F433201

General Info

Members Datasets Scaffolds Average Seq Length
395 270 382 214

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10019877|Ga0105248_1001987710
Length 239
Sequence MNRRQRRKGVAFPPQAVEIAAMASKAGVRPTRVGRDFIARHGETVFNAAGRLQGDHPHTPLTRAGFAQADEMGAALRAELGVRPRLTLWASPTGRALQTLAVIAEHLELDWHAARTDARLVEIGMGGWGGRYYADLAAERGSVVDPAAGLLVPAPDGESYRAIAARVSGWLADTDDDSGDRLVIMHGISSRVMRGVMTGLPDLPGYDAPAATSLPQGSVVMIAGGVERLVHAGGGGTRA

Samples

Sample ID Description Type Environment
1 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
2 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
3 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
4 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
5 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
6 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
7 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
8 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
9 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
10 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
11 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
12 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
13 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
14 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
15 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
16 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
17 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
18 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
19 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
20 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
21 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
22 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
23 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
24 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
25 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
26 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
27 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
28 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
29 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
30 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
31 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
32 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
33 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
34 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
35 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
36 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
93 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
97 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
98 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
100 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
101 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
104 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
105 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
110 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
111 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
153 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
154 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
155 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
160 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
164 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
165 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
166 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
167 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
168 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
169 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
170 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
171 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
172 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
173 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
174 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
175 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
176 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
177 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
178 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
179 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
180 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
181 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
182 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
183 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
184 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
185 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
186 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
187 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
188 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
189 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
190 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
191 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
192 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
193 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
194 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
195 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
196 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
197 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
198 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
199 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
200 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
201 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
202 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
203 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
204 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
205 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
206 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
207 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
208 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
209 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
210 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
211 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
212 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
213 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
214 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
215 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
216 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
217 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
218 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
219 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
220 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
221 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
222 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
223 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
227 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
228 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
229 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
230 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
231 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
232 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
233 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
234 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
235 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
236 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
237 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
238 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
239 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
240 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
241 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
242 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
243 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
244 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
245 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
246 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
247 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
248 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
249 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
250 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
251 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
252 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
253 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
254 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
255 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
256 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
257 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
258 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
259 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
260 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
261 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
262 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
263 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
264 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
265 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
266 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
267 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
268 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
269 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
270 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.7
Metatranscriptomes 1.01
Isolates 3.29

Biome Distribution

Category Percentage (%)
Aerial Root 0.76
Bulb 0
Endosphere 24.3
Nodule 0
Rhizoplane 3.8
Rhizosphere 60.51
Stem 0
Stem Tuber 0
Unclassified 10.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c004634 3300000041 Bacteria 1189
2 ARcpr5yngRDRAFT_c008251 3300000043 Bacteria 902
3 JGI24741J21665_1002127 3300001915 Bacteria 5274
4 JGI24740J21852_10062956 3300001979 Bacteria 1017
5 JGI24735J21928_10034764 3300002067 Bacteria 1484
6 JGI25150J39212_1000128 3300002774 Bacteria 42771
7 JGI25151J46595_10030545 3300003187 Bacteria 2117
8 JGI25165J46597_1000166 3300003214 Bacteria 103861
9 JGI25153J46596_10000027 3300003215 Bacteria 210760
10 JGI25153J46596_10012056 3300003215 Bacteria 3769
11 rootL2_10015964 3300003322 Bacteria 1335
12 Ga0055525_1000119 3300003759 Bacteria 120272
13 Ga0055542_1000076 3300003762 Bacteria 139662
14 Ga0055529_1000004 3300003763 Bacteria 433331
15 Ga0055526_1005136 3300003771 Bacteria 7628
16 Ga0055537_1004563 3300003773 Bacteria 3935
17 Ga0055537_1008861 3300003773 Bacteria 2275
18 Ga0055524_1000324 3300003775 Bacteria 44924
19 Ga0055536_1007840 3300003781 Bacteria 4704
20 Ga0055530_10000202 3300003791 Bacteria 53648
21 Ga0055530_10007920 3300003791 Bacteria 4357
22 Ga0055540_1003208 3300003792 Bacteria 8032
23 Ga0055540_1004149 3300003792 Bacteria 6694
24 Ga0055531_10000090 3300003794 Bacteria 100342
25 Ga0055531_10006935 3300003794 Bacteria 6309
26 Ga0065165_1001918 3300005262 Bacteria 19856
27 Ga0065165_1004381 3300005262 Bacteria 8814
28 Ga0065165_1012524 3300005262 Bacteria 3448
29 Ga0065165_1016150 3300005262 Bacteria 2809
30 Ga0070658_10002454 3300005327 Bacteria 15511
31 Ga0070658_10172368 3300005327 Bacteria 1818
32 Ga0070683_100051395 3300005329 Bacteria 3816
33 Ga0070670_100422294 3300005331 Bacteria 1179
34 Ga0070660_100566229 3300005339 Bacteria 948
35 Ga0070687_100124163 3300005343 Bacteria 1481
36 Ga0070661_100000614 3300005344 Bacteria 26629
37 Ga0070668_100193074 3300005347 Bacteria 1668
38 Ga0070669_100165743 3300005353 Bacteria 1720
39 Ga0070675_100379063 3300005354 Unclassified 1259
40 Ga0070671_100137837 3300005355 Bacteria 2058
41 Ga0070674_100016877 3300005356 Bacteria 4581
42 Ga0070674_100039904 3300005356 Bacteria 3173
43 Ga0070674_100154189 3300005356 Bacteria 1736
44 Ga0070659_100556372 3300005366 Bacteria 982
45 Ga0070667_100196203 3300005367 Bacteria 1790
46 Ga0070678_100000786 3300005456 Bacteria 15935
47 Ga0070662_100549005 3300005457 Unclassified 968
48 Ga0068867_100037571 3300005459 Bacteria 3520
49 Ga0070684_100579121 3300005535 Bacteria 1043
50 Ga0068853_100828330 3300005539 Bacteria 887
51 Ga0068853_100941239 3300005539 Bacteria 830
52 Ga0070686_100000180 3300005544 Bacteria 44847
53 Ga0070696_100459661 3300005546 Bacteria 1006
54 Ga0070665_100000067 3300005548 Bacteria 204787
55 Ga0070665_100000145 3300005548 Bacteria 131599
56 Ga0070665_100000567 3300005548 Bacteria 51614
57 Ga0068855_100466365 3300005563 Bacteria 1376
58 Ga0068857_100009574 3300005577 Bacteria 8417
59 Ga0068854_100067809 3300005578 Bacteria 2600
60 Ga0068856_100073783 3300005614 Bacteria 3378
61 Ga0068856_100191821 3300005614 Bacteria 2057
62 Ga0068852_100082034 3300005616 Bacteria 2864
63 Ga0068852_100097753 3300005616 Bacteria 2642
64 Ga0068859_100015618 3300005617 Bacteria 7630
65 Ga0068864_100000742 3300005618 Bacteria 27346
66 Ga0068851_10324291 3300005834 Bacteria 890
67 Ga0068863_100056131 3300005841 Bacteria 3729
68 Ga0068858_100000275 3300005842 Bacteria 55318
69 Ga0068858_100053878 3300005842 Bacteria 3720
70 Ga0068860_100000680 3300005843 Bacteria 39339
71 Ga0068862_100000193 3300005844 Bacteria 67697
72 Ga0081539_10009013 3300005985 Bacteria 8477
73 Ga0075369_10056906 3300006186 Bacteria 1700
74 Ga0075366_10032737 3300006195 Bacteria 3060
75 Ga0097621_100052631 3300006237 Bacteria 3317
76 Ga0075434_100126641 3300006871 Bacteria 2571
77 Ga0097620_100015617 3300006931 Bacteria 7630
78 Ga0105245_10000232 3300009098 Bacteria 53204
79 Ga0105245_10050673 3300009098 Bacteria 3721
80 Ga0105245_10345395 3300009098 Bacteria 1473
81 Ga0105247_10013641 3300009101 Bacteria 4873
82 Ga0105243_10000812 3300009148 Bacteria 29753
83 Ga0105243_10887812 3300009148 Bacteria 886
84 Ga0105241_10003240 3300009174 Bacteria 12103
85 Ga0105248_10019877 3300009177 Bacteria 7437
86 Ga0105237_10021104 3300009545 Bacteria 6700
87 Ga0105237_10961856 3300009545 Bacteria 861
88 Ga0105238_10097095 3300009551 Bacteria 2933
89 Ga0105249_10000002 3300009553 Bacteria 376207
90 Ga0105239_10414169 3300010375 Bacteria 1526
91 Ga0105239_10598372 3300010375 Bacteria 1258
92 Ga0105246_10729161 3300011119 Bacteria 872
93 Ga0157373_10586747 3300013100 Bacteria 810
94 Ga0157371_10000197 3300013102 Bacteria 88423
95 Ga0157369_10215304 3300013105 Bacteria 2012
96 Ga0157374_10473210 3300013296 Bacteria 1255
97 Ga0157378_10038176 3300013297 Bacteria 4256
98 Ga0157378_10233332 3300013297 Bacteria 1754
99 Ga0163162_10001358 3300013306 Bacteria 22795
100 Ga0163162_10529054 3300013306 Bacteria 1308
101 Ga0163162_10780614 3300013306 Bacteria 1074
102 Ga0157372_10429520 3300013307 Bacteria 1540
103 Ga0163163_10115281 3300014325 Bacteria 2718
104 Ga0157380_10145241 3300014326 Bacteria 2044
105 Ga0157380_10286260 3300014326 Bacteria 1511
106 Ga0183363_1007 3300015690 Bacteria 315687
107 Ga0206356_10944380 3300020070 Bacteria 2559
108 Ga0206354_10538658 3300020081 Bacteria 4055
109 Ga0206353_10762095 3300020082 Bacteria 2275
110 Ga0206353_11732096 3300020082 Bacteria 3169
111 Ga0213873_10000014 3300021358 Bacteria 139420
112 Ga0213876_10000020 3300021384 Bacteria 268316
113 Ga0213876_10003478 3300021384 Bacteria 9001
114 Ga0213876_10041095 3300021384 Bacteria 2444
115 Ga0209563_100024 3300025230 Bacteria 601155
116 Ga0209437_111166 3300025233 Bacteria 1350
117 Ga0207425_1000005 3300025245 Bacteria 900502
118 Ga0207425_1034022 3300025245 Bacteria 1001
119 Ga0209677_105926 3300025253 Bacteria 3045
120 Ga0209148_1000008 3300025254 Bacteria 1504371
121 Ga0209129_1004436 3300025258 Bacteria 5471
122 Ga0209233_1000222 3300025261 Bacteria 103917
123 Ga0209565_1000011 3300025263 Bacteria 637062
124 Ga0209565_1000121 3300025263 Bacteria 111264
125 Ga0209455_1000002 3300025272 Bacteria 1505459
126 Ga0209455_1031187 3300025272 Bacteria 899
127 Ga0209675_1006210 3300025291 Bacteria 4840
128 Ga0209676_1012128 3300025292 Bacteria 3416
129 Ga0209025_1001924 3300025294 Bacteria 24077
130 Ga0209758_1000002 3300025297 Bacteria 1400310
131 Ga0209758_1000007 3300025297 Bacteria 1270410
132 Ga0209758_1008966 3300025297 Bacteria 6337
133 Ga0209050_1000001 3300025298 Bacteria 3563507
134 Ga0209050_1000051 3300025298 Bacteria 353153
135 Ga0209050_1009405 3300025298 Bacteria 5007
136 Ga0209256_1000016 3300025299 Bacteria 599092
137 Ga0209051_1000802 3300025303 Bacteria 33033
138 Ga0209257_1000028 3300025304 Bacteria 699493
139 Ga0209257_1000555 3300025304 Bacteria 64065
140 Ga0209257_1000855 3300025304 Bacteria 43394
141 Ga0209257_1010458 3300025304 Bacteria 4691
142 Ga0207656_10003245 3300025321 Bacteria 5567
143 Ga0207688_10040220 3300025901 Bacteria 2598
144 Ga0207647_10327155 3300025904 Bacteria 870
145 Ga0207705_10000489 3300025909 Bacteria 33785
146 Ga0207654_10000273 3300025911 Bacteria 31494
147 Ga0207707_10291264 3300025912 Bacteria 1412
148 Ga0207695_10018525 3300025913 Bacteria 8048
149 Ga0207671_10008023 3300025914 Bacteria 9033
150 Ga0207671_10008263 3300025914 Bacteria 8855
151 Ga0207649_10000443 3300025920 Bacteria 29944
152 Ga0207649_10205475 3300025920 Bacteria 1394
153 Ga0207681_10190384 3300025923 Bacteria 1569
154 Ga0207694_10032672 3300025924 Bacteria 3984
155 Ga0207694_10159567 3300025924 Bacteria 1821
156 Ga0207694_10232578 3300025924 Bacteria 1505
157 Ga0207659_10239277 3300025926 Unclassified 1468
158 Ga0207687_10004119 3300025927 Bacteria 9735
159 Ga0207687_10031413 3300025927 Bacteria 3588
160 Ga0207687_10825766 3300025927 Bacteria 791
161 Ga0207690_10011928 3300025932 Bacteria 5196
162 Ga0207690_10623593 3300025932 Bacteria 882
163 Ga0207706_10005757 3300025933 Bacteria 11532
164 Ga0207709_10151375 3300025935 Bacteria 1607
165 Ga0207669_10000251 3300025937 Bacteria 24482
166 Ga0207669_10024854 3300025937 Bacteria 3226
167 Ga0207711_10006789 3300025941 Bacteria 9616
168 Ga0207661_10149643 3300025944 Bacteria 2017
169 Ga0207667_10000001 3300025949 Bacteria 1178522
170 Ga0207712_10000002 3300025961 Bacteria 706628
171 Ga0207668_10100938 3300025972 Bacteria 2144
172 Ga0207668_10484877 3300025972 Bacteria 1061
173 Ga0207640_10001706 3300025981 Bacteria 11781
174 Ga0207703_10000272 3300026035 Bacteria 57191
175 Ga0207703_10000334 3300026035 Bacteria 51370
176 Ga0207639_10013303 3300026041 Bacteria 5756
177 Ga0207639_10044507 3300026041 Bacteria 3339
178 Ga0207639_10108706 3300026041 Bacteria 2255
179 Ga0207639_10295654 3300026041 Bacteria 1429
180 Ga0207639_10546866 3300026041 Bacteria 1063
181 Ga0207678_10015021 3300026067 Bacteria 6813
182 Ga0207708_10260545 3300026075 Bacteria 1400
183 Ga0207702_10003678 3300026078 Bacteria 13879
184 Ga0207641_10063720 3300026088 Bacteria 3149
185 Ga0207641_10100849 3300026088 Bacteria 2543
186 Ga0207648_10093222 3300026089 Bacteria 2634
187 Ga0207648_10125079 3300026089 Bacteria 2261
188 Ga0207676_10000217 3300026095 Bacteria 49723
189 Ga0207674_10008106 3300026116 Bacteria 12179
190 Ga0207674_10226904 3300026116 Bacteria 1816
191 Ga0207683_10008013 3300026121 Bacteria 9032
192 Ga0207683_10384176 3300026121 Bacteria 1291
193 Ga0207698_10012704 3300026142 Bacteria 5523
194 Ga0207698_10109798 3300026142 Bacteria 2309
195 Ga0268266_10000002 3300028379 Bacteria 3059047
196 Ga0268266_10000173 3300028379 Bacteria 117695
197 Ga0268266_10001468 3300028379 Bacteria 28028
198 Ga0268265_10000048 3300028380 Bacteria 178523
199 Ga0268264_10000304 3300028381 Bacteria 79130
200 Ga0307517_10001703 3300028786 Bacteria 36321
201 Ga0307517_10023907 3300028786 Bacteria 7565
202 Ga0307515_10463024 3300028794 Bacteria 882
203 Ga0307513_10028207 3300031456 Bacteria 6422
204 Ga0307513_10046629 3300031456 Bacteria 4722
205 Ga0307513_10052123 3300031456 Bacteria 4408
206 Ga0307508_10000251 3300031616 Bacteria 65275
207 Ga0307410_10459707 3300031852 Bacteria 1040
208 Ga0307412_10000160 3300031911 Bacteria 47459
209 Ga0307412_10488305 3300031911 Bacteria 1023
210 Ga0307416_100259022 3300032002 Bacteria 1699
211 Ga0307510_10010934 3300033180 Bacteria 10783
212 Ga0307510_10058820 3300033180 Bacteria 3976
213 Ga0373954_0078934 3300035118 Bacteria 1571
214 Ga0395905_0231144 3300037471 Bacteria 1729
215 Ga0395901_0072135 3300038443 Bacteria 3599
216 Ga0237816_00171 3300039145 Bacteria 5179
217 Ga0436365_0751207 3300039437 Bacteria 13250
218 Ga0436365_1447172 3300039437 Bacteria 79922
219 Ga0436365_1638339 3300039437 Bacteria 5293
220 Ga0436363_0676919 3300039450 Bacteria 1112
221 Ga0436362_0847557 3300039453 Bacteria 84207
222 Ga0439461_0000342 3300041410 Bacteria 6640
223 Ga0439461_0012942 3300041410 Bacteria 1567
224 Ga0439465_0002464 3300041413 Bacteria 6043
225 Ga0439465_0010492 3300041413 Bacteria 2908
226 Ga0451807_1258736 3300041486 Bacteria 810
227 Ga0439431_0002960 3300041997 Bacteria 3731
228 Ga0439433_0073116 3300041999 Bacteria 828
229 Ga0439443_008944 3300042003 Bacteria 1425
230 Ga0439445_0009573 3300042004 Bacteria 2285
231 Ga0439445_0012133 3300042004 Bacteria 2066
232 Ga0439432_001045 3300042006 Bacteria 10506
233 Ga0439432_087448 3300042006 Bacteria 940
234 Ga0439449_0112504 3300042007 Bacteria 1009
235 Ga0439452_012067 3300042010 Bacteria 2468
236 Ga0439457_009549 3300042014 Bacteria 2255
237 Ga0439462_0002511 3300042015 Bacteria 4271
238 Ga0439462_0011600 3300042015 Bacteria 2246
239 Ga0450923_024796 3300042125 Bacteria 1192
240 Ga0439434_0000405 3300042435 Bacteria 12271
241 Ga0439434_0020241 3300042435 Bacteria 1997
242 Ga0495617_015748 3300046452 Bacteria 2559
243 Ga0495590_0062781 3300046457 Bacteria 1300
244 Ga0495629_0011780 3300046459 Bacteria 6347
245 Ga0495638_0001538 3300046460 Bacteria 20746
246 Ga0495650_0000792 3300046471 Bacteria 38739
247 Ga0495584_0050523 3300046491 Bacteria 2094
248 Ga0495585_0005849 3300046492 Bacteria 7710
249 Ga0495585_0033403 3300046492 Bacteria 2912
250 Ga0495594_0186906 3300046499 Bacteria 1180
251 Ga0495596_0019300 3300046500 Bacteria 2802
252 Ga0495607_0117378 3300046501 Bacteria 1402
253 Ga0495583_0003563 3300046506 Bacteria 11728
254 Ga0495583_0004282 3300046506 Bacteria 10329
255 Ga0495583_0006785 3300046506 Bacteria 7399
256 Ga0495583_0031812 3300046506 Bacteria 2553
257 Ga0495606_0002822 3300046507 Bacteria 19294
258 Ga0495606_0018630 3300046507 Bacteria 5196
259 Ga0495606_0130071 3300046507 Bacteria 1497
260 Ga0495631_0058551 3300046518 Bacteria 1675
261 Ga0495637_0048933 3300046520 Bacteria 1778
262 Ga0495637_0070234 3300046520 Bacteria 1415
263 Ga0495643_0007657 3300046522 Bacteria 6927
264 Ga0495643_0143128 3300046522 Bacteria 1190
265 Ga0495648_0000123 3300046524 Bacteria 92159
266 Ga0495648_0003352 3300046524 Bacteria 14115
267 Ga0495648_0055575 3300046524 Bacteria 2386
268 Ga0495648_0137630 3300046524 Bacteria 1289
269 Ga0495642_0016383 3300046528 Bacteria 2888
270 Ga0495587_0087560 3300046536 Bacteria 1802
271 Ga0495609_0161567 3300046538 Bacteria 949
272 Ga0495597_0028596 3300046542 Bacteria 2551
273 Ga0495622_0003063 3300046557 Bacteria 7929
274 Ga0495622_0028547 3300046557 Bacteria 2606
275 Ga0495633_0004307 3300046558 Bacteria 9088
276 Ga0495668_0000149 3300046616 Bacteria 105826
277 Ga0495611_0001502 3300046648 Bacteria 11538
278 Ga0495611_0169035 3300046648 Bacteria 1022
279 Ga0495625_0001285 3300046660 Bacteria 31497
280 Ga0495625_0062067 3300046660 Bacteria 2642
281 Ga0495625_0085757 3300046660 Bacteria 2185
282 Ga0495625_0127614 3300046660 Bacteria 1725
283 Ga0495625_0478849 3300046660 Bacteria 764
284 Ga0495661_0354046 3300046665 Bacteria 722
285 Ga0495669_0000951 3300046684 Bacteria 12114
286 Ga0495613_0180714 3300046689 Bacteria 1494
287 Ga0495670_0001049 3300046691 Bacteria 13375
288 Ga0495670_0011359 3300046691 Bacteria 4378
289 Ga0495649_0008479 3300046694 Bacteria 6182
290 Ga0495660_0027783 3300046810 Bacteria 3199
291 Ga0495660_0084637 3300046810 Bacteria 1658
292 Ga0495683_0000751 3300047323 Bacteria 23402
293 Ga0495687_000181 3300047443 Bacteria 91455
294 Ga0495687_000286 3300047443 Bacteria 66428
295 Ga0495677_0004983 3300047445 Bacteria 5065
296 Ga0495677_0064507 3300047445 Bacteria 1361
297 Ga0495681_0027876 3300047470 Bacteria 2916
298 Ga0495681_0046417 3300047470 Bacteria 2071
299 Ga0495686_0000209 3300047472 Bacteria 108972
300 Ga0495686_0036224 3300047472 Bacteria 3167
301 Ga0495686_0039267 3300047472 Bacteria 3024
302 Ga0495686_0135316 3300047472 Bacteria 1458
303 Ga0496100_0618053 3300048903 Bacteria 842
304 Ga0496101_0172007 3300048904 Bacteria 1665
305 Ga0496102_0004598 3300048905 Bacteria 11673
306 Ga0496103_0000784 3300048906 Bacteria 23390
307 Ga0496104_0034197 3300048907 Bacteria 4737
308 Ga0496105_0106749 3300048908 Bacteria 2311
309 Ga0496107_0093653 3300048910 Bacteria 2197
310 Ga0496109_0670320 3300048912 Bacteria 974
311 Ga0496110_0043524 3300048913 Bacteria 3921
312 Ga0496114_0025174 3300048917 Bacteria 4862
313 Ga0496115_0000783 3300048918 Bacteria 23323
314 Ga0496115_0003374 3300048918 Bacteria 11458
315 Ga0496115_0145372 3300048918 Bacteria 1957
316 Ga0496116_0033294 3300048919 Bacteria 3659
317 Ga0496117_0001166 3300048920 Bacteria 39515
318 Ga0496118_0000039 3300048921 Bacteria 305458
319 Ga0496120_0022464 3300048923 Bacteria 3968
320 Ga0496121_0000123 3300048924 Bacteria 172448
321 Ga0496121_0001367 3300048924 Bacteria 41529
322 Ga0496121_0032716 3300048924 Bacteria 4721
323 Ga0496122_0033588 3300048925 Bacteria 4216
324 Ga0496122_0361105 3300048925 Bacteria 754
325 Ga0496123_0065126 3300048926 Bacteria 2318
326 Ga0496123_0173735 3300048926 Bacteria 1133
327 Ga0496124_0000232 3300048927 Bacteria 108986
328 Ga0496124_0001482 3300048927 Bacteria 34498
329 Ga0496124_0001624 3300048927 Bacteria 32235
330 Ga0496124_0039731 3300048927 Bacteria 4075
331 Ga0496125_0010075 3300048928 Bacteria 9588
332 Ga0496125_0037628 3300048928 Bacteria 4204
333 Ga0496126_0001437 3300048929 Bacteria 37376
334 Ga0496126_0187833 3300048929 Bacteria 1752
335 Ga0496126_0197356 3300048929 Bacteria 1701
336 Ga0501241_063773 3300049758 Bacteria 743
337 nmdc:mga0k408_14784_c1 3300050493 Bacteria 4307
338 nmdc:mga07m45_37750_c1 3300050496 Bacteria 2694
339 nmdc:mga0n895_282865_c1 3300050512 Bacteria 1682
340 Ga0500610_0003135 3300053079 Bacteria 6277
341 Ga0495655_0035074 3300053083 Bacteria 1246
342 Ga0500643_011454 3300053087 Bacteria 3235
343 Ga0500643_014523 3300053087 Bacteria 2734
344 Ga0500643_028405 3300053087 Bacteria 1730
345 Ga0500583_0099649 3300053092 Bacteria 1422
346 Ga0500651_0196820 3300053093 Bacteria 1190
347 Ga0500566_0004026 3300053094 Bacteria 8765
348 Ga0500641_0004051 3300053096 Bacteria 5174
349 Ga0500641_0031997 3300053096 Bacteria 2078
350 Ga0500650_0150380 3300053098 Bacteria 1077
351 Ga0500555_011321 3300053103 Bacteria 2562
352 Ga0500562_018356 3300053108 Bacteria 1806
353 Ga0500562_043972 3300053108 Bacteria 1189
354 Ga0500562_071676 3300053108 Bacteria 935
355 Ga0500595_004353 3300053119 Bacteria 6371
356 Ga0500595_005457 3300053119 Bacteria 5547
357 Ga0500595_013100 3300053119 Bacteria 3184
358 Ga0500597_002220 3300053120 Bacteria 5313
359 Ga0500642_0006722 3300053130 Bacteria 3813
360 Ga0500652_056579 3300053131 Bacteria 1609
361 Ga0500658_0004296 3300053134 Bacteria 5341
362 Ga0500658_0005688 3300053134 Bacteria 4641
363 Ga0500658_0011875 3300053134 Bacteria 3211
364 Ga0500658_0049295 3300053134 Bacteria 1716
365 Ga0500559_0008105 3300053136 Bacteria 4622
366 Ga0500559_0014726 3300053136 Bacteria 3304
367 Ga0500568_0007530 3300053139 Bacteria 5331
368 Ga0500568_0034212 3300053139 Bacteria 2080
369 Ga0500573_0000041 3300053140 Bacteria 103805
370 Ga0500577_0022309 3300053142 Bacteria 2099
371 Ga0500604_0002928 3300053151 Bacteria 4612
372 Ga0500616_0001169 3300053153 Bacteria 26764
373 Ga0500616_0046932 3300053153 Bacteria 2295
374 Ga0500619_039802 3300053154 Bacteria 1479
375 Ga0500624_000013 3300053157 Bacteria 165889
376 Ga0500636_0003876 3300053177 Bacteria 8442
377 Ga0500637_0001361 3300053178 Bacteria 10361
378 Ga0500645_000083 3300053730 Bacteria 76285
379 Ga0500645_000910 3300053730 Bacteria 17019
380 Ga0500645_072096 3300053730 Bacteria 991
381 Ga0500596_010498 3300053735 Bacteria 1429
382 Ga0500587_009155 3300053739 Bacteria 1268

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048929 Ga0496126_0187833 Ga0496126_0187833_193_702 169
2 3300005548 Ga0070665_100000567 Ga0070665_10000056720 187
3 3300028379 Ga0268266_10001468 Ga0268266_100014688 187
4 3300053153 Ga0500616_0046932 Ga0500616_0046932_1107_1763 190
5 3300042003 Ga0439443_008944 Ga0439443_008944_826_1410 191
6 3300053139 Ga0500568_0007530 Ga0500568_0007530_467_1123 191
7 3300053153 Ga0500616_0001169 Ga0500616_0001169_22114_22770 191
8 3300015690 Ga0183363_1007 Ga0183363_100763 192
9 3300041486 Ga0451807_1258736 Ga0451807_1258736_48_680 193
10 3300021384 Ga0213876_10003478 Ga0213876_100034784 198
11 3300039437 Ga0436365_0751207 Ga0436365_0751207_7065_7694 198
12 3300005329 Ga0070683_100051395 Ga0070683_1000513952 199
13 3300005535 Ga0070684_100579121 Ga0070684_1005791212 199
14 3300005546 Ga0070696_100459661 Ga0070696_1004596612 199
15 3300005614 Ga0068856_100191821 Ga0068856_1001918212 199
16 3300013105 Ga0157369_10215304 Ga0157369_102153042 199
17 3300013307 Ga0157372_10429520 Ga0157372_104295202 199
18 3300025912 Ga0207707_10291264 Ga0207707_102912643 199
19 3300025944 Ga0207661_10149643 Ga0207661_101496432 199
20 3300053151 Ga0500604_0002928 Ga0500604_0002928_591_1235 200
21 3300021358 Ga0213873_10000014 Ga0213873_10000014124 203
22 3300021384 Ga0213876_10000020 Ga0213876_10000020193 203
23 3300039437 Ga0436365_1447172 Ga0436365_1447172_72737_73348 203
24 3300039453 Ga0436362_0847557 Ga0436362_0847557_18219_18830 203
25 3300031911 Ga0307412_10488305 Ga0307412_104883052 204
26 iso_pu_bacteria 2928027323 2928031072 204
27 3300020081 Ga0206354_10538658 Ga0206354_105386584 205
28 3300020082 Ga0206353_11732096 Ga0206353_117320962 205
29 3300021384 Ga0213876_10041095 Ga0213876_100410952 205
30 3300039437 Ga0436365_1638339 Ga0436365_1638339_3541_4158 205
31 iso_pu_bacteria 2885429604 2885430989 205
32 3300053096 Ga0500641_0031997 Ga0500641_0031997_141_797 206
33 3300053108 Ga0500562_071676 Ga0500562_071676_71_727 206
34 3300048929 Ga0496126_0197356 Ga0496126_0197356_601_1227 207
35 iso_pu_bacteria 8057101203 8057101380 207
36 3300047472 Ga0495686_0039267 Ga0495686_0039267_802_1467 208
37 3300003214 JGI25165J46597_1000166 JGI25165J46597_100016646 209
38 3300005343 Ga0070687_100124163 Ga0070687_1001241632 209
39 3300005539 Ga0068853_100828330 Ga0068853_1008283302 209
40 3300005544 Ga0070686_100000180 Ga0070686_10000018049 209
41 3300005548 Ga0070665_100000145 Ga0070665_100000145129 209
42 3300005616 Ga0068852_100097753 Ga0068852_1000977532 209
43 3300005842 Ga0068858_100000275 Ga0068858_10000027513 209
44 3300006871 Ga0075434_100126641 Ga0075434_1001266412 209
45 3300009098 Ga0105245_10000232 Ga0105245_1000023249 209
46 3300009098 Ga0105245_10050673 Ga0105245_100506732 209
47 3300009098 Ga0105245_10345395 Ga0105245_103453952 209
48 3300009148 Ga0105243_10887812 Ga0105243_108878121 209
49 3300009551 Ga0105238_10097095 Ga0105238_100970952 209
50 3300010375 Ga0105239_10414169 Ga0105239_104141692 209
51 3300010375 Ga0105239_10598372 Ga0105239_105983722 209
52 3300013297 Ga0157378_10038176 Ga0157378_100381763 209
53 3300013306 Ga0163162_10529054 Ga0163162_105290542 209
54 3300020070 Ga0206356_10944380 Ga0206356_109443803 209
55 3300025261 Ga0209233_1000222 Ga0209233_100022246 209
56 3300025272 Ga0209455_1031187 Ga0209455_10311872 209
57 3300025924 Ga0207694_10159567 Ga0207694_101595673 209
58 3300025927 Ga0207687_10004119 Ga0207687_100041195 209
59 3300025927 Ga0207687_10031413 Ga0207687_100314132 209
60 3300025927 Ga0207687_10825766 Ga0207687_108257661 209
61 3300025935 Ga0207709_10151375 Ga0207709_101513752 209
62 3300025972 Ga0207668_10484877 Ga0207668_104848771 209
63 3300026035 Ga0207703_10000334 Ga0207703_1000033446 209
64 3300026041 Ga0207639_10044507 Ga0207639_100445072 209
65 3300026041 Ga0207639_10295654 Ga0207639_102956543 209
66 3300026088 Ga0207641_10100849 Ga0207641_101008494 209
67 3300026089 Ga0207648_10093222 Ga0207648_100932222 209
68 3300026142 Ga0207698_10109798 Ga0207698_101097982 209
69 3300028379 Ga0268266_10000173 Ga0268266_1000017320 209
70 3300031616 Ga0307508_10000251 Ga0307508_1000025154 209
71 3300031852 Ga0307410_10459707 Ga0307410_104597071 209
72 3300032002 Ga0307416_100259022 Ga0307416_1002590223 209
73 3300039450 Ga0436363_0676919 Ga0436363_0676919_471_1100 209
74 3300046492 Ga0495585_0033403 Ga0495585_0033403_138_767 209
75 3300046557 Ga0495622_0028547 Ga0495622_0028547_1327_1956 209
76 3300050512 nmdc:mga0n895_282865_c1 nmdc:mga0n895_282865_c1_478_1107 209
77 3300053083 Ga0495655_0035074 Ga0495655_0035074_80_709 209
78 3300053119 Ga0500595_013100 Ga0500595_013100_1289_1918 209
79 3300053134 Ga0500658_0049295 Ga0500658_0049295_575_1204 209
80 3300053136 Ga0500559_0008105 Ga0500559_0008105_2808_3437 209
81 3300053136 Ga0500559_0014726 Ga0500559_0014726_280_909 209
82 3300053739 Ga0500587_009155 Ga0500587_009155_217_849 209
83 iso_pu_bacteria 2830075706 2830076290 209
84 3300005617 Ga0068859_100015618 Ga0068859_1000156184 210
85 3300005841 Ga0068863_100056131 Ga0068863_1000561313 210
86 3300005843 Ga0068860_100000680 Ga0068860_1000006806 210
87 3300005844 Ga0068862_100000193 Ga0068862_10000019333 210
88 3300006931 Ga0097620_100015617 Ga0097620_1000156175 210
89 3300009101 Ga0105247_10013641 Ga0105247_100136413 210
90 3300014326 Ga0157380_10286260 Ga0157380_102862602 210
91 3300025961 Ga0207712_10000002 Ga0207712_10000002484 210
92 3300026088 Ga0207641_10063720 Ga0207641_100637203 210
93 3300028380 Ga0268265_10000048 Ga0268265_10000048150 210
94 3300028381 Ga0268264_10000304 Ga0268264_100003046 210
95 3300031456 Ga0307513_10052123 Ga0307513_100521234 210
96 3300035118 Ga0373954_0078934 Ga0373954_0078934_205_852 210
97 3300037471 Ga0395905_0231144 Ga0395905_0231144_397_1032 210
98 3300039145 Ga0237816_00171 Ga0237816_00171_1814_2455 210
99 3300046460 Ga0495638_0001538 Ga0495638_0001538_8383_9048 210
100 3300053087 Ga0500643_011454 Ga0500643_011454_809_1447 210
101 3300053087 Ga0500643_014523 Ga0500643_014523_1067_1705 210
102 3300005353 Ga0070669_100165743 Ga0070669_1001657432 211
103 3300005354 Ga0070675_100379063 Ga0070675_1003790632 211
104 3300005356 Ga0070674_100039904 Ga0070674_1000399042 211
105 3300005457 Ga0070662_100549005 Ga0070662_1005490052 211
106 3300005563 Ga0068855_100466365 Ga0068855_1004663652 211
107 3300005578 Ga0068854_100067809 Ga0068854_1000678093 211
108 3300005614 Ga0068856_100073783 Ga0068856_1000737833 211
109 3300005616 Ga0068852_100082034 Ga0068852_1000820342 211
110 3300006186 Ga0075369_10056906 Ga0075369_100569062 211
111 3300009174 Ga0105241_10003240 Ga0105241_100032408 211
112 3300009545 Ga0105237_10961856 Ga0105237_109618561 211
113 3300013102 Ga0157371_10000197 Ga0157371_1000019761 211
114 3300013297 Ga0157378_10233332 Ga0157378_102333323 211
115 3300014326 Ga0157380_10145241 Ga0157380_101452412 211
116 3300025230 Ga0209563_100024 Ga0209563_100024538 211
117 3300025233 Ga0209437_111166 Ga0209437_1111662 211
118 3300025253 Ga0209677_105926 Ga0209677_1059263 211
119 3300025254 Ga0209148_1000008 Ga0209148_1000008525 211
120 3300025272 Ga0209455_1000002 Ga0209455_1000002899 211
121 3300025904 Ga0207647_10327155 Ga0207647_103271551 211
122 3300025909 Ga0207705_10000489 Ga0207705_1000048922 211
123 3300025911 Ga0207654_10000273 Ga0207654_100002738 211
124 3300025913 Ga0207695_10018525 Ga0207695_100185255 211
125 3300025914 Ga0207671_10008263 Ga0207671_100082635 211
126 3300025920 Ga0207649_10000443 Ga0207649_1000044325 211
127 3300025920 Ga0207649_10205475 Ga0207649_102054752 211
128 3300025924 Ga0207694_10032672 Ga0207694_100326722 211
129 3300025926 Ga0207659_10239277 Ga0207659_102392773 211
130 3300025932 Ga0207690_10623593 Ga0207690_106235932 211
131 3300025933 Ga0207706_10005757 Ga0207706_100057572 211
132 3300025949 Ga0207667_10000001 Ga0207667_10000001823 211
133 3300025981 Ga0207640_10001706 Ga0207640_100017066 211
134 3300026041 Ga0207639_10108706 Ga0207639_101087064 211
135 3300026041 Ga0207639_10546866 Ga0207639_105468661 211
136 3300026075 Ga0207708_10260545 Ga0207708_102605452 211
137 3300026078 Ga0207702_10003678 Ga0207702_100036784 211
138 3300026116 Ga0207674_10008106 Ga0207674_1000810611 211
139 3300026142 Ga0207698_10012704 Ga0207698_100127042 211
140 3300028786 Ga0307517_10001703 Ga0307517_100017036 211
141 3300028786 Ga0307517_10023907 Ga0307517_100239075 211
142 3300031456 Ga0307513_10028207 Ga0307513_100282074 211
143 3300033180 Ga0307510_10058820 Ga0307510_100588203 211
144 3300046452 Ga0495617_015748 Ga0495617_015748_344_979 211
145 3300046457 Ga0495590_0062781 Ga0495590_0062781_499_1134 211
146 3300046459 Ga0495629_0011780 Ga0495629_0011780_4132_4767 211
147 3300046471 Ga0495650_0000792 Ga0495650_0000792_13084_13719 211
148 3300046491 Ga0495584_0050523 Ga0495584_0050523_865_1500 211
149 3300046499 Ga0495594_0186906 Ga0495594_0186906_520_1155 211
150 3300046500 Ga0495596_0019300 Ga0495596_0019300_2020_2655 211
151 3300046501 Ga0495607_0117378 Ga0495607_0117378_462_1097 211
152 3300046506 Ga0495583_0003563 Ga0495583_0003563_3524_4159 211
153 3300046506 Ga0495583_0004282 Ga0495583_0004282_7763_8398 211
154 3300046506 Ga0495583_0031812 Ga0495583_0031812_1883_2518 211
155 3300046507 Ga0495606_0002822 Ga0495606_0002822_880_1515 211
156 3300046507 Ga0495606_0018630 Ga0495606_0018630_3682_4317 211
157 3300046518 Ga0495631_0058551 Ga0495631_0058551_565_1200 211
158 3300046520 Ga0495637_0048933 Ga0495637_0048933_1072_1707 211
159 3300046520 Ga0495637_0070234 Ga0495637_0070234_527_1162 211
160 3300046522 Ga0495643_0007657 Ga0495643_0007657_6223_6858 211
161 3300046522 Ga0495643_0143128 Ga0495643_0143128_424_1059 211
162 3300046524 Ga0495648_0000123 Ga0495648_0000123_71196_71831 211
163 3300046524 Ga0495648_0137630 Ga0495648_0137630_389_1024 211
164 3300046536 Ga0495587_0087560 Ga0495587_0087560_1143_1778 211
165 3300046538 Ga0495609_0161567 Ga0495609_0161567_10_645 211
166 3300046542 Ga0495597_0028596 Ga0495597_0028596_566_1201 211
167 3300046557 Ga0495622_0003063 Ga0495622_0003063_4430_5065 211
168 3300046558 Ga0495633_0004307 Ga0495633_0004307_600_1235 211
169 3300046616 Ga0495668_0000149 Ga0495668_0000149_13109_13744 211
170 3300046648 Ga0495611_0001502 Ga0495611_0001502_1990_2625 211
171 3300046648 Ga0495611_0169035 Ga0495611_0169035_62_697 211
172 3300046660 Ga0495625_0001285 Ga0495625_0001285_20234_20869 211
173 3300046660 Ga0495625_0085757 Ga0495625_0085757_1539_2174 211
174 3300046660 Ga0495625_0127614 Ga0495625_0127614_864_1499 211
175 3300046660 Ga0495625_0478849 Ga0495625_0478849_54_689 211
176 3300046665 Ga0495661_0354046 Ga0495661_0354046_64_699 211
177 3300046684 Ga0495669_0000951 Ga0495669_0000951_3765_4400 211
178 3300046689 Ga0495613_0180714 Ga0495613_0180714_329_964 211
179 3300046691 Ga0495670_0011359 Ga0495670_0011359_725_1360 211
180 3300046694 Ga0495649_0008479 Ga0495649_0008479_381_1016 211
181 3300046810 Ga0495660_0027783 Ga0495660_0027783_1595_2230 211
182 3300046810 Ga0495660_0084637 Ga0495660_0084637_809_1444 211
183 3300047323 Ga0495683_0000751 Ga0495683_0000751_22027_22662 211
184 3300047443 Ga0495687_000181 Ga0495687_000181_56976_57611 211
185 3300047443 Ga0495687_000286 Ga0495687_000286_62273_62908 211
186 3300047445 Ga0495677_0064507 Ga0495677_0064507_145_780 211
187 3300047470 Ga0495681_0027876 Ga0495681_0027876_544_1179 211
188 3300048903 Ga0496100_0618053 Ga0496100_0618053_127_762 211
189 3300048904 Ga0496101_0172007 Ga0496101_0172007_494_1129 211
190 3300048905 Ga0496102_0004598 Ga0496102_0004598_3204_3839 211
191 3300048906 Ga0496103_0000784 Ga0496103_0000784_1552_2187 211
192 3300048907 Ga0496104_0034197 Ga0496104_0034197_1466_2101 211
193 3300048908 Ga0496105_0106749 Ga0496105_0106749_722_1357 211
194 3300048910 Ga0496107_0093653 Ga0496107_0093653_1073_1708 211
195 3300048912 Ga0496109_0670320 Ga0496109_0670320_47_682 211
196 3300048913 Ga0496110_0043524 Ga0496110_0043524_1778_2413 211
197 3300048917 Ga0496114_0025174 Ga0496114_0025174_1527_2162 211
198 3300048918 Ga0496115_0000783 Ga0496115_0000783_20872_21507 211
199 3300048919 Ga0496116_0033294 Ga0496116_0033294_1340_1975 211
200 3300048920 Ga0496117_0001166 Ga0496117_0001166_36099_36734 211
201 3300048921 Ga0496118_0000039 Ga0496118_0000039_3491_4126 211
202 3300048923 Ga0496120_0022464 Ga0496120_0022464_786_1421 211
203 3300048924 Ga0496121_0001367 Ga0496121_0001367_38132_38767 211
204 3300048925 Ga0496122_0033588 Ga0496122_0033588_38_673 211
205 3300048927 Ga0496124_0000232 Ga0496124_0000232_22292_22927 211
206 3300048928 Ga0496125_0010075 Ga0496125_0010075_3289_3924 211
207 3300048929 Ga0496126_0001437 Ga0496126_0001437_2740_3375 211
208 3300050493 nmdc:mga0k408_14784_c1 nmdc:mga0k408_14784_c1_2252_2887 211
209 3300053079 Ga0500610_0003135 Ga0500610_0003135_5416_6051 211
210 3300053092 Ga0500583_0099649 Ga0500583_0099649_635_1270 211
211 3300053119 Ga0500595_004353 Ga0500595_004353_1953_2588 211
212 3300053120 Ga0500597_002220 Ga0500597_002220_603_1247 211
213 3300053130 Ga0500642_0006722 Ga0500642_0006722_508_1143 211
214 3300053154 Ga0500619_039802 Ga0500619_039802_629_1264 211
215 3300053157 Ga0500624_000013 Ga0500624_000013_50468_51112 211
216 3300053177 Ga0500636_0003876 Ga0500636_0003876_5035_5670 211
217 3300053178 Ga0500637_0001361 Ga0500637_0001361_6192_6836 211
218 3300053730 Ga0500645_000083 Ga0500645_000083_24366_25001 211
219 3300053735 Ga0500596_010498 Ga0500596_010498_221_856 211
220 iso_pu_bacteria 2599185359 2600226855 211
221 iso_pu_bacteria 2818991466 2819715700 211
222 iso_pu_bacteria 2879163058 2879163142 211
223 iso_pu_bacteria 2928526807 2928529717 211
224 iso_pu_bacteria 2928968154 2928970795 211
225 3300003322 rootL2_10015964 rootL2_100159642 212
226 3300005548 Ga0070665_100000067 Ga0070665_100000067126 212
227 3300005618 Ga0068864_100000742 Ga0068864_1000007425 212
228 3300005842 Ga0068858_100053878 Ga0068858_1000538785 212
229 3300006237 Ga0097621_100052631 Ga0097621_1000526313 212
230 3300009148 Ga0105243_10000812 Ga0105243_100008126 212
231 3300011119 Ga0105246_10729161 Ga0105246_107291611 212
232 3300013296 Ga0157374_10473210 Ga0157374_104732101 212
233 3300013306 Ga0163162_10780614 Ga0163162_107806142 212
234 3300025924 Ga0207694_10232578 Ga0207694_102325782 212
235 3300025941 Ga0207711_10006789 Ga0207711_1000678910 212
236 3300026035 Ga0207703_10000272 Ga0207703_1000027226 212
237 3300026095 Ga0207676_10000217 Ga0207676_1000021751 212
238 3300026121 Ga0207683_10384176 Ga0207683_103841762 212
239 3300028379 Ga0268266_10000002 Ga0268266_10000002199 212
240 3300028794 Ga0307515_10463024 Ga0307515_104630241 212
241 3300031456 Ga0307513_10046629 Ga0307513_100466294 212
242 3300033180 Ga0307510_10010934 Ga0307510_1001093411 212
243 3300038443 Ga0395901_0072135 Ga0395901_0072135_430_1071 212
244 3300046492 Ga0495585_0005849 Ga0495585_0005849_3789_4430 212
245 3300046506 Ga0495583_0006785 Ga0495583_0006785_423_1079 212
246 3300046507 Ga0495606_0130071 Ga0495606_0130071_77_718 212
247 3300046524 Ga0495648_0055575 Ga0495648_0055575_286_942 212
248 3300046528 Ga0495642_0016383 Ga0495642_0016383_324_965 212
249 3300046660 Ga0495625_0062067 Ga0495625_0062067_1818_2474 212
250 3300047445 Ga0495677_0004983 Ga0495677_0004983_3512_4153 212
251 3300047472 Ga0495686_0000209 Ga0495686_0000209_105732_106388 212
252 3300048918 Ga0496115_0145372 Ga0496115_0145372_771_1415 212
253 3300048924 Ga0496121_0000123 Ga0496121_0000123_128746_129396 212
254 3300048924 Ga0496121_0032716 Ga0496121_0032716_3400_4059 212
255 3300053093 Ga0500651_0196820 Ga0500651_0196820_263_919 212
256 3300053098 Ga0500650_0150380 Ga0500650_0150380_330_986 212
257 3300053140 Ga0500573_0000041 Ga0500573_0000041_50033_50677 212
258 3300053730 Ga0500645_072096 Ga0500645_072096_311_967 212
259 iso_pu_bacteria 2984555340 2984556952 212
260 iso_pu_bacteria 2984564862 2984568741 212
261 iso_pu_bacteria 2993356040 2993359732 212
262 3300005262 Ga0065165_1012524 Ga0065165_10125243 213
263 3300005327 Ga0070658_10172368 Ga0070658_101723682 213
264 3300013100 Ga0157373_10586747 Ga0157373_105867471 213
265 3300046524 Ga0495648_0003352 Ga0495648_0003352_7899_8561 213
266 3300053730 Ga0500645_000910 Ga0500645_000910_8532_9176 213
267 3300050496 nmdc:mga07m45_37750_c1 nmdc:mga07m45_37750_c1_1381_2028 214
268 3300002774 JGI25150J39212_1000128 JGI25150J39212_100012835 215
269 3300003187 JGI25151J46595_10030545 JGI25151J46595_100305454 215
270 3300003215 JGI25153J46596_10000027 JGI25153J46596_1000002771 215
271 3300003771 Ga0055526_1005136 Ga0055526_10051364 215
272 3300003773 Ga0055537_1004563 Ga0055537_10045632 215
273 3300003781 Ga0055536_1007840 Ga0055536_10078403 215
274 3300003792 Ga0055540_1003208 Ga0055540_10032086 215
275 3300003792 Ga0055540_1004149 Ga0055540_10041493 215
276 3300005577 Ga0068857_100009574 Ga0068857_1000095742 215
277 3300005985 Ga0081539_10009013 Ga0081539_100090136 215
278 3300009545 Ga0105237_10021104 Ga0105237_100211045 215
279 3300025245 Ga0207425_1000005 Ga0207425_1000005335 215
280 3300025258 Ga0209129_1004436 Ga0209129_10044363 215
281 3300025263 Ga0209565_1000121 Ga0209565_100012197 215
282 3300025292 Ga0209676_1012128 Ga0209676_10121283 215
283 3300025294 Ga0209025_1001924 Ga0209025_100192410 215
284 3300025297 Ga0209758_1000002 Ga0209758_10000021009 215
285 3300025298 Ga0209050_1000001 Ga0209050_1000001993 215
286 3300025303 Ga0209051_1000802 Ga0209051_100080219 215
287 3300025304 Ga0209257_1000555 Ga0209257_100055528 215
288 3300025304 Ga0209257_1010458 Ga0209257_10104585 215
289 3300025914 Ga0207671_10008023 Ga0207671_100080237 215
290 3300025923 Ga0207681_10190384 Ga0207681_101903842 215
291 3300026041 Ga0207639_10013303 Ga0207639_100133034 215
292 3300026116 Ga0207674_10226904 Ga0207674_102269042 215
293 3300031911 Ga0307412_10000160 Ga0307412_1000016018 215
294 3300047472 Ga0495686_0036224 Ga0495686_0036224_320_1006 215
295 3300047472 Ga0495686_0135316 Ga0495686_0135316_660_1307 215
296 3300048918 Ga0496115_0003374 Ga0496115_0003374_1623_2270 215
297 3300048925 Ga0496122_0361105 Ga0496122_0361105_59_706 215
298 3300048926 Ga0496123_0065126 Ga0496123_0065126_1076_1723 215
299 3300048926 Ga0496123_0173735 Ga0496123_0173735_268_915 215
300 3300048927 Ga0496124_0001482 Ga0496124_0001482_1698_2345 215
301 3300048927 Ga0496124_0001624 Ga0496124_0001624_1175_1822 215
302 3300048927 Ga0496124_0039731 Ga0496124_0039731_2749_3396 215
303 3300048928 Ga0496125_0037628 Ga0496125_0037628_1025_1711 215
304 3300053096 Ga0500641_0004051 Ga0500641_0004051_2079_2753 215
305 3300053108 Ga0500562_018356 Ga0500562_018356_1085_1732 215
306 3300053119 Ga0500595_005457 Ga0500595_005457_1632_2294 215
307 3300053131 Ga0500652_056579 Ga0500652_056579_711_1358 215
308 3300053134 Ga0500658_0004296 Ga0500658_0004296_458_1123 215
309 3300053142 Ga0500577_0022309 Ga0500577_0022309_359_1024 215
310 3300003791 Ga0055530_10000202 Ga0055530_1000020215 216
311 3300003794 Ga0055531_10000090 Ga0055531_1000009026 216
312 3300005262 Ga0065165_1001918 Ga0065165_100191813 216
313 3300005262 Ga0065165_1004381 Ga0065165_100438111 216
314 3300009553 Ga0105249_10000002 Ga0105249_10000002112 216
315 3300025298 Ga0209050_1000051 Ga0209050_1000051212 216
316 3300025304 Ga0209257_1000028 Ga0209257_1000028156 216
317 3300049758 Ga0501241_063773 Ga0501241_063773_24_674 216
318 3300001915 JGI24741J21665_1002127 JGI24741J21665_10021273 217
319 3300001979 JGI24740J21852_10062956 JGI24740J21852_100629562 217
320 3300002067 JGI24735J21928_10034764 JGI24735J21928_100347642 217
321 3300003759 Ga0055525_1000119 Ga0055525_1000119110 217
322 3300003762 Ga0055542_1000076 Ga0055542_1000076111 217
323 3300003763 Ga0055529_1000004 Ga0055529_100000433 217
324 3300005327 Ga0070658_10002454 Ga0070658_1000245411 217
325 3300005331 Ga0070670_100422294 Ga0070670_1004222942 217
326 3300005339 Ga0070660_100566229 Ga0070660_1005662292 217
327 3300005344 Ga0070661_100000614 Ga0070661_1000006142 217
328 3300005347 Ga0070668_100193074 Ga0070668_1001930742 217
329 3300005355 Ga0070671_100137837 Ga0070671_1001378371 217
330 3300005356 Ga0070674_100154189 Ga0070674_1001541892 217
331 3300005366 Ga0070659_100556372 Ga0070659_1005563721 217
332 3300005367 Ga0070667_100196203 Ga0070667_1001962032 217
333 3300005539 Ga0068853_100941239 Ga0068853_1009412392 217
334 3300005834 Ga0068851_10324291 Ga0068851_103242911 217
335 3300006195 Ga0075366_10032737 Ga0075366_100327372 217
336 3300020082 Ga0206353_10762095 Ga0206353_107620951 217
337 3300025297 Ga0209758_1000007 Ga0209758_1000007802 217
338 3300025321 Ga0207656_10003245 Ga0207656_100032455 217
339 3300025901 Ga0207688_10040220 Ga0207688_100402203 217
340 3300025932 Ga0207690_10011928 Ga0207690_100119284 217
341 3300025937 Ga0207669_10024854 Ga0207669_100248544 217
342 3300025972 Ga0207668_10100938 Ga0207668_101009383 217
343 3300026067 Ga0207678_10015021 Ga0207678_100150217 217
344 3300046691 Ga0495670_0001049 Ga0495670_0001049_3593_4246 217
345 iso_pu_bacteria 2643221622 2644127841 217
346 3300005356 Ga0070674_100016877 Ga0070674_1000168772 218
347 3300005456 Ga0070678_100000786 Ga0070678_1000007862 218
348 3300005459 Ga0068867_100037571 Ga0068867_1000375713 218
349 3300009177 Ga0105248_10019877 Ga0105248_1001987710 218
350 3300013306 Ga0163162_10001358 Ga0163162_1000135820 218
351 3300014325 Ga0163163_10115281 Ga0163163_101152812 218
352 3300025937 Ga0207669_10000251 Ga0207669_1000025121 218
353 3300026089 Ga0207648_10125079 Ga0207648_101250793 218
354 3300026121 Ga0207683_10008013 Ga0207683_100080132 218
355 3300053108 Ga0500562_043972 Ga0500562_043972_117_788 218
356 3300000041 ARcpr5oldR_c004634 ARcpr5oldR_0046342 221
357 3300000043 ARcpr5yngRDRAFT_c008251 ARcpr5yngRDRAFT_0082512 221
358 3300003215 JGI25153J46596_10012056 JGI25153J46596_100120563 221
359 3300003773 Ga0055537_1008861 Ga0055537_10088613 221
360 3300003775 Ga0055524_1000324 Ga0055524_100032418 221
361 3300003791 Ga0055530_10007920 Ga0055530_100079206 221
362 3300003794 Ga0055531_10006935 Ga0055531_100069354 221
363 3300005262 Ga0065165_1016150 Ga0065165_10161504 221
364 3300025245 Ga0207425_1034022 Ga0207425_10340221 221
365 3300025263 Ga0209565_1000011 Ga0209565_1000011260 221
366 3300025291 Ga0209675_1006210 Ga0209675_10062107 221
367 3300025297 Ga0209758_1008966 Ga0209758_10089669 221
368 3300025298 Ga0209050_1009405 Ga0209050_10094053 221
369 3300025299 Ga0209256_1000016 Ga0209256_1000016339 221
370 3300025304 Ga0209257_1000855 Ga0209257_100085536 221
371 3300041410 Ga0439461_0000342 Ga0439461_0000342_23_688 221
372 3300041410 Ga0439461_0012942 Ga0439461_0012942_481_1146 221
373 3300041413 Ga0439465_0002464 Ga0439465_0002464_3623_4288 221
374 3300041413 Ga0439465_0010492 Ga0439465_0010492_1939_2604 221
375 3300041997 Ga0439431_0002960 Ga0439431_0002960_1756_2421 221
376 3300041999 Ga0439433_0073116 Ga0439433_0073116_16_681 221
377 3300042004 Ga0439445_0009573 Ga0439445_0009573_559_1224 221
378 3300042004 Ga0439445_0012133 Ga0439445_0012133_971_1636 221
379 3300042006 Ga0439432_001045 Ga0439432_001045_7892_8557 221
380 3300042006 Ga0439432_087448 Ga0439432_087448_154_819 221
381 3300042007 Ga0439449_0112504 Ga0439449_0112504_214_879 221
382 3300042010 Ga0439452_012067 Ga0439452_012067_1406_2071 221
383 3300042014 Ga0439457_009549 Ga0439457_009549_843_1508 221
384 3300042015 Ga0439462_0002511 Ga0439462_0002511_2726_3391 221
385 3300042015 Ga0439462_0011600 Ga0439462_0011600_1139_1804 221
386 3300042125 Ga0450923_024796 Ga0450923_024796_438_1103 221
387 3300042435 Ga0439434_0000405 Ga0439434_0000405_7857_8522 221
388 3300042435 Ga0439434_0020241 Ga0439434_0020241_1202_1867 221
389 3300047470 Ga0495681_0046417 Ga0495681_0046417_1195_1860 221
390 3300053087 Ga0500643_028405 Ga0500643_028405_741_1406 221
391 3300053094 Ga0500566_0004026 Ga0500566_0004026_1674_2339 221
392 3300053103 Ga0500555_011321 Ga0500555_011321_954_1619 221
393 3300053134 Ga0500658_0005688 Ga0500658_0005688_1352_2017 221
394 3300053134 Ga0500658_0011875 Ga0500658_0011875_1994_2659 221
395 3300053139 Ga0500568_0034212 Ga0500568_0034212_636_1301 221

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00300

His_Phos_1

Histidine phosphatase superfamily (branch 1)

37

222

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4qih-assembly1.cif.gz_B the structure of mycobacterial glucosyl-3-phosphoglycerate phosphatase rv2419c complexes with vo3 0.8162 13 209
6etj-assembly1.cif.gz_A-2 human pfkfb3 in complex with kan0438241 0.79 13 209
4ij6-assembly1.cif.gz_B crystal structure of a novel-type phosphoserine phosphatase mutant (h9a) from <i>hydrogenobacter thermophilus</i> tk-6 in complex with l-phosphoserine 0.7899 14 213
4ij5-assembly1.cif.gz_B crystal structure of a novel-type phosphoserine phosphatase from <i>hydrogenobacter thermophilus</i> tk-6 0.7884 14 218
5ajz-assembly1.cif.gz_A-2 human pfkfb3 in complex with an indole inhibitor 5 0.7876 13 209
ID Description Score Start End Superfamily
af_K7TSF9_113_270_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8274 20 154 3.40.50.1240
af_Q9LW33_109_250_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8217 20 154 3.40.50.1240
4qihB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8162 13 209 3.40.50.1240
af_Q4DL01_2_181_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8149 15 193 3.40.50.1240
af_A0A1D6HET3_64_207_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8028 20 158 3.40.50.1240
ID Description Score Start End GO Terms
AF-A0A239HJF6-F1-model_v4 Probable phosphoglycerate mutase 0.9851 52 216
AF-A0A848SV41-F1-model_v4 Histidine phosphatase family protein 0.9792 76 215
AF-A0A4Q5T0Y9-F1-model_v4 Histidine phosphatase family protein 0.979 96 221
AF-A0A2A2K250-F1-model_v4 Phosphoglycerate mutase (2,3-diphosphoglycerate-dependent) 0.9697 4 216 GO:0005737
GO:0016791
AF-A0A4Q5T0Y9-F1-model_v4 Histidine phosphatase family protein 0.9638 96 221

Feature Viewer

pLDDT pTM Quality
88.52 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map