210 | Ga0307416_100259022 | 3300032002 | Bacteria | 1699 |
| 211 | Ga0307510_10010934 | 3300033180 | Bacteria | 10783 |
| 212 | Ga0307510_10058820 | 3300033180 | Bacteria | 3976 |
| 213 | Ga0373954_0078934 | 3300035118 | Bacteria | 1571 |
| 214 | Ga0395905_0231144 | 3300037471 | Bacteria | 1729 |
| 215 | Ga0395901_0072135 | 3300038443 | Bacteria | 3599 |
| 216 | Ga0237816_00171 | 3300039145 | Bacteria | 5179 |
| 217 | Ga0436365_0751207 | 3300039437 | Bacteria | 13250 |
| 218 | Ga0436365_1447172 | 3300039437 | Bacteria | 79922 |
| 219 | Ga0436365_1638339 | 3300039437 | Bacteria | 5293 |
| 220 | Ga0436363_0676919 | 3300039450 | Bacteria | 1112 |
| 221 | Ga0436362_0847557 | 3300039453 | Bacteria | 84207 |
| 222 | Ga0439461_0000342 | 3300041410 | Bacteria | 6640 |
| 223 | Ga0439461_0012942 | 3300041410 | Bacteria | 1567 |
| 224 | Ga0439465_0002464 | 3300041413 | Bacteria | 6043 |
| 225 | Ga0439465_0010492 | 3300041413 | Bacteria | 2908 |
| 226 | Ga0451807_1258736 | 3300041486 | Bacteria | 810 |
| 227 | Ga0439431_0002960 | 3300041997 | Bacteria | 3731 |
| 228 | Ga0439433_0073116 | 3300041999 | Bacteria | 828 |
| 229 | Ga0439443_008944 | 3300042003 | Bacteria | 1425 |
| 230 | Ga0439445_0009573 | 3300042004 | Bacteria | 2285 |
| 231 | Ga0439445_0012133 | 3300042004 | Bacteria | 2066 |
| 232 | Ga0439432_001045 | 3300042006 | Bacteria | 10506 |
| 233 | Ga0439432_087448 | 3300042006 | Bacteria | 940 |
| 234 | Ga0439449_0112504 | 3300042007 | Bacteria | 1009 |
| 235 | Ga0439452_012067 | 3300042010 | Bacteria | 2468 |
| 236 | Ga0439457_009549 | 3300042014 | Bacteria | 2255 |
| 237 | Ga0439462_0002511 | 3300042015 | Bacteria | 4271 |
| 238 | Ga0439462_0011600 | 3300042015 | Bacteria | 2246 |
| 239 | Ga0450923_024796 | 3300042125 | Bacteria | 1192 |
| 240 | Ga0439434_0000405 | 3300042435 | Bacteria | 12271 |
| 241 | Ga0439434_0020241 | 3300042435 | Bacteria | 1997 |
| 242 | Ga0495617_015748 | 3300046452 | Bacteria | 2559 |
| 243 | Ga0495590_0062781 | 3300046457 | Bacteria | 1300 |
| 244 | Ga0495629_0011780 | 3300046459 | Bacteria | 6347 |
| 245 | Ga0495638_0001538 | 3300046460 | Bacteria | 20746 |
| 246 | Ga0495650_0000792 | 3300046471 | Bacteria | 38739 |
| 247 | Ga0495584_0050523 | 3300046491 | Bacteria | 2094 |
| 248 | Ga0495585_0005849 | 3300046492 | Bacteria | 7710 |
| 249 | Ga0495585_0033403 | 3300046492 | Bacteria | 2912 |
| 250 | Ga0495594_0186906 | 3300046499 | Bacteria | 1180 |
| 251 | Ga0495596_0019300 | 3300046500 | Bacteria | 2802 |
| 252 | Ga0495607_0117378 | 3300046501 | Bacteria | 1402 |
| 253 | Ga0495583_0003563 | 3300046506 | Bacteria | 11728 |
| 254 | Ga0495583_0004282 | 3300046506 | Bacteria | 10329 |
| 255 | Ga0495583_0006785 | 3300046506 | Bacteria | 7399 |
| 256 | Ga0495583_0031812 | 3300046506 | Bacteria | 2553 |
| 257 | Ga0495606_0002822 | 3300046507 | Bacteria | 19294 |
| 258 | Ga0495606_0018630 | 3300046507 | Bacteria | 5196 |
| 259 | Ga0495606_0130071 | 3300046507 | Bacteria | 1497 |
| 260 | Ga0495631_0058551 | 3300046518 | Bacteria | 1675 |
| 261 | Ga0495637_0048933 | 3300046520 | Bacteria | 1778 |
| 262 | Ga0495637_0070234 | 3300046520 | Bacteria | 1415 |
| 263 | Ga0495643_0007657 | 3300046522 | Bacteria | 6927 |
| 264 | Ga0495643_0143128 | 3300046522 | Bacteria | 1190 |
| 265 | Ga0495648_0000123 | 3300046524 | Bacteria | 92159 |
| 266 | Ga0495648_0003352 | 3300046524 | Bacteria | 14115 |
| 267 | Ga0495648_0055575 | 3300046524 | Bacteria | 2386 |
| 268 | Ga0495648_0137630 | 3300046524 | Bacteria | 1289 |
| 269 | Ga0495642_0016383 | 3300046528 | Bacteria | 2888 |
| 270 | Ga0495587_0087560 | 3300046536 | Bacteria | 1802 |
| 271 | Ga0495609_0161567 | 3300046538 | Bacteria | 949 |
| 272 | Ga0495597_0028596 | 3300046542 | Bacteria | 2551 |
| 273 | Ga0495622_0003063 | 3300046557 | Bacteria | 7929 |
| 274 | Ga0495622_0028547 | 3300046557 | Bacteria | 2606 |
| 275 | Ga0495633_0004307 | 3300046558 | Bacteria | 9088 |
| 276 | Ga0495668_0000149 | 3300046616 | Bacteria | 105826 |
| 277 | Ga0495611_0001502 | 3300046648 | Bacteria | 11538 |
| 278 | Ga0495611_0169035 | 3300046648 | Bacteria | 1022 |
| 279 | Ga0495625_0001285 | 3300046660 | Bacteria | 31497 |
| 280 | Ga0495625_0062067 | 3300046660 | Bacteria | 2642 |
| 281 | Ga0495625_0085757 | 3300046660 | Bacteria | 2185 |
| 282 | Ga0495625_0127614 | 3300046660 | Bacteria | 1725 |
| 283 | Ga0495625_0478849 | 3300046660 | Bacteria | 764 |
| 284 | Ga0495661_0354046 | 3300046665 | Bacteria | 722 |
| 285 | Ga0495669_0000951 | 3300046684 | Bacteria | 12114 |
| 286 | Ga0495613_0180714 | 3300046689 | Bacteria | 1494 |
| 287 | Ga0495670_0001049 | 3300046691 | Bacteria | 13375 |
| 288 | Ga0495670_0011359 | 3300046691 | Bacteria | 4378 |
| 289 | Ga0495649_0008479 | 3300046694 | Bacteria | 6182 |
| 290 | Ga0495660_0027783 | 3300046810 | Bacteria | 3199 |
| 291 | Ga0495660_0084637 | 3300046810 | Bacteria | 1658 |
| 292 | Ga0495683_0000751 | 3300047323 | Bacteria | 23402 |
| 293 | Ga0495687_000181 | 3300047443 | Bacteria | 91455 |
| 294 | Ga0495687_000286 | 3300047443 | Bacteria | 66428 |
| 295 | Ga0495677_0004983 | 3300047445 | Bacteria | 5065 |
| 296 | Ga0495677_0064507 | 3300047445 | Bacteria | 1361 |
| 297 | Ga0495681_0027876 | 3300047470 | Bacteria | 2916 |
| 298 | Ga0495681_0046417 | 3300047470 | Bacteria | 2071 |
| 299 | Ga0495686_0000209 | 3300047472 | Bacteria | 108972 |
| 300 | Ga0495686_0036224 | 3300047472 | Bacteria | 3167 |
| 301 | Ga0495686_0039267 | 3300047472 | Bacteria | 3024 |
| 302 | Ga0495686_0135316 | 3300047472 | Bacteria | 1458 |
| 303 | Ga0496100_0618053 | 3300048903 | Bacteria | 842 |
| 304 | Ga0496101_0172007 | 3300048904 | Bacteria | 1665 |
| 305 | Ga0496102_0004598 | 3300048905 | Bacteria | 11673 |
| 306 | Ga0496103_0000784 | 3300048906 | Bacteria | 23390 |
| 307 | Ga0496104_0034197 | 3300048907 | Bacteria | 4737 |
| 308 | Ga0496105_0106749 | 3300048908 | Bacteria | 2311 |
| 309 | Ga0496107_0093653 | 3300048910 | Bacteria | 2197 |
| 310 | Ga0496109_0670320 | 3300048912 | Bacteria | 974 |
| 311 | Ga0496110_0043524 | 3300048913 | Bacteria | 3921 |
| 312 | Ga0496114_0025174 | 3300048917 | Bacteria | 4862 |
| 313 | Ga0496115_0000783 | 3300048918 | Bacteria | 23323 |
| 314 | Ga0496115_0003374 | 3300048918 | Bacteria | 11458 |
| 315 | Ga0496115_0145372 | 3300048918 | Bacteria | 1957 |
| 316 | Ga0496116_0033294 | 3300048919 | Bacteria | 3659 |
| 317 | Ga0496117_0001166 | 3300048920 | Bacteria | 39515 |
| 318 | Ga0496118_0000039 | 3300048921 | Bacteria | 305458 |
| 319 | Ga0496120_0022464 | 3300048923 | Bacteria | 3968 |
| 320 | Ga0496121_0000123 | 3300048924 | Bacteria | 172448 |
| 321 | Ga0496121_0001367 | 3300048924 | Bacteria | 41529 |
| 322 | Ga0496121_0032716 | 3300048924 | Bacteria | 4721 |
| 323 | Ga0496122_0033588 | 3300048925 | Bacteria | 4216 |
| 324 | Ga0496122_0361105 | 3300048925 | Bacteria | 754 |
| 325 | Ga0496123_0065126 | 3300048926 | Bacteria | 2318 |
| 326 | Ga0496123_0173735 | 3300048926 | Bacteria | 1133 |
| 327 | Ga0496124_0000232 | 3300048927 | Bacteria | 108986 |
| 328 | Ga0496124_0001482 | 3300048927 | Bacteria | 34498 |
| 329 | Ga0496124_0001624 | 3300048927 | Bacteria | 32235 |
| 330 | Ga0496124_0039731 | 3300048927 | Bacteria | 4075 |
| 331 | Ga0496125_0010075 | 3300048928 | Bacteria | 9588 |
| 332 | Ga0496125_0037628 | 3300048928 | Bacteria | 4204 |
| 333 | Ga0496126_0001437 | 3300048929 | Bacteria | 37376 |
| 334 | Ga0496126_0187833 | 3300048929 | Bacteria | 1752 |
| 335 | Ga0496126_0197356 | 3300048929 | Bacteria | 1701 |
| 336 | Ga0501241_063773 | 3300049758 | Bacteria | 743 |
| 337 | nmdc:mga0k408_14784_c1 | 3300050493 | Bacteria | 4307 |
| 338 | nmdc:mga07m45_37750_c1 | 3300050496 | Bacteria | 2694 |
| 339 | nmdc:mga0n895_282865_c1 | 3300050512 | Bacteria | 1682 |
| 340 | Ga0500610_0003135 | 3300053079 | Bacteria | 6277 |
| 341 | Ga0495655_0035074 | 3300053083 | Bacteria | 1246 |
| 342 | Ga0500643_011454 | 3300053087 | Bacteria | 3235 |
| 343 | Ga0500643_014523 | 3300053087 | Bacteria | 2734 |
| 344 | Ga0500643_028405 | 3300053087 | Bacteria | 1730 |
| 345 | Ga0500583_0099649 | 3300053092 | Bacteria | 1422 |
| 346 | Ga0500651_0196820 | 3300053093 | Bacteria | 1190 |
| 347 | Ga0500566_0004026 | 3300053094 | Bacteria | 8765 |
| 348 | Ga0500641_0004051 | 3300053096 | Bacteria | 5174 |
| 349 | Ga0500641_0031997 | 3300053096 | Bacteria | 2078 |
| 350 | Ga0500650_0150380 | 3300053098 | Bacteria | 1077 |
| 351 | Ga0500555_011321 | 3300053103 | Bacteria | 2562 |
| 352 | Ga0500562_018356 | 3300053108 | Bacteria | 1806 |
| 353 | Ga0500562_043972 | 3300053108 | Bacteria | 1189 |
| 354 | Ga0500562_071676 | 3300053108 | Bacteria | 935 |
| 355 | Ga0500595_004353 | 3300053119 | Bacteria | 6371 |
| 356 | Ga0500595_005457 | 3300053119 | Bacteria | 5547 |
| 357 | Ga0500595_013100 | 3300053119 | Bacteria | 3184 |
| 358 | Ga0500597_002220 | 3300053120 | Bacteria | 5313 |
| 359 | Ga0500642_0006722 | 3300053130 | Bacteria | 3813 |
| 360 | Ga0500652_056579 | 3300053131 | Bacteria | 1609 |
| 361 | Ga0500658_0004296 | 3300053134 | Bacteria | 5341 |
| 362 | Ga0500658_0005688 | 3300053134 | Bacteria | 4641 |
| 363 | Ga0500658_0011875 | 3300053134 | Bacteria | 3211 |
| 364 | Ga0500658_0049295 | 3300053134 | Bacteria | 1716 |
| 365 | Ga0500559_0008105 | 3300053136 | Bacteria | 4622 |
| 366 | Ga0500559_0014726 | 3300053136 | Bacteria | 3304 |
| 367 | Ga0500568_0007530 | 3300053139 | Bacteria | 5331 |
| 368 | Ga0500568_0034212 | 3300053139 | Bacteria | 2080 |
| 369 | Ga0500573_0000041 | 3300053140 | Bacteria | 103805 |
| 370 | Ga0500577_0022309 | 3300053142 | Bacteria | 2099 |
| 371 | Ga0500604_0002928 | 3300053151 | Bacteria | 4612 |
| 372 | Ga0500616_0001169 | 3300053153 | Bacteria | 26764 |
| 373 | Ga0500616_0046932 | 3300053153 | Bacteria | 2295 |
| 374 | Ga0500619_039802 | 3300053154 | Bacteria | 1479 |
| 375 | Ga0500624_000013 | 3300053157 | Bacteria | 165889 |
| 376 | Ga0500636_0003876 | 3300053177 | Bacteria | 8442 |
| 377 | Ga0500637_0001361 | 3300053178 | Bacteria | 10361 |
| 378 | Ga0500645_000083 | 3300053730 | Bacteria | 76285 |
| 379 | Ga0500645_000910 | 3300053730 | Bacteria | 17019 |
| 380 | Ga0500645_072096 | 3300053730 | Bacteria | 991 |
| 381 | Ga0500596_010498 | 3300053735 | Bacteria | 1429 |
| 382 | Ga0500587_009155 | 3300053739 | Bacteria | 1268 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048929 | Ga0496126_0187833 | Ga0496126_0187833_193_702 | 169 |
| 2 | 3300005548 | Ga0070665_100000567 | Ga0070665_10000056720 | 187 |
| 3 | 3300028379 | Ga0268266_10001468 | Ga0268266_100014688 | 187 |
| 4 | 3300053153 | Ga0500616_0046932 | Ga0500616_0046932_1107_1763 | 190 |
| 5 | 3300042003 | Ga0439443_008944 | Ga0439443_008944_826_1410 | 191 |
| 6 | 3300053139 | Ga0500568_0007530 | Ga0500568_0007530_467_1123 | 191 |
| 7 | 3300053153 | Ga0500616_0001169 | Ga0500616_0001169_22114_22770 | 191 |
| 8 | 3300015690 | Ga0183363_1007 | Ga0183363_100763 | 192 |
| 9 | 3300041486 | Ga0451807_1258736 | Ga0451807_1258736_48_680 | 193 |
| 10 | 3300021384 | Ga0213876_10003478 | Ga0213876_100034784 | 198 |
| 11 | 3300039437 | Ga0436365_0751207 | Ga0436365_0751207_7065_7694 | 198 |
| 12 | 3300005329 | Ga0070683_100051395 | Ga0070683_1000513952 | 199 |
| 13 | 3300005535 | Ga0070684_100579121 | Ga0070684_1005791212 | 199 |
| 14 | 3300005546 | Ga0070696_100459661 | Ga0070696_1004596612 | 199 |
| 15 | 3300005614 | Ga0068856_100191821 | Ga0068856_1001918212 | 199 |
| 16 | 3300013105 | Ga0157369_10215304 | Ga0157369_102153042 | 199 |
| 17 | 3300013307 | Ga0157372_10429520 | Ga0157372_104295202 | 199 |
| 18 | 3300025912 | Ga0207707_10291264 | Ga0207707_102912643 | 199 |
| 19 | 3300025944 | Ga0207661_10149643 | Ga0207661_101496432 | 199 |
| 20 | 3300053151 | Ga0500604_0002928 | Ga0500604_0002928_591_1235 | 200 |
| 21 | 3300021358 | Ga0213873_10000014 | Ga0213873_10000014124 | 203 |
| 22 | 3300021384 | Ga0213876_10000020 | Ga0213876_10000020193 | 203 |
| 23 | 3300039437 | Ga0436365_1447172 | Ga0436365_1447172_72737_73348 | 203 |
| 24 | 3300039453 | Ga0436362_0847557 | Ga0436362_0847557_18219_18830 | 203 |
| 25 | 3300031911 | Ga0307412_10488305 | Ga0307412_104883052 | 204 |
| 26 | iso_pu_bacteria | 2928027323 | 2928031072 | 204 |
| 27 | 3300020081 | Ga0206354_10538658 | Ga0206354_105386584 | 205 |
| 28 | 3300020082 | Ga0206353_11732096 | Ga0206353_117320962 | 205 |
| 29 | 3300021384 | Ga0213876_10041095 | Ga0213876_100410952 | 205 |
| 30 | 3300039437 | Ga0436365_1638339 | Ga0436365_1638339_3541_4158 | 205 |
| 31 | iso_pu_bacteria | 2885429604 | 2885430989 | 205 |
| 32 | 3300053096 | Ga0500641_0031997 | Ga0500641_0031997_141_797 | 206 |
| 33 | 3300053108 | Ga0500562_071676 | Ga0500562_071676_71_727 | 206 |
| 34 | 3300048929 | Ga0496126_0197356 | Ga0496126_0197356_601_1227 | 207 |
| 35 | iso_pu_bacteria | 8057101203 | 8057101380 | 207 |
| 36 | 3300047472 | Ga0495686_0039267 | Ga0495686_0039267_802_1467 | 208 |
| 37 | 3300003214 | JGI25165J46597_1000166 | JGI25165J46597_100016646 | 209 |
| 38 | 3300005343 | Ga0070687_100124163 | Ga0070687_1001241632 | 209 |
| 39 | 3300005539 | Ga0068853_100828330 | Ga0068853_1008283302 | 209 |
| 40 | 3300005544 | Ga0070686_100000180 | Ga0070686_10000018049 | 209 |
| 41 | 3300005548 | Ga0070665_100000145 | Ga0070665_100000145129 | 209 |
| 42 | 3300005616 | Ga0068852_100097753 | Ga0068852_1000977532 | 209 |
| 43 | 3300005842 | Ga0068858_100000275 | Ga0068858_10000027513 | 209 |
| 44 | 3300006871 | Ga0075434_100126641 | Ga0075434_1001266412 | 209 |
| 45 | 3300009098 | Ga0105245_10000232 | Ga0105245_1000023249 | 209 |
| 46 | 3300009098 | Ga0105245_10050673 | Ga0105245_100506732 | 209 |
| 47 | 3300009098 | Ga0105245_10345395 | Ga0105245_103453952 | 209 |
| 48 | 3300009148 | Ga0105243_10887812 | Ga0105243_108878121 | 209 |
| 49 | 3300009551 | Ga0105238_10097095 | Ga0105238_100970952 | 209 |
| 50 | 3300010375 | Ga0105239_10414169 | Ga0105239_104141692 | 209 |
| 51 | 3300010375 | Ga0105239_10598372 | Ga0105239_105983722 | 209 |
| 52 | 3300013297 | Ga0157378_10038176 | Ga0157378_100381763 | 209 |
| 53 | 3300013306 | Ga0163162_10529054 | Ga0163162_105290542 | 209 |
| 54 | 3300020070 | Ga0206356_10944380 | Ga0206356_109443803 | 209 |
| 55 | 3300025261 | Ga0209233_1000222 | Ga0209233_100022246 | 209 |
| 56 | 3300025272 | Ga0209455_1031187 | Ga0209455_10311872 | 209 |
| 57 | 3300025924 | Ga0207694_10159567 | Ga0207694_101595673 | 209 |
| 58 | 3300025927 | Ga0207687_10004119 | Ga0207687_100041195 | 209 |
| 59 | 3300025927 | Ga0207687_10031413 | Ga0207687_100314132 | 209 |
| 60 | 3300025927 | Ga0207687_10825766 | Ga0207687_108257661 | 209 |
| 61 | 3300025935 | Ga0207709_10151375 | Ga0207709_101513752 | 209 |
| 62 | 3300025972 | Ga0207668_10484877 | Ga0207668_104848771 | 209 |
| 63 | 3300026035 | Ga0207703_10000334 | Ga0207703_1000033446 | 209 |
| 64 | 3300026041 | Ga0207639_10044507 | Ga0207639_100445072 | 209 |
| 65 | 3300026041 | Ga0207639_10295654 | Ga0207639_102956543 | 209 |
| 66 | 3300026088 | Ga0207641_10100849 | Ga0207641_101008494 | 209 |
| 67 | 3300026089 | Ga0207648_10093222 | Ga0207648_100932222 | 209 |
| 68 | 3300026142 | Ga0207698_10109798 | Ga0207698_101097982 | 209 |
| 69 | 3300028379 | Ga0268266_10000173 | Ga0268266_1000017320 | 209 |
| 70 | 3300031616 | Ga0307508_10000251 | Ga0307508_1000025154 | 209 |
| 71 | 3300031852 | Ga0307410_10459707 | Ga0307410_104597071 | 209 |
| 72 | 3300032002 | Ga0307416_100259022 | Ga0307416_1002590223 | 209 |
| 73 | 3300039450 | Ga0436363_0676919 | Ga0436363_0676919_471_1100 | 209 |
| 74 | 3300046492 | Ga0495585_0033403 | Ga0495585_0033403_138_767 | 209 |
| 75 | 3300046557 | Ga0495622_0028547 | Ga0495622_0028547_1327_1956 | 209 |
| 76 | 3300050512 | nmdc:mga0n895_282865_c1 | nmdc:mga0n895_282865_c1_478_1107 | 209 |
| 77 | 3300053083 | Ga0495655_0035074 | Ga0495655_0035074_80_709 | 209 |
| 78 | 3300053119 | Ga0500595_013100 | Ga0500595_013100_1289_1918 | 209 |
| 79 | 3300053134 | Ga0500658_0049295 | Ga0500658_0049295_575_1204 | 209 |
| 80 | 3300053136 | Ga0500559_0008105 | Ga0500559_0008105_2808_3437 | 209 |
| 81 | 3300053136 | Ga0500559_0014726 | Ga0500559_0014726_280_909 | 209 |
| 82 | 3300053739 | Ga0500587_009155 | Ga0500587_009155_217_849 | 209 |
| 83 | iso_pu_bacteria | 2830075706 | 2830076290 | 209 |
| 84 | 3300005617 | Ga0068859_100015618 | Ga0068859_1000156184 | 210 |
| 85 | 3300005841 | Ga0068863_100056131 | Ga0068863_1000561313 | 210 |
| 86 | 3300005843 | Ga0068860_100000680 | Ga0068860_1000006806 | 210 |
| 87 | 3300005844 | Ga0068862_100000193 | Ga0068862_10000019333 | 210 |
| 88 | 3300006931 | Ga0097620_100015617 | Ga0097620_1000156175 | 210 |
| 89 | 3300009101 | Ga0105247_10013641 | Ga0105247_100136413 | 210 |
| 90 | 3300014326 | Ga0157380_10286260 | Ga0157380_102862602 | 210 |
| 91 | 3300025961 | Ga0207712_10000002 | Ga0207712_10000002484 | 210 |
| 92 | 3300026088 | Ga0207641_10063720 | Ga0207641_100637203 | 210 |
| 93 | 3300028380 | Ga0268265_10000048 | Ga0268265_10000048150 | 210 |
| 94 | 3300028381 | Ga0268264_10000304 | Ga0268264_100003046 | 210 |
| 95 | 3300031456 | Ga0307513_10052123 | Ga0307513_100521234 | 210 |
| 96 | 3300035118 | Ga0373954_0078934 | Ga0373954_0078934_205_852 | 210 |
| 97 | 3300037471 | Ga0395905_0231144 | Ga0395905_0231144_397_1032 | 210 |
| 98 | 3300039145 | Ga0237816_00171 | Ga0237816_00171_1814_2455 | 210 |
| 99 | 3300046460 | Ga0495638_0001538 | Ga0495638_0001538_8383_9048 | 210 |
| 100 | 3300053087 | Ga0500643_011454 | Ga0500643_011454_809_1447 | 210 |
| 101 | 3300053087 | Ga0500643_014523 | Ga0500643_014523_1067_1705 | 210 |
| 102 | 3300005353 | Ga0070669_100165743 | Ga0070669_1001657432 | 211 |
| 103 | 3300005354 | Ga0070675_100379063 | Ga0070675_1003790632 | 211 |
| 104 | 3300005356 | Ga0070674_100039904 | Ga0070674_1000399042 | 211 |
| 105 | 3300005457 | Ga0070662_100549005 | Ga0070662_1005490052 | 211 |
| 106 | 3300005563 | Ga0068855_100466365 | Ga0068855_1004663652 | 211 |
| 107 | 3300005578 | Ga0068854_100067809 | Ga0068854_1000678093 | 211 |
| 108 | 3300005614 | Ga0068856_100073783 | Ga0068856_1000737833 | 211 |
| 109 | 3300005616 | Ga0068852_100082034 | Ga0068852_1000820342 | 211 |
| 110 | 3300006186 | Ga0075369_10056906 | Ga0075369_100569062 | 211 |
| 111 | 3300009174 | Ga0105241_10003240 | Ga0105241_100032408 | 211 |
| 112 | 3300009545 | Ga0105237_10961856 | Ga0105237_109618561 | 211 |
| 113 | 3300013102 | Ga0157371_10000197 | Ga0157371_1000019761 | 211 |
| 114 | 3300013297 | Ga0157378_10233332 | Ga0157378_102333323 | 211 |
| 115 | 3300014326 | Ga0157380_10145241 | Ga0157380_101452412 | 211 |
| 116 | 3300025230 | Ga0209563_100024 | Ga0209563_100024538 | 211 |
| 117 | 3300025233 | Ga0209437_111166 | Ga0209437_1111662 | 211 |
| 118 | 3300025253 | Ga0209677_105926 | Ga0209677_1059263 | 211 |
| 119 | 3300025254 | Ga0209148_1000008 | Ga0209148_1000008525 | 211 |
| 120 | 3300025272 | Ga0209455_1000002 | Ga0209455_1000002899 | 211 |
| 121 | 3300025904 | Ga0207647_10327155 | Ga0207647_103271551 | 211 |
| 122 | 3300025909 | Ga0207705_10000489 | Ga0207705_1000048922 | 211 |
| 123 | 3300025911 | Ga0207654_10000273 | Ga0207654_100002738 | 211 |
| 124 | 3300025913 | Ga0207695_10018525 | Ga0207695_100185255 | 211 |
| 125 | 3300025914 | Ga0207671_10008263 | Ga0207671_100082635 | 211 |
| 126 | 3300025920 | Ga0207649_10000443 | Ga0207649_1000044325 | 211 |
| 127 | 3300025920 | Ga0207649_10205475 | Ga0207649_102054752 | 211 |
| 128 | 3300025924 | Ga0207694_10032672 | Ga0207694_100326722 | 211 |
| 129 | 3300025926 | Ga0207659_10239277 | Ga0207659_102392773 | 211 |
| 130 | 3300025932 | Ga0207690_10623593 | Ga0207690_106235932 | 211 |
| 131 | 3300025933 | Ga0207706_10005757 | Ga0207706_100057572 | 211 |
| 132 | 3300025949 | Ga0207667_10000001 | Ga0207667_10000001823 | 211 |
| 133 | 3300025981 | Ga0207640_10001706 | Ga0207640_100017066 | 211 |
| 134 | 3300026041 | Ga0207639_10108706 | Ga0207639_101087064 | 211 |
| 135 | 3300026041 | Ga0207639_10546866 | Ga0207639_105468661 | 211 |
| 136 | 3300026075 | Ga0207708_10260545 | Ga0207708_102605452 | 211 |
| 137 | 3300026078 | Ga0207702_10003678 | Ga0207702_100036784 | 211 |
| 138 | 3300026116 | Ga0207674_10008106 | Ga0207674_1000810611 | 211 |
| 139 | 3300026142 | Ga0207698_10012704 | Ga0207698_100127042 | 211 |
| 140 | 3300028786 | Ga0307517_10001703 | Ga0307517_100017036 | 211 |
| 141 | 3300028786 | Ga0307517_10023907 | Ga0307517_100239075 | 211 |
| 142 | 3300031456 | Ga0307513_10028207 | Ga0307513_100282074 | 211 |
| 143 | 3300033180 | Ga0307510_10058820 | Ga0307510_100588203 | 211 |
| 144 | 3300046452 | Ga0495617_015748 | Ga0495617_015748_344_979 | 211 |
| 145 | 3300046457 | Ga0495590_0062781 | Ga0495590_0062781_499_1134 | 211 |
| 146 | 3300046459 | Ga0495629_0011780 | Ga0495629_0011780_4132_4767 | 211 |
| 147 | 3300046471 | Ga0495650_0000792 | Ga0495650_0000792_13084_13719 | 211 |
| 148 | 3300046491 | Ga0495584_0050523 | Ga0495584_0050523_865_1500 | 211 |
| 149 | 3300046499 | Ga0495594_0186906 | Ga0495594_0186906_520_1155 | 211 |
| 150 | 3300046500 | Ga0495596_0019300 | Ga0495596_0019300_2020_2655 | 211 |
| 151 | 3300046501 | Ga0495607_0117378 | Ga0495607_0117378_462_1097 | 211 |
| 152 | 3300046506 | Ga0495583_0003563 | Ga0495583_0003563_3524_4159 | 211 |
| 153 | 3300046506 | Ga0495583_0004282 | Ga0495583_0004282_7763_8398 | 211 |
| 154 | 3300046506 | Ga0495583_0031812 | Ga0495583_0031812_1883_2518 | 211 |
| 155 | 3300046507 | Ga0495606_0002822 | Ga0495606_0002822_880_1515 | 211 |
| 156 | 3300046507 | Ga0495606_0018630 | Ga0495606_0018630_3682_4317 | 211 |
| 157 | 3300046518 | Ga0495631_0058551 | Ga0495631_0058551_565_1200 | 211 |
| 158 | 3300046520 | Ga0495637_0048933 | Ga0495637_0048933_1072_1707 | 211 |
| 159 | 3300046520 | Ga0495637_0070234 | Ga0495637_0070234_527_1162 | 211 |
| 160 | 3300046522 | Ga0495643_0007657 | Ga0495643_0007657_6223_6858 | 211 |
| 161 | 3300046522 | Ga0495643_0143128 | Ga0495643_0143128_424_1059 | 211 |
| 162 | 3300046524 | Ga0495648_0000123 | Ga0495648_0000123_71196_71831 | 211 |
| 163 | 3300046524 | Ga0495648_0137630 | Ga0495648_0137630_389_1024 | 211 |
| 164 | 3300046536 | Ga0495587_0087560 | Ga0495587_0087560_1143_1778 | 211 |
| 165 | 3300046538 | Ga0495609_0161567 | Ga0495609_0161567_10_645 | 211 |
| 166 | 3300046542 | Ga0495597_0028596 | Ga0495597_0028596_566_1201 | 211 |
| 167 | 3300046557 | Ga0495622_0003063 | Ga0495622_0003063_4430_5065 | 211 |
| 168 | 3300046558 | Ga0495633_0004307 | Ga0495633_0004307_600_1235 | 211 |
| 169 | 3300046616 | Ga0495668_0000149 | Ga0495668_0000149_13109_13744 | 211 |
| 170 | 3300046648 | Ga0495611_0001502 | Ga0495611_0001502_1990_2625 | 211 |
| 171 | 3300046648 | Ga0495611_0169035 | Ga0495611_0169035_62_697 | 211 |
| 172 | 3300046660 | Ga0495625_0001285 | Ga0495625_0001285_20234_20869 | 211 |
| 173 | 3300046660 | Ga0495625_0085757 | Ga0495625_0085757_1539_2174 | 211 |
| 174 | 3300046660 | Ga0495625_0127614 | Ga0495625_0127614_864_1499 | 211 |
| 175 | 3300046660 | Ga0495625_0478849 | Ga0495625_0478849_54_689 | 211 |
| 176 | 3300046665 | Ga0495661_0354046 | Ga0495661_0354046_64_699 | 211 |
| 177 | 3300046684 | Ga0495669_0000951 | Ga0495669_0000951_3765_4400 | 211 |
| 178 | 3300046689 | Ga0495613_0180714 | Ga0495613_0180714_329_964 | 211 |
| 179 | 3300046691 | Ga0495670_0011359 | Ga0495670_0011359_725_1360 | 211 |
| 180 | 3300046694 | Ga0495649_0008479 | Ga0495649_0008479_381_1016 | 211 |
| 181 | 3300046810 | Ga0495660_0027783 | Ga0495660_0027783_1595_2230 | 211 |
| 182 | 3300046810 | Ga0495660_0084637 | Ga0495660_0084637_809_1444 | 211 |
| 183 | 3300047323 | Ga0495683_0000751 | Ga0495683_0000751_22027_22662 | 211 |
| 184 | 3300047443 | Ga0495687_000181 | Ga0495687_000181_56976_57611 | 211 |
| 185 | 3300047443 | Ga0495687_000286 | Ga0495687_000286_62273_62908 | 211 |
| 186 | 3300047445 | Ga0495677_0064507 | Ga0495677_0064507_145_780 | 211 |
| 187 | 3300047470 | Ga0495681_0027876 | Ga0495681_0027876_544_1179 | 211 |
| 188 | 3300048903 | Ga0496100_0618053 | Ga0496100_0618053_127_762 | 211 |
| 189 | 3300048904 | Ga0496101_0172007 | Ga0496101_0172007_494_1129 | 211 |
| 190 | 3300048905 | Ga0496102_0004598 | Ga0496102_0004598_3204_3839 | 211 |
| 191 | 3300048906 | Ga0496103_0000784 | Ga0496103_0000784_1552_2187 | 211 |
| 192 | 3300048907 | Ga0496104_0034197 | Ga0496104_0034197_1466_2101 | 211 |
| 193 | 3300048908 | Ga0496105_0106749 | Ga0496105_0106749_722_1357 | 211 |
| 194 | 3300048910 | Ga0496107_0093653 | Ga0496107_0093653_1073_1708 | 211 |
| 195 | 3300048912 | Ga0496109_0670320 | Ga0496109_0670320_47_682 | 211 |
| 196 | 3300048913 | Ga0496110_0043524 | Ga0496110_0043524_1778_2413 | 211 |
| 197 | 3300048917 | Ga0496114_0025174 | Ga0496114_0025174_1527_2162 | 211 |
| 198 | 3300048918 | Ga0496115_0000783 | Ga0496115_0000783_20872_21507 | 211 |
| 199 | 3300048919 | Ga0496116_0033294 | Ga0496116_0033294_1340_1975 | 211 |
| 200 | 3300048920 | Ga0496117_0001166 | Ga0496117_0001166_36099_36734 | 211 |
| 201 | 3300048921 | Ga0496118_0000039 | Ga0496118_0000039_3491_4126 | 211 |
| 202 | 3300048923 | Ga0496120_0022464 | Ga0496120_0022464_786_1421 | 211 |
| 203 | 3300048924 | Ga0496121_0001367 | Ga0496121_0001367_38132_38767 | 211 |
| 204 | 3300048925 | Ga0496122_0033588 | Ga0496122_0033588_38_673 | 211 |
| 205 | 3300048927 | Ga0496124_0000232 | Ga0496124_0000232_22292_22927 | 211 |
| 206 | 3300048928 | Ga0496125_0010075 | Ga0496125_0010075_3289_3924 | 211 |
| 207 | 3300048929 | Ga0496126_0001437 | Ga0496126_0001437_2740_3375 | 211 |
| 208 | 3300050493 | nmdc:mga0k408_14784_c1 | nmdc:mga0k408_14784_c1_2252_2887 | 211 |
| 209 | 3300053079 | Ga0500610_0003135 | Ga0500610_0003135_5416_6051 | 211 |
| 210 | 3300053092 | Ga0500583_0099649 | Ga0500583_0099649_635_1270 | 211 |
| 211 | 3300053119 | Ga0500595_004353 | Ga0500595_004353_1953_2588 | 211 |
| 212 | 3300053120 | Ga0500597_002220 | Ga0500597_002220_603_1247 | 211 |
| 213 | 3300053130 | Ga0500642_0006722 | Ga0500642_0006722_508_1143 | 211 |
| 214 | 3300053154 | Ga0500619_039802 | Ga0500619_039802_629_1264 | 211 |
| 215 | 3300053157 | Ga0500624_000013 | Ga0500624_000013_50468_51112 | 211 |
| 216 | 3300053177 | Ga0500636_0003876 | Ga0500636_0003876_5035_5670 | 211 |
| 217 | 3300053178 | Ga0500637_0001361 | Ga0500637_0001361_6192_6836 | 211 |
| 218 | 3300053730 | Ga0500645_000083 | Ga0500645_000083_24366_25001 | 211 |
| 219 | 3300053735 | Ga0500596_010498 | Ga0500596_010498_221_856 | 211 |
| 220 | iso_pu_bacteria | 2599185359 | 2600226855 | 211 |
| 221 | iso_pu_bacteria | 2818991466 | 2819715700 | 211 |
| 222 | iso_pu_bacteria | 2879163058 | 2879163142 | 211 |
| 223 | iso_pu_bacteria | 2928526807 | 2928529717 | 211 |
| 224 | iso_pu_bacteria | 2928968154 | 2928970795 | 211 |
| 225 | 3300003322 | rootL2_10015964 | rootL2_100159642 | 212 |
| 226 | 3300005548 | Ga0070665_100000067 | Ga0070665_100000067126 | 212 |
| 227 | 3300005618 | Ga0068864_100000742 | Ga0068864_1000007425 | 212 |
| 228 | 3300005842 | Ga0068858_100053878 | Ga0068858_1000538785 | 212 |
| 229 | 3300006237 | Ga0097621_100052631 | Ga0097621_1000526313 | 212 |
| 230 | 3300009148 | Ga0105243_10000812 | Ga0105243_100008126 | 212 |
| 231 | 3300011119 | Ga0105246_10729161 | Ga0105246_107291611 | 212 |
| 232 | 3300013296 | Ga0157374_10473210 | Ga0157374_104732101 | 212 |
| 233 | 3300013306 | Ga0163162_10780614 | Ga0163162_107806142 | 212 |
| 234 | 3300025924 | Ga0207694_10232578 | Ga0207694_102325782 | 212 |
| 235 | 3300025941 | Ga0207711_10006789 | Ga0207711_1000678910 | 212 |
| 236 | 3300026035 | Ga0207703_10000272 | Ga0207703_1000027226 | 212 |
| 237 | 3300026095 | Ga0207676_10000217 | Ga0207676_1000021751 | 212 |
| 238 | 3300026121 | Ga0207683_10384176 | Ga0207683_103841762 | 212 |
| 239 | 3300028379 | Ga0268266_10000002 | Ga0268266_10000002199 | 212 |
| 240 | 3300028794 | Ga0307515_10463024 | Ga0307515_104630241 | 212 |
| 241 | 3300031456 | Ga0307513_10046629 | Ga0307513_100466294 | 212 |
| 242 | 3300033180 | Ga0307510_10010934 | Ga0307510_1001093411 | 212 |
| 243 | 3300038443 | Ga0395901_0072135 | Ga0395901_0072135_430_1071 | 212 |
| 244 | 3300046492 | Ga0495585_0005849 | Ga0495585_0005849_3789_4430 | 212 |
| 245 | 3300046506 | Ga0495583_0006785 | Ga0495583_0006785_423_1079 | 212 |
| 246 | 3300046507 | Ga0495606_0130071 | Ga0495606_0130071_77_718 | 212 |
| 247 | 3300046524 | Ga0495648_0055575 | Ga0495648_0055575_286_942 | 212 |
| 248 | 3300046528 | Ga0495642_0016383 | Ga0495642_0016383_324_965 | 212 |
| 249 | 3300046660 | Ga0495625_0062067 | Ga0495625_0062067_1818_2474 | 212 |
| 250 | 3300047445 | Ga0495677_0004983 | Ga0495677_0004983_3512_4153 | 212 |
| 251 | 3300047472 | Ga0495686_0000209 | Ga0495686_0000209_105732_106388 | 212 |
| 252 | 3300048918 | Ga0496115_0145372 | Ga0496115_0145372_771_1415 | 212 |
| 253 | 3300048924 | Ga0496121_0000123 | Ga0496121_0000123_128746_129396 | 212 |
| 254 | 3300048924 | Ga0496121_0032716 | Ga0496121_0032716_3400_4059 | 212 |
| 255 | 3300053093 | Ga0500651_0196820 | Ga0500651_0196820_263_919 | 212 |
| 256 | 3300053098 | Ga0500650_0150380 | Ga0500650_0150380_330_986 | 212 |
| 257 | 3300053140 | Ga0500573_0000041 | Ga0500573_0000041_50033_50677 | 212 |
| 258 | 3300053730 | Ga0500645_072096 | Ga0500645_072096_311_967 | 212 |
| 259 | iso_pu_bacteria | 2984555340 | 2984556952 | 212 |
| 260 | iso_pu_bacteria | 2984564862 | 2984568741 | 212 |
| 261 | iso_pu_bacteria | 2993356040 | 2993359732 | 212 |
| 262 | 3300005262 | Ga0065165_1012524 | Ga0065165_10125243 | 213 |
| 263 | 3300005327 | Ga0070658_10172368 | Ga0070658_101723682 | 213 |
| 264 | 3300013100 | Ga0157373_10586747 | Ga0157373_105867471 | 213 |
| 265 | 3300046524 | Ga0495648_0003352 | Ga0495648_0003352_7899_8561 | 213 |
| 266 | 3300053730 | Ga0500645_000910 | Ga0500645_000910_8532_9176 | 213 |
| 267 | 3300050496 | nmdc:mga07m45_37750_c1 | nmdc:mga07m45_37750_c1_1381_2028 | 214 |
| 268 | 3300002774 | JGI25150J39212_1000128 | JGI25150J39212_100012835 | 215 |
| 269 | 3300003187 | JGI25151J46595_10030545 | JGI25151J46595_100305454 | 215 |
| 270 | 3300003215 | JGI25153J46596_10000027 | JGI25153J46596_1000002771 | 215 |
| 271 | 3300003771 | Ga0055526_1005136 | Ga0055526_10051364 | 215 |
| 272 | 3300003773 | Ga0055537_1004563 | Ga0055537_10045632 | 215 |
| 273 | 3300003781 | Ga0055536_1007840 | Ga0055536_10078403 | 215 |
| 274 | 3300003792 | Ga0055540_1003208 | Ga0055540_10032086 | 215 |
| 275 | 3300003792 | Ga0055540_1004149 | Ga0055540_10041493 | 215 |
| 276 | 3300005577 | Ga0068857_100009574 | Ga0068857_1000095742 | 215 |
| 277 | 3300005985 | Ga0081539_10009013 | Ga0081539_100090136 | 215 |
| 278 | 3300009545 | Ga0105237_10021104 | Ga0105237_100211045 | 215 |
| 279 | 3300025245 | Ga0207425_1000005 | Ga0207425_1000005335 | 215 |
| 280 | 3300025258 | Ga0209129_1004436 | Ga0209129_10044363 | 215 |
| 281 | 3300025263 | Ga0209565_1000121 | Ga0209565_100012197 | 215 |
| 282 | 3300025292 | Ga0209676_1012128 | Ga0209676_10121283 | 215 |
| 283 | 3300025294 | Ga0209025_1001924 | Ga0209025_100192410 | 215 |
| 284 | 3300025297 | Ga0209758_1000002 | Ga0209758_10000021009 | 215 |
| 285 | 3300025298 | Ga0209050_1000001 | Ga0209050_1000001993 | 215 |
| 286 | 3300025303 | Ga0209051_1000802 | Ga0209051_100080219 | 215 |
| 287 | 3300025304 | Ga0209257_1000555 | Ga0209257_100055528 | 215 |
| 288 | 3300025304 | Ga0209257_1010458 | Ga0209257_10104585 | 215 |
| 289 | 3300025914 | Ga0207671_10008023 | Ga0207671_100080237 | 215 |
| 290 | 3300025923 | Ga0207681_10190384 | Ga0207681_101903842 | 215 |
| 291 | 3300026041 | Ga0207639_10013303 | Ga0207639_100133034 | 215 |
| 292 | 3300026116 | Ga0207674_10226904 | Ga0207674_102269042 | 215 |
| 293 | 3300031911 | Ga0307412_10000160 | Ga0307412_1000016018 | 215 |
| 294 | 3300047472 | Ga0495686_0036224 | Ga0495686_0036224_320_1006 | 215 |
| 295 | 3300047472 | Ga0495686_0135316 | Ga0495686_0135316_660_1307 | 215 |
| 296 | 3300048918 | Ga0496115_0003374 | Ga0496115_0003374_1623_2270 | 215 |
| 297 | 3300048925 | Ga0496122_0361105 | Ga0496122_0361105_59_706 | 215 |
| 298 | 3300048926 | Ga0496123_0065126 | Ga0496123_0065126_1076_1723 | 215 |
| 299 | 3300048926 | Ga0496123_0173735 | Ga0496123_0173735_268_915 | 215 |
| 300 | 3300048927 | Ga0496124_0001482 | Ga0496124_0001482_1698_2345 | 215 |
| 301 | 3300048927 | Ga0496124_0001624 | Ga0496124_0001624_1175_1822 | 215 |
| 302 | 3300048927 | Ga0496124_0039731 | Ga0496124_0039731_2749_3396 | 215 |
| 303 | 3300048928 | Ga0496125_0037628 | Ga0496125_0037628_1025_1711 | 215 |
| 304 | 3300053096 | Ga0500641_0004051 | Ga0500641_0004051_2079_2753 | 215 |
| 305 | 3300053108 | Ga0500562_018356 | Ga0500562_018356_1085_1732 | 215 |
| 306 | 3300053119 | Ga0500595_005457 | Ga0500595_005457_1632_2294 | 215 |
| 307 | 3300053131 | Ga0500652_056579 | Ga0500652_056579_711_1358 | 215 |
| 308 | 3300053134 | Ga0500658_0004296 | Ga0500658_0004296_458_1123 | 215 |
| 309 | 3300053142 | Ga0500577_0022309 | Ga0500577_0022309_359_1024 | 215 |
| 310 | 3300003791 | Ga0055530_10000202 | Ga0055530_1000020215 | 216 |
| 311 | 3300003794 | Ga0055531_10000090 | Ga0055531_1000009026 | 216 |
| 312 | 3300005262 | Ga0065165_1001918 | Ga0065165_100191813 | 216 |
| 313 | 3300005262 | Ga0065165_1004381 | Ga0065165_100438111 | 216 |
| 314 | 3300009553 | Ga0105249_10000002 | Ga0105249_10000002112 | 216 |
| 315 | 3300025298 | Ga0209050_1000051 | Ga0209050_1000051212 | 216 |
| 316 | 3300025304 | Ga0209257_1000028 | Ga0209257_1000028156 | 216 |
| 317 | 3300049758 | Ga0501241_063773 | Ga0501241_063773_24_674 | 216 |
| 318 | 3300001915 | JGI24741J21665_1002127 | JGI24741J21665_10021273 | 217 |
| 319 | 3300001979 | JGI24740J21852_10062956 | JGI24740J21852_100629562 | 217 |
| 320 | 3300002067 | JGI24735J21928_10034764 | JGI24735J21928_100347642 | 217 |
| 321 | 3300003759 | Ga0055525_1000119 | Ga0055525_1000119110 | 217 |
| 322 | 3300003762 | Ga0055542_1000076 | Ga0055542_1000076111 | 217 |
| 323 | 3300003763 | Ga0055529_1000004 | Ga0055529_100000433 | 217 |
| 324 | 3300005327 | Ga0070658_10002454 | Ga0070658_1000245411 | 217 |
| 325 | 3300005331 | Ga0070670_100422294 | Ga0070670_1004222942 | 217 |
| 326 | 3300005339 | Ga0070660_100566229 | Ga0070660_1005662292 | 217 |
| 327 | 3300005344 | Ga0070661_100000614 | Ga0070661_1000006142 | 217 |
| 328 | 3300005347 | Ga0070668_100193074 | Ga0070668_1001930742 | 217 |
| 329 | 3300005355 | Ga0070671_100137837 | Ga0070671_1001378371 | 217 |
| 330 | 3300005356 | Ga0070674_100154189 | Ga0070674_1001541892 | 217 |
| 331 | 3300005366 | Ga0070659_100556372 | Ga0070659_1005563721 | 217 |
| 332 | 3300005367 | Ga0070667_100196203 | Ga0070667_1001962032 | 217 |
| 333 | 3300005539 | Ga0068853_100941239 | Ga0068853_1009412392 | 217 |
| 334 | 3300005834 | Ga0068851_10324291 | Ga0068851_103242911 | 217 |
| 335 | 3300006195 | Ga0075366_10032737 | Ga0075366_100327372 | 217 |
| 336 | 3300020082 | Ga0206353_10762095 | Ga0206353_107620951 | 217 |
| 337 | 3300025297 | Ga0209758_1000007 | Ga0209758_1000007802 | 217 |
| 338 | 3300025321 | Ga0207656_10003245 | Ga0207656_100032455 | 217 |
| 339 | 3300025901 | Ga0207688_10040220 | Ga0207688_100402203 | 217 |
| 340 | 3300025932 | Ga0207690_10011928 | Ga0207690_100119284 | 217 |
| 341 | 3300025937 | Ga0207669_10024854 | Ga0207669_100248544 | 217 |
| 342 | 3300025972 | Ga0207668_10100938 | Ga0207668_101009383 | 217 |
| 343 | 3300026067 | Ga0207678_10015021 | Ga0207678_100150217 | 217 |
| 344 | 3300046691 | Ga0495670_0001049 | Ga0495670_0001049_3593_4246 | 217 |
| 345 | iso_pu_bacteria | 2643221622 | 2644127841 | 217 |
| 346 | 3300005356 | Ga0070674_100016877 | Ga0070674_1000168772 | 218 |
| 347 | 3300005456 | Ga0070678_100000786 | Ga0070678_1000007862 | 218 |
| 348 | 3300005459 | Ga0068867_100037571 | Ga0068867_1000375713 | 218 |
| 349 | 3300009177 | Ga0105248_10019877 | Ga0105248_1001987710 | 218 |
| 350 | 3300013306 | Ga0163162_10001358 | Ga0163162_1000135820 | 218 |
| 351 | 3300014325 | Ga0163163_10115281 | Ga0163163_101152812 | 218 |
| 352 | 3300025937 | Ga0207669_10000251 | Ga0207669_1000025121 | 218 |
| 353 | 3300026089 | Ga0207648_10125079 | Ga0207648_101250793 | 218 |
| 354 | 3300026121 | Ga0207683_10008013 | Ga0207683_100080132 | 218 |
| 355 | 3300053108 | Ga0500562_043972 | Ga0500562_043972_117_788 | 218 |
| 356 | 3300000041 | ARcpr5oldR_c004634 | ARcpr5oldR_0046342 | 221 |
| 357 | 3300000043 | ARcpr5yngRDRAFT_c008251 | ARcpr5yngRDRAFT_0082512 | 221 |
| 358 | 3300003215 | JGI25153J46596_10012056 | JGI25153J46596_100120563 | 221 |
| 359 | 3300003773 | Ga0055537_1008861 | Ga0055537_10088613 | 221 |
| 360 | 3300003775 | Ga0055524_1000324 | Ga0055524_100032418 | 221 |
| 361 | 3300003791 | Ga0055530_10007920 | Ga0055530_100079206 | 221 |
| 362 | 3300003794 | Ga0055531_10006935 | Ga0055531_100069354 | 221 |
| 363 | 3300005262 | Ga0065165_1016150 | Ga0065165_10161504 | 221 |
| 364 | 3300025245 | Ga0207425_1034022 | Ga0207425_10340221 | 221 |
| 365 | 3300025263 | Ga0209565_1000011 | Ga0209565_1000011260 | 221 |
| 366 | 3300025291 | Ga0209675_1006210 | Ga0209675_10062107 | 221 |
| 367 | 3300025297 | Ga0209758_1008966 | Ga0209758_10089669 | 221 |
| 368 | 3300025298 | Ga0209050_1009405 | Ga0209050_10094053 | 221 |
| 369 | 3300025299 | Ga0209256_1000016 | Ga0209256_1000016339 | 221 |
| 370 | 3300025304 | Ga0209257_1000855 | Ga0209257_100085536 | 221 |
| 371 | 3300041410 | Ga0439461_0000342 | Ga0439461_0000342_23_688 | 221 |
| 372 | 3300041410 | Ga0439461_0012942 | Ga0439461_0012942_481_1146 | 221 |
| 373 | 3300041413 | Ga0439465_0002464 | Ga0439465_0002464_3623_4288 | 221 |
| 374 | 3300041413 | Ga0439465_0010492 | Ga0439465_0010492_1939_2604 | 221 |
| 375 | 3300041997 | Ga0439431_0002960 | Ga0439431_0002960_1756_2421 | 221 |
| 376 | 3300041999 | Ga0439433_0073116 | Ga0439433_0073116_16_681 | 221 |
| 377 | 3300042004 | Ga0439445_0009573 | Ga0439445_0009573_559_1224 | 221 |
| 378 | 3300042004 | Ga0439445_0012133 | Ga0439445_0012133_971_1636 | 221 |
| 379 | 3300042006 | Ga0439432_001045 | Ga0439432_001045_7892_8557 | 221 |
| 380 | 3300042006 | Ga0439432_087448 | Ga0439432_087448_154_819 | 221 |
| 381 | 3300042007 | Ga0439449_0112504 | Ga0439449_0112504_214_879 | 221 |
| 382 | 3300042010 | Ga0439452_012067 | Ga0439452_012067_1406_2071 | 221 |
| 383 | 3300042014 | Ga0439457_009549 | Ga0439457_009549_843_1508 | 221 |
| 384 | 3300042015 | Ga0439462_0002511 | Ga0439462_0002511_2726_3391 | 221 |
| 385 | 3300042015 | Ga0439462_0011600 | Ga0439462_0011600_1139_1804 | 221 |
| 386 | 3300042125 | Ga0450923_024796 | Ga0450923_024796_438_1103 | 221 |
| 387 | 3300042435 | Ga0439434_0000405 | Ga0439434_0000405_7857_8522 | 221 |
| 388 | 3300042435 | Ga0439434_0020241 | Ga0439434_0020241_1202_1867 | 221 |
| 389 | 3300047470 | Ga0495681_0046417 | Ga0495681_0046417_1195_1860 | 221 |
| 390 | 3300053087 | Ga0500643_028405 | Ga0500643_028405_741_1406 | 221 |
| 391 | 3300053094 | Ga0500566_0004026 | Ga0500566_0004026_1674_2339 | 221 |
| 392 | 3300053103 | Ga0500555_011321 | Ga0500555_011321_954_1619 | 221 |
| 393 | 3300053134 | Ga0500658_0005688 | Ga0500658_0005688_1352_2017 | 221 |
| 394 | 3300053134 | Ga0500658_0011875 | Ga0500658_0011875_1994_2659 | 221 |
| 395 | 3300053139 | Ga0500568_0034212 | Ga0500568_0034212_636_1301 | 221 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4qih-assembly1.cif.gz_B | the structure of mycobacterial glucosyl-3-phosphoglycerate phosphatase rv2419c complexes with vo3 | 0.8162 | 13 | 209 |
| 6etj-assembly1.cif.gz_A-2 | human pfkfb3 in complex with kan0438241 | 0.79 | 13 | 209 |
| 4ij6-assembly1.cif.gz_B | crystal structure of a novel-type phosphoserine phosphatase mutant (h9a) from <i>hydrogenobacter thermophilus</i> tk-6 in complex with l-phosphoserine | 0.7899 | 14 | 213 |
| 4ij5-assembly1.cif.gz_B | crystal structure of a novel-type phosphoserine phosphatase from <i>hydrogenobacter thermophilus</i> tk-6 | 0.7884 | 14 | 218 |
| 5ajz-assembly1.cif.gz_A-2 | human pfkfb3 in complex with an indole inhibitor 5 | 0.7876 | 13 | 209 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_K7TSF9_113_270_3.40.50.1240 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like | 0.8274 | 20 | 154 | 3.40.50.1240 |
| af_Q9LW33_109_250_3.40.50.1240 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like | 0.8217 | 20 | 154 | 3.40.50.1240 |
| 4qihB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like | 0.8162 | 13 | 209 | 3.40.50.1240 |
| af_Q4DL01_2_181_3.40.50.1240 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like | 0.8149 | 15 | 193 | 3.40.50.1240 |
| af_A0A1D6HET3_64_207_3.40.50.1240 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like | 0.8028 | 20 | 158 | 3.40.50.1240 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A239HJF6-F1-model_v4 | Probable phosphoglycerate mutase | 0.9851 | 52 | 216 |
|
| AF-A0A848SV41-F1-model_v4 | Histidine phosphatase family protein | 0.9792 | 76 | 215 |
|
| AF-A0A4Q5T0Y9-F1-model_v4 | Histidine phosphatase family protein | 0.979 | 96 | 221 |
|
| AF-A0A2A2K250-F1-model_v4 | Phosphoglycerate mutase (2,3-diphosphoglycerate-dependent) | 0.9697 | 4 | 216 |
GO:0005737
GO:0016791 |
| AF-A0A4Q5T0Y9-F1-model_v4 | Histidine phosphatase family protein | 0.9638 | 96 | 221 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar