F433148

General Info

Members Datasets Scaffolds Average Seq Length
395 223 790 147

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100033351|Ga0070707_1000333512
Length 164
Sequence MASPRVRKIADRIKVIVAEMLERRIKDPRLGFVTVTDVRVTGDSQQATVFYTVLGEDADLVSTAAALESAKGILRSEVAKQLALRHAPTLEFIHDALPETARQLDDVLAKARAQDEAVAAVATGAVYAGEPDPYKKPRVEGADEPEQDFHETVRRDLDEFDDEA

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
70 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
71 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
72 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
110 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
111 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
112 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
113 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
114 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
115 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
116 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
117 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
118 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
121 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
122 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
123 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
130 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
131 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
132 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
133 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
134 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
135 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
136 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
137 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
138 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
139 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
140 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
141 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
142 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
143 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
144 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
145 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
146 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
147 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
148 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
149 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
150 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
151 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
152 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
153 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
158 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
159 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
160 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
168 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
185 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
186 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
187 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
188 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
189 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
190 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
191 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
192 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
193 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
194 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
195 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
196 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
197 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
198 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
200 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
201 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
202 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
203 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
204 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
205 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
206 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
207 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
208 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
209 2643221561 Nocardioides sp. Root151 Isolate Unclassified
210 2643221620 Nocardioides sp. Root240 Isolate Unclassified
211 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
212 2643221696 Nocardioides sp. Root140 Isolate Unclassified
213 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
214 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
215 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
216 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
217 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
218 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
219 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
220 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
221 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
222 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
223 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 93.92
Metatranscriptomes 2.03
Isolates 4.05

Biome Distribution

Category Percentage (%)
Aerial Root 0.25
Bulb 0
Endosphere 3.8
Nodule 0
Rhizoplane 9.87
Rhizosphere 79.75
Stem 0
Stem Tuber 0.25
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100033351 3300005468 Bacteria 4910
2 JGI24737J22298_10151145 3300001990 Bacteria 685
3 JGI25405J52794_10035841 3300003911 Bacteria 1039
4 Ga0070658_10073267 3300005327 Bacteria 2808
5 Ga0070683_100341684 3300005329 Bacteria 1425
6 Ga0070683_102114919 3300005329 Bacteria 541
7 Ga0070670_100198796 3300005331 Bacteria 1742
8 Ga0070670_100256468 3300005331 Bacteria 1524
9 Ga0070682_100100835 3300005337 Bacteria 1905
10 Ga0070682_100300552 3300005337 Bacteria 1177
11 Ga0068868_100981498 3300005338 Bacteria 772
12 Ga0070660_100265726 3300005339 Bacteria 1401
13 Ga0070691_10450072 3300005341 Bacteria 735
14 Ga0070687_100300034 3300005343 Bacteria 1019
15 Ga0070692_10121942 3300005345 Bacteria 1455
16 Ga0070668_101407289 3300005347 Bacteria 636
17 Ga0070674_101097147 3300005356 Bacteria 703
18 Ga0070667_100773333 3300005367 Bacteria 891
19 Ga0070667_101015967 3300005367 Bacteria 774
20 Ga0070667_101234940 3300005367 Bacteria 700
21 Ga0070700_100480332 3300005441 Bacteria 952
22 Ga0070708_100467053 3300005445 Bacteria 1190
23 Ga0070663_100346454 3300005455 Bacteria 1202
24 Ga0070678_101703020 3300005456 Bacteria 593
25 Ga0070681_10045610 3300005458 Bacteria 4385
26 Ga0070698_100038510 3300005471 Bacteria 4926
27 Ga0070679_100002368 3300005530 Bacteria 17089
28 Ga0070684_100020302 3300005535 Bacteria 5511
29 Ga0070684_100156259 3300005535 Bacteria 2068
30 Ga0070684_100487975 3300005535 Bacteria 1141
31 Ga0070684_100542742 3300005535 Bacteria 1079
32 Ga0070684_100980852 3300005535 Bacteria 793
33 Ga0068853_101333438 3300005539 Bacteria 694
34 Ga0070686_101363763 3300005544 Bacteria 594
35 Ga0070665_101046792 3300005548 Bacteria 828
36 Ga0068855_100263655 3300005563 Bacteria 1918
37 Ga0068855_101429837 3300005563 Bacteria 712
38 Ga0068857_100010904 3300005577 Bacteria 7910
39 Ga0070702_100164946 3300005615 Bacteria 1435
40 Ga0068852_100883003 3300005616 Bacteria 911
41 Ga0068852_101339589 3300005616 Bacteria 738
42 Ga0068864_100074748 3300005618 Bacteria 2957
43 Ga0068866_10116617 3300005718 Bacteria 1498
44 Ga0068861_100410211 3300005719 Bacteria 1204
45 Ga0068851_10141057 3300005834 Bacteria 1311
46 Ga0068870_10220943 3300005840 Bacteria 1160
47 Ga0068863_100816419 3300005841 Bacteria 930
48 Ga0068860_100235574 3300005843 Bacteria 1779
49 Ga0081455_10000025 3300005937 Bacteria 157583
50 Ga0081455_10041807 3300005937 Bacteria 4026
51 Ga0075365_10171302 3300006038 Bacteria 1515
52 Ga0075365_10361810 3300006038 Bacteria 1023
53 Ga0075363_100039393 3300006048 Bacteria 2487
54 Ga0075364_10190919 3300006051 Bacteria 1387
55 Ga0075364_10490642 3300006051 Bacteria 840
56 Ga0075364_10677541 3300006051 Bacteria 704
57 Ga0075362_10037549 3300006177 Bacteria 2124
58 Ga0097621_100425232 3300006237 Bacteria 1193
59 Ga0097621_101226282 3300006237 Bacteria 707
60 Ga0068865_100411734 3300006881 Bacteria 1109
61 Ga0068865_100544625 3300006881 Bacteria 974
62 Ga0105251_10462138 3300009011 Bacteria 589
63 Ga0111539_10571728 3300009094 Bacteria 1316
64 Ga0105245_10008202 3300009098 Bacteria 9133
65 Ga0105245_10458677 3300009098 Bacteria 1284
66 Ga0105245_11140999 3300009098 Bacteria 826
67 Ga0105245_11201428 3300009098 Bacteria 806
68 Ga0105243_10299536 3300009148 Bacteria 1457
69 Ga0105243_10471207 3300009148 Bacteria 1183
70 Ga0105241_12194492 3300009174 Bacteria 547
71 Ga0105242_10171540 3300009176 Bacteria 1907
72 Ga0105248_10145572 3300009177 Bacteria 2674
73 Ga0105248_12338058 3300009177 Bacteria 609
74 Ga0105238_10750765 3300009551 Bacteria 990
75 Ga0105249_10022443 3300009553 Bacteria 5653
76 Ga0105249_10259187 3300009553 Bacteria 1727
77 Ga0105249_10639715 3300009553 Bacteria 1121
78 Ga0105249_12148101 3300009553 Bacteria 631
79 Ga0105239_10050364 3300010375 Bacteria 4568
80 Ga0105239_10168229 3300010375 Bacteria 2451
81 Ga0105239_10480459 3300010375 Bacteria 1411
82 Ga0105239_13101165 3300010375 Bacteria 541
83 Ga0105246_10002779 3300011119 Bacteria 10596
84 Ga0105246_10385921 3300011119 Bacteria 1159
85 Ga0157371_10321002 3300013102 Bacteria 1124
86 Ga0157369_10408619 3300013105 Bacteria 1408
87 Ga0157369_10627127 3300013105 Bacteria 1109
88 Ga0157369_11540256 3300013105 Bacteria 676
89 Ga0157374_10296453 3300013296 Bacteria 1599
90 Ga0157374_12019269 3300013296 Bacteria 603
91 Ga0163162_10988590 3300013306 Bacteria 951
92 Ga0163162_12092516 3300013306 Bacteria 649
93 Ga0157372_10392085 3300013307 Bacteria 1618
94 Ga0157372_11764945 3300013307 Bacteria 712
95 Ga0157375_10487584 3300013308 Bacteria 1397
96 Ga0157375_10622647 3300013308 Bacteria 1237
97 Ga0157375_10836215 3300013308 Bacteria 1068
98 Ga0157375_10955751 3300013308 Bacteria 998
99 Ga0163163_10174418 3300014325 Bacteria 2196
100 Ga0163163_10492729 3300014325 Bacteria 1287
101 Ga0163163_10533547 3300014325 Bacteria 1236
102 Ga0163163_11631596 3300014325 Bacteria 706
103 Ga0157380_10648724 3300014326 Bacteria 1053
104 Ga0157379_10066508 3300014968 Bacteria 3222
105 Ga0157376_10931613 3300014969 Bacteria 888
106 Ga0157376_11754957 3300014969 Bacteria 656
107 Ga0163161_10110236 3300017792 Bacteria 2057
108 Ga0163161_10573091 3300017792 Bacteria 928
109 Ga0163161_10575094 3300017792 Bacteria 926
110 Ga0197907_11417478 3300020069 Bacteria 1115
111 Ga0206353_10168687 3300020082 Bacteria 576
112 Ga0206353_10829262 3300020082 Bacteria 2911
113 Ga0206353_10994926 3300020082 Bacteria 784
114 Ga0154015_1072119 3300020610 Bacteria 2169
115 Ga0213876_10139430 3300021384 Bacteria 1290
116 Ga0213875_10084557 3300021388 Bacteria 1480
117 Ga0207656_10514986 3300025321 Bacteria 608
118 Ga0207688_10130938 3300025901 Bacteria 1470
119 Ga0207688_10261984 3300025901 Bacteria 1049
120 Ga0207688_10415044 3300025901 Bacteria 836
121 Ga0207688_10917429 3300025901 Bacteria 554
122 Ga0207647_10036622 3300025904 Bacteria 3116
123 Ga0207647_10115710 3300025904 Bacteria 1583
124 Ga0207647_10301973 3300025904 Bacteria 911
125 Ga0207643_10181739 3300025908 Bacteria 1273
126 Ga0207705_10012807 3300025909 Bacteria 6055
127 Ga0207705_10278037 3300025909 Bacteria 1281
128 Ga0207705_10771664 3300025909 Bacteria 746
129 Ga0207707_10037586 3300025912 Bacteria 4231
130 Ga0207707_11572394 3300025912 Bacteria 519
131 Ga0207671_10459388 3300025914 Bacteria 1014
132 Ga0207660_10502909 3300025917 Bacteria 983
133 Ga0207662_10266750 3300025918 Bacteria 1129
134 Ga0207662_10309673 3300025918 Bacteria 1052
135 Ga0207657_10070052 3300025919 Bacteria 2973
136 Ga0207657_10533476 3300025919 Bacteria 918
137 Ga0207652_10425512 3300025921 Bacteria 1197
138 Ga0207694_10188421 3300025924 Bacteria 1675
139 Ga0207694_11205263 3300025924 Bacteria 641
140 Ga0207659_10446099 3300025926 Bacteria 1089
141 Ga0207659_10515009 3300025926 Bacteria 1014
142 Ga0207687_10056356 3300025927 Bacteria 2757
143 Ga0207687_10738323 3300025927 Bacteria 837
144 Ga0207687_10796019 3300025927 Bacteria 806
145 Ga0207686_10059120 3300025934 Bacteria 2420
146 Ga0207686_10450791 3300025934 Bacteria 990
147 Ga0207709_10412431 3300025935 Bacteria 1035
148 Ga0207709_10492665 3300025935 Bacteria 955
149 Ga0207669_10556781 3300025937 Bacteria 926
150 Ga0207704_10083036 3300025938 Bacteria 2078
151 Ga0207704_10223200 3300025938 Bacteria 1396
152 Ga0207704_11741549 3300025938 Bacteria 536
153 Ga0207711_10143393 3300025941 Bacteria 2150
154 Ga0207661_10017285 3300025944 Bacteria 5333
155 Ga0207661_10198979 3300025944 Bacteria 1760
156 Ga0207661_10655710 3300025944 Bacteria 965
157 Ga0207661_10979992 3300025944 Bacteria 779
158 Ga0207679_10457274 3300025945 Bacteria 1133
159 Ga0207679_10506705 3300025945 Bacteria 1078
160 Ga0207679_11321284 3300025945 Bacteria 662
161 Ga0207667_10511313 3300025949 Bacteria 1217
162 Ga0207712_10464333 3300025961 Bacteria 1076
163 Ga0207712_11086180 3300025961 Bacteria 712
164 Ga0207668_10228099 3300025972 Bacteria 1500
165 Ga0207658_10291241 3300025986 Bacteria 1403
166 Ga0207658_11250517 3300025986 Bacteria 679
167 Ga0207639_10557462 3300026041 Bacteria 1053
168 Ga0207639_10807201 3300026041 Bacteria 874
169 Ga0207678_10975241 3300026067 Bacteria 750
170 Ga0207708_10402614 3300026075 Bacteria 1132
171 Ga0207708_10993276 3300026075 Bacteria 729
172 Ga0207702_10293118 3300026078 Bacteria 1542
173 Ga0207648_10951148 3300026089 Bacteria 804
174 Ga0207676_10129493 3300026095 Bacteria 2143
175 Ga0207674_10036572 3300026116 Bacteria 5113
176 Ga0207674_10150842 3300026116 Bacteria 2282
177 Ga0207675_100168109 3300026118 Bacteria 2095
178 Ga0207675_100213754 3300026118 Bacteria 1856
179 Ga0207675_100392333 3300026118 Bacteria 1367
180 Ga0207683_10153599 3300026121 Bacteria 2078
181 Ga0207683_11201638 3300026121 Bacteria 703
182 Ga0207698_10037307 3300026142 Bacteria 3578
183 Ga0207698_10747804 3300026142 Bacteria 976
184 Ga0207698_10818003 3300026142 Bacteria 935
185 Ga0268266_10002912 3300028379 Bacteria 17710
186 Ga0268264_10792149 3300028381 Bacteria 946
187 Ga0314311_1229274 3300030733 Bacteria 881
188 Ga0316179_1098336 3300030734 Bacteria 686
189 Ga0307516_10676528 3300031730 Bacteria 688
190 Ga0307405_10607195 3300031731 Bacteria 894
191 Ga0307405_11374999 3300031731 Bacteria 616
192 Ga0307413_10043682 3300031824 Bacteria 2643
193 Ga0307413_10314386 3300031824 Bacteria 1194
194 Ga0307413_11864355 3300031824 Bacteria 539
195 Ga0307518_10000507 3300031838 Bacteria 29604
196 Ga0307410_10162321 3300031852 Bacteria 1676
197 Ga0307410_10284791 3300031852 Bacteria 1298
198 Ga0307410_10863085 3300031852 Bacteria 773
199 Ga0307410_11964397 3300031852 Bacteria 522
200 Ga0307407_10186451 3300031903 Bacteria 1379
201 Ga0307412_10117040 3300031911 Bacteria 1913
202 Ga0307412_10236891 3300031911 Bacteria 1409
203 Ga0307409_100122622 3300031995 Bacteria 2204
204 Ga0307416_100231631 3300032002 Bacteria 1781
205 Ga0307416_102283532 3300032002 Bacteria 642
206 Ga0307414_10171764 3300032004 Bacteria 1734
207 Ga0307414_10791597 3300032004 Bacteria 864
208 Ga0307411_10123827 3300032005 Bacteria 1876
209 Ga0307411_10608010 3300032005 Bacteria 941
210 Ga0307415_100001999 3300032126 Bacteria 10033
211 Ga0395899_0048256 3300037312 Bacteria 3169
212 Ga0395900_0123802 3300037418 Bacteria 2652
213 Ga0395900_0573726 3300037418 Bacteria 1071
214 Ga0395898_0016619 3300037466 Bacteria 7521
215 Ga0395905_0060450 3300037471 Bacteria 3543
216 Ga0436364_0293981 3300037853 Bacteria 1999
217 Ga0436364_1175560 3300037853 Bacteria 553
218 Ga0395901_0007288 3300038443 Bacteria 11163
219 Ga0395901_0271910 3300038443 Bacteria 1762
220 Ga0436365_1452403 3300039437 Bacteria 1028
221 Ga0436365_1852140 3300039437 Bacteria 2241
222 Ga0439447_092743 3300041407 Bacteria 694
223 Ga0439461_0108361 3300041410 Bacteria 683
224 Ga0451793_1591680 3300041452 Bacteria 627
225 Ga0451843_0916054 3300041509 Bacteria 606
226 Ga0451843_1268819 3300041509 Bacteria 712
227 Ga0439431_0002769 3300041997 Bacteria 3858
228 Ga0439445_0006597 3300042004 Bacteria 2670
229 Ga0439446_0079899 3300042156 Bacteria 1011
230 Ga0439434_0002233 3300042435 Bacteria 5619
231 Ga0466965_0136843 3300044683 Bacteria 1273
232 Ga0466965_0361272 3300044683 Bacteria 797
233 Ga0466965_0368923 3300044683 Bacteria 789
234 Ga0466966_0246525 3300044684 Bacteria 1076
235 Ga0466961_0207479 3300044693 Bacteria 1210
236 Ga0466963_0194866 3300044694 Bacteria 1416
237 Ga0466963_0502405 3300044694 Bacteria 856
238 Ga0466963_0659885 3300044694 Bacteria 738
239 Ga0466964_0184128 3300044706 Bacteria 992
240 Ga0466968_0133552 3300044735 Bacteria 1131
241 Ga0466970_0040442 3300044765 Bacteria 2476
242 Ga0466970_0420416 3300044765 Bacteria 764
243 Ga0466957_0029618 3300044842 Bacteria 3266
244 Ga0466957_0144572 3300044842 Bacteria 1534
245 Ga0466960_0032826 3300044901 Bacteria 2407
246 Ga0466960_0215907 3300044901 Bacteria 1053
247 Ga0466960_0670669 3300044901 Bacteria 620
248 Ga0466960_0824113 3300044901 Bacteria 563
249 Ga0466967_0433567 3300045976 Bacteria 1282
250 Ga0466967_0475752 3300045976 Bacteria 1223
251 Ga0466967_0694544 3300045976 Bacteria 1007
252 Ga0466967_1704758 3300045976 Bacteria 627
253 Ga0495653_0176089 3300046463 Bacteria 1472
254 Ga0495653_0702526 3300046463 Bacteria 614
255 Ga0495667_0359149 3300046559 Bacteria 920
256 Ga0495674_1057125 3300047319 Bacteria 620
257 Ga0495680_0096704 3300047322 Bacteria 2205
258 Ga0496100_0940074 3300048903 Bacteria 679
259 Ga0496100_0998810 3300048903 Bacteria 658
260 Ga0496100_1660175 3300048903 Bacteria 505
261 Ga0496101_0851931 3300048904 Bacteria 718
262 Ga0496102_0013592 3300048905 Bacteria 7056
263 Ga0496102_0503392 3300048905 Bacteria 1133
264 Ga0496102_0792297 3300048905 Bacteria 870
265 Ga0496102_1362912 3300048905 Bacteria 628
266 Ga0496103_0378630 3300048906 Bacteria 909
267 Ga0496103_0415995 3300048906 Bacteria 863
268 Ga0496104_0205830 3300048907 Bacteria 1879
269 Ga0496104_0486591 3300048907 Bacteria 1145
270 Ga0496105_0004845 3300048908 Bacteria 10163
271 Ga0496105_0226744 3300048908 Bacteria 1519
272 Ga0496105_0293223 3300048908 Bacteria 1309
273 Ga0496106_0077751 3300048909 Bacteria 2545
274 Ga0496106_1307844 3300048909 Bacteria 563
275 Ga0496107_0979788 3300048910 Bacteria 614
276 Ga0496108_0404111 3300048911 Bacteria 1193
277 Ga0496108_0525616 3300048911 Bacteria 1033
278 Ga0496109_0165270 3300048912 Bacteria 2074
279 Ga0496109_0640056 3300048912 Bacteria 1000
280 Ga0496109_0751219 3300048912 Bacteria 913
281 Ga0496110_0064291 3300048913 Bacteria 3242
282 Ga0496110_0556322 3300048913 Bacteria 1042
283 Ga0496110_0638849 3300048913 Bacteria 964
284 Ga0496111_0034587 3300048914 Bacteria 3608
285 Ga0496111_0356169 3300048914 Bacteria 1083
286 Ga0496111_0532639 3300048914 Bacteria 863
287 Ga0496112_1563832 3300048915 Bacteria 573
288 Ga0496113_0687681 3300048916 Bacteria 817
289 Ga0496113_0728370 3300048916 Bacteria 790
290 Ga0496114_0003818 3300048917 Bacteria 11618
291 Ga0496114_0016635 3300048917 Bacteria 5930
292 Ga0496114_0018898 3300048917 Bacteria 5582
293 Ga0496114_0090309 3300048917 Bacteria 2600
294 Ga0496114_0104365 3300048917 Bacteria 2423
295 Ga0496115_0027306 3300048918 Bacteria 4463
296 Ga0501306_011783 3300049127 Bacteria 1119
297 Ga0501309_035600 3300049129 Bacteria 747
298 Ga0501311_031692 3300049527 Bacteria 768
299 Ga0501031_0143075 3300049568 Bacteria 1563
300 Ga0501032_0005625 3300049569 Bacteria 9285
301 Ga0501032_0125411 3300049569 Bacteria 1696
302 Ga0501033_0029018 3300049570 Bacteria 4156
303 Ga0501033_0167490 3300049570 Bacteria 1579
304 Ga0501034_0009813 3300049571 Bacteria 10009
305 Ga0501034_0151162 3300049571 Bacteria 2297
306 Ga0501034_1270707 3300049571 Bacteria 613
307 Ga0501036_0008172 3300049572 Bacteria 8577
308 Ga0501036_0019560 3300049572 Bacteria 5685
309 Ga0501037_0017187 3300049573 Bacteria 5325
310 Ga0501037_0064838 3300049573 Bacteria 2661
311 Ga0501037_0953899 3300049573 Bacteria 560
312 Ga0501038_0011330 3300049574 Bacteria 8141
313 Ga0501038_0150297 3300049574 Bacteria 1899
314 Ga0501038_0729911 3300049574 Bacteria 740
315 Ga0501039_0052874 3300049575 Bacteria 3142
316 Ga0501039_0268335 3300049575 Bacteria 1341
317 Ga0501039_0492027 3300049575 Bacteria 963
318 Ga0501039_0578090 3300049575 Bacteria 881
319 Ga0501039_1589193 3300049575 Bacteria 502
320 Ga0501040_0518095 3300049576 Bacteria 860
321 Ga0501042_0116529 3300049578 Bacteria 1923
322 Ga0501042_0169960 3300049578 Bacteria 1573
323 Ga0501046_0063290 3300049580 Bacteria 2889
324 Ga0501046_0212462 3300049580 Bacteria 1435
325 Ga0501047_0009384 3300049581 Bacteria 9243
326 Ga0501047_0302599 3300049581 Bacteria 1441
327 Ga0501048_0001905 3300049582 Bacteria 15841
328 Ga0501048_0413812 3300049582 Bacteria 964
329 Ga0501067_0001852 3300049583 Bacteria 11638
330 Ga0501067_0269101 3300049583 Bacteria 949
331 Ga0501068_0004395 3300049584 Bacteria 7670
332 Ga0501068_1065901 3300049584 Bacteria 534
333 Ga0501069_0069450 3300049585 Bacteria 1972
334 Ga0501069_0223446 3300049585 Bacteria 1095
335 Ga0501069_0435541 3300049585 Bacteria 778
336 Ga0501070_0001372 3300049586 Bacteria 21777
337 Ga0501070_0013174 3300049586 Bacteria 6969
338 Ga0501070_0035985 3300049586 Bacteria 4134
339 Ga0501070_0081502 3300049586 Bacteria 2677
340 Ga0501070_0573050 3300049586 Bacteria 902
341 Ga0501071_0006585 3300049587 Bacteria 7545
342 Ga0501071_0316790 3300049587 Bacteria 1184
343 Ga0501072_0370927 3300049588 Bacteria 1136
344 Ga0501072_0574407 3300049588 Bacteria 890
345 Ga0501072_1135589 3300049588 Bacteria 608
346 Ga0501073_0097443 3300049589 Bacteria 2043
347 Ga0501073_0233849 3300049589 Bacteria 1269
348 Ga0501074_0014548 3300049590 Bacteria 5725
349 Ga0501074_0078927 3300049590 Bacteria 2362
350 Ga0501074_0667149 3300049590 Bacteria 734
351 Ga0501076_0327125 3300049592 Bacteria 1257
352 Ga0501077_0173183 3300049593 Bacteria 1371
353 Ga0501079_0868313 3300049741 Bacteria 710
354 Ga0501080_0028783 3300049742 Bacteria 5172
355 Ga0501080_0092659 3300049742 Bacteria 2806
356 Ga0501080_0243339 3300049742 Bacteria 1641
357 Ga0501081_1409068 3300049743 Bacteria 529
358 Ga0501083_0164098 3300049744 Bacteria 1452
359 Ga0501083_0208159 3300049744 Bacteria 1275
360 Ga0501044_0016962 3300049823 Bacteria 7814
361 Ga0501044_0017336 3300049823 Bacteria 7724
362 Ga0501044_0151736 3300049823 Bacteria 2299
363 Ga0501044_0272284 3300049823 Bacteria 1628
364 Ga0501045_0032464 3300049824 Bacteria 3783
365 nmdc:mga03683_51311_c1 3300050489 Bacteria 1721
366 nmdc:mga03n38_108560_c1 3300050490 Bacteria 1348
367 nmdc:mga03n38_36262_c1 3300050490 Bacteria 2119
368 nmdc:mga00v17_13300_c1 3300050491 Bacteria 4565
369 nmdc:mga00v17_394692_c1 3300050491 Bacteria 899
370 nmdc:mga0yw44_679814_c1 3300050492 Bacteria 699
371 nmdc:mga0yw44_81576_c1 3300050492 Bacteria 2028
372 nmdc:mga0yw44_82666_c1 3300050492 Bacteria 2015
373 Ga0495619_0095764 3300053085 Bacteria 2014
374 Ga0501082_0085095 3300060353 Bacteria 2727
375 Ga0501082_0086518 3300060353 Bacteria 2704
376 Ga0501082_0952818 3300060353 Bacteria 750
377 Ga0501082_1609626 3300060353 Bacteria 567
378 Ga0466962_0229270 3300061719 Bacteria 910
379 Ga0530510_0954598 3300061734 Bacteria 656
380 2586062867 2585427649 Bacteria 9053857
381 2643825438 2643221561 Bacteria 4984412
382 2644114892 2643221620 Bacteria 5134593
383 2644456677 2643221681 Bacteria 3707866
384 2644531435 2643221696 Bacteria 5431823
385 2739205438 2738543005 Bacteria 5278128
386 2739362134 2738543034 Bacteria 6084756
387 2774393510 2773857762 Bacteria 5971770
388 2809195598 2808606439 Bacteria 5952208
389 2809587958 2808606522 Bacteria 9488490
390 2812350497 2811994878 Bacteria 5992952
391 2891971902 2891968417 Bacteria 5821697
392 2899376356 2899370129 Bacteria 6781179
393 2915774619 2915768154 Bacteria 8424322
394 2928144846 2928142448 Bacteria 5288925
395 2990258765 2990256926 Bacteria 4252839
396 Ga0070707_100033351
397 JGI24737J22298_10151145
398 JGI25405J52794_10035841
399 Ga0070658_10073267
400 Ga0070683_100341684
401 Ga0070683_102114919
402 Ga0070670_100198796
403 Ga0070670_100256468
404 Ga0070682_100100835
405 Ga0070682_100300552
406 Ga0068868_100981498
407 Ga0070660_100265726
408 Ga0070691_10450072
409 Ga0070687_100300034
410 Ga0070692_10121942
411 Ga0070668_101407289
412 Ga0070674_101097147
413 Ga0070667_100773333
414 Ga0070667_101015967
415 Ga0070667_101234940
416 Ga0070700_100480332
417 Ga0070708_100467053
418 Ga0070663_100346454
419 Ga0070678_101703020
420 Ga0070681_10045610
421 Ga0070698_100038510
422 Ga0070679_100002368
423 Ga0070684_100020302
424 Ga0070684_100156259
425 Ga0070684_100487975
426 Ga0070684_100542742
427 Ga0070684_100980852
428 Ga0068853_101333438
429 Ga0070686_101363763
430 Ga0070665_101046792
431 Ga0068855_100263655
432 Ga0068855_101429837
433 Ga0068857_100010904
434 Ga0070702_100164946
435 Ga0068852_100883003
436 Ga0068852_101339589
437 Ga0068864_100074748
438 Ga0068866_10116617
439 Ga0068861_100410211
440 Ga0068851_10141057
441 Ga0068870_10220943
442 Ga0068863_100816419
443 Ga0068860_100235574
444 Ga0081455_10000025
445 Ga0081455_10041807
446 Ga0075365_10171302
447 Ga0075365_10361810
448 Ga0075363_100039393
449 Ga0075364_10190919
450 Ga0075364_10490642
451 Ga0075364_10677541
452 Ga0075362_10037549
453 Ga0097621_100425232
454 Ga0097621_101226282
455 Ga0068865_100411734
456 Ga0068865_100544625
457 Ga0105251_10462138
458 Ga0111539_10571728
459 Ga0105245_10008202
460 Ga0105245_10458677
461 Ga0105245_11140999
462 Ga0105245_11201428
463 Ga0105243_10299536
464 Ga0105243_10471207
465 Ga0105241_12194492
466 Ga0105242_10171540
467 Ga0105248_10145572
468 Ga0105248_12338058
469 Ga0105238_10750765
470 Ga0105249_10022443
471 Ga0105249_10259187
472 Ga0105249_10639715
473 Ga0105249_12148101
474 Ga0105239_10050364
475 Ga0105239_10168229
476 Ga0105239_10480459
477 Ga0105239_13101165
478 Ga0105246_10002779
479 Ga0105246_10385921
480 Ga0157371_10321002
481 Ga0157369_10408619
482 Ga0157369_10627127
483 Ga0157369_11540256
484 Ga0157374_10296453
485 Ga0157374_12019269
486 Ga0163162_10988590
487 Ga0163162_12092516
488 Ga0157372_10392085
489 Ga0157372_11764945
490 Ga0157375_10487584
491 Ga0157375_10622647
492 Ga0157375_10836215
493 Ga0157375_10955751
494 Ga0163163_10174418
495 Ga0163163_10492729
496 Ga0163163_10533547
497 Ga0163163_11631596
498 Ga0157380_10648724
499 Ga0157379_10066508
500 Ga0157376_10931613
501 Ga0157376_11754957
502 Ga0163161_10110236
503 Ga0163161_10573091
504 Ga0163161_10575094
505 Ga0197907_11417478
506 Ga0206353_10168687
507 Ga0206353_10829262
508 Ga0206353_10994926
509 Ga0154015_1072119
510 Ga0213876_10139430
511 Ga0213875_10084557
512 Ga0207656_10514986
513 Ga0207688_10130938
514 Ga0207688_10261984
515 Ga0207688_10415044
516 Ga0207688_10917429
517 Ga0207647_10036622
518 Ga0207647_10115710
519 Ga0207647_10301973
520 Ga0207643_10181739
521 Ga0207705_10012807
522 Ga0207705_10278037
523 Ga0207705_10771664
524 Ga0207707_10037586
525 Ga0207707_11572394
526 Ga0207671_10459388
527 Ga0207660_10502909
528 Ga0207662_10266750
529 Ga0207662_10309673
530 Ga0207657_10070052
531 Ga0207657_10533476
532 Ga0207652_10425512
533 Ga0207694_10188421
534 Ga0207694_11205263
535 Ga0207659_10446099
536 Ga0207659_10515009
537 Ga0207687_10056356
538 Ga0207687_10738323
539 Ga0207687_10796019
540 Ga0207686_10059120
541 Ga0207686_10450791
542 Ga0207709_10412431
543 Ga0207709_10492665
544 Ga0207669_10556781
545 Ga0207704_10083036
546 Ga0207704_10223200
547 Ga0207704_11741549
548 Ga0207711_10143393
549 Ga0207661_10017285
550 Ga0207661_10198979
551 Ga0207661_10655710
552 Ga0207661_10979992
553 Ga0207679_10457274
554 Ga0207679_10506705
555 Ga0207679_11321284
556 Ga0207667_10511313
557 Ga0207712_10464333
558 Ga0207712_11086180
559 Ga0207668_10228099
560 Ga0207658_10291241
561 Ga0207658_11250517
562 Ga0207639_10557462
563 Ga0207639_10807201
564 Ga0207678_10975241
565 Ga0207708_10402614
566 Ga0207708_10993276
567 Ga0207702_10293118
568 Ga0207648_10951148
569 Ga0207676_10129493
570 Ga0207674_10036572
571 Ga0207674_10150842
572 Ga0207675_100168109
573 Ga0207675_100213754
574 Ga0207675_100392333
575 Ga0207683_10153599
576 Ga0207683_11201638
577 Ga0207698_10037307
578 Ga0207698_10747804
579 Ga0207698_10818003
580 Ga0268266_10002912
581 Ga0268264_10792149
582 Ga0314311_1229274
583 Ga0316179_1098336
584 Ga0307516_10676528
585 Ga0307405_10607195
586 Ga0307405_11374999
587 Ga0307413_10043682
588 Ga0307413_10314386
589 Ga0307413_11864355
590 Ga0307518_10000507
591 Ga0307410_10162321
592 Ga0307410_10284791
593 Ga0307410_10863085
594 Ga0307410_11964397
595 Ga0307407_10186451
596 Ga0307412_10117040
597 Ga0307412_10236891
598 Ga0307409_100122622
599 Ga0307416_100231631
600 Ga0307416_102283532
601 Ga0307414_10171764
602 Ga0307414_10791597
603 Ga0307411_10123827
604 Ga0307411_10608010
605 Ga0307415_100001999
606 Ga0395899_0048256
607 Ga0395900_0123802
608 Ga0395900_0573726
609 Ga0395898_0016619
610 Ga0395905_0060450
611 Ga0436364_0293981
612 Ga0436364_1175560
613 Ga0395901_0007288
614 Ga0395901_0271910
615 Ga0436365_1452403
616 Ga0436365_1852140
617 Ga0439447_092743
618 Ga0439461_0108361
619 Ga0451793_1591680
620 Ga0451843_0916054
621 Ga0451843_1268819
622 Ga0439431_0002769
623 Ga0439445_0006597
624 Ga0439446_0079899
625 Ga0439434_0002233
626 Ga0466965_0136843
627 Ga0466965_0361272
628 Ga0466965_0368923
629 Ga0466966_0246525
630 Ga0466961_0207479
631 Ga0466963_0194866
632 Ga0466963_0502405
633 Ga0466963_0659885
634 Ga0466964_0184128
635 Ga0466968_0133552
636 Ga0466970_0040442
637 Ga0466970_0420416
638 Ga0466957_0029618
639 Ga0466957_0144572
640 Ga0466960_0032826
641 Ga0466960_0215907
642 Ga0466960_0670669
643 Ga0466960_0824113
644 Ga0466967_0433567
645 Ga0466967_0475752
646 Ga0466967_0694544
647 Ga0466967_1704758
648 Ga0495653_0176089
649 Ga0495653_0702526
650 Ga0495667_0359149
651 Ga0495674_1057125
652 Ga0495680_0096704
653 Ga0496100_0940074
654 Ga0496100_0998810
655 Ga0496100_1660175
656 Ga0496101_0851931
657 Ga0496102_0013592
658 Ga0496102_0503392
659 Ga0496102_0792297
660 Ga0496102_1362912
661 Ga0496103_0378630
662 Ga0496103_0415995
663 Ga0496104_0205830
664 Ga0496104_0486591
665 Ga0496105_0004845
666 Ga0496105_0226744
667 Ga0496105_0293223
668 Ga0496106_0077751
669 Ga0496106_1307844
670 Ga0496107_0979788
671 Ga0496108_0404111
672 Ga0496108_0525616
673 Ga0496109_0165270
674 Ga0496109_0640056
675 Ga0496109_0751219
676 Ga0496110_0064291
677 Ga0496110_0556322
678 Ga0496110_0638849
679 Ga0496111_0034587
680 Ga0496111_0356169
681 Ga0496111_0532639
682 Ga0496112_1563832
683 Ga0496113_0687681
684 Ga0496113_0728370
685 Ga0496114_0003818
686 Ga0496114_0016635
687 Ga0496114_0018898
688 Ga0496114_0090309
689 Ga0496114_0104365
690 Ga0496115_0027306
691 Ga0501306_011783
692 Ga0501309_035600
693 Ga0501311_031692
694 Ga0501031_0143075
695 Ga0501032_0005625
696 Ga0501032_0125411
697 Ga0501033_0029018
698 Ga0501033_0167490
699 Ga0501034_0009813
700 Ga0501034_0151162
701 Ga0501034_1270707
702 Ga0501036_0008172
703 Ga0501036_0019560
704 Ga0501037_0017187
705 Ga0501037_0064838
706 Ga0501037_0953899
707 Ga0501038_0011330
708 Ga0501038_0150297
709 Ga0501038_0729911
710 Ga0501039_0052874
711 Ga0501039_0268335
712 Ga0501039_0492027
713 Ga0501039_0578090
714 Ga0501039_1589193
715 Ga0501040_0518095
716 Ga0501042_0116529
717 Ga0501042_0169960
718 Ga0501046_0063290
719 Ga0501046_0212462
720 Ga0501047_0009384
721 Ga0501047_0302599
722 Ga0501048_0001905
723 Ga0501048_0413812
724 Ga0501067_0001852
725 Ga0501067_0269101
726 Ga0501068_0004395
727 Ga0501068_1065901
728 Ga0501069_0069450
729 Ga0501069_0223446
730 Ga0501069_0435541
731 Ga0501070_0001372
732 Ga0501070_0013174
733 Ga0501070_0035985
734 Ga0501070_0081502
735 Ga0501070_0573050
736 Ga0501071_0006585
737 Ga0501071_0316790
738 Ga0501072_0370927
739 Ga0501072_0574407
740 Ga0501072_1135589
741 Ga0501073_0097443
742 Ga0501073_0233849
743 Ga0501074_0014548
744 Ga0501074_0078927
745 Ga0501074_0667149
746 Ga0501076_0327125
747 Ga0501077_0173183
748 Ga0501079_0868313
749 Ga0501080_0028783
750 Ga0501080_0092659
751 Ga0501080_0243339
752 Ga0501081_1409068
753 Ga0501083_0164098
754 Ga0501083_0208159
755 Ga0501044_0016962
756 Ga0501044_0017336
757 Ga0501044_0151736
758 Ga0501044_0272284
759 Ga0501045_0032464
760 nmdc:mga03683_51311_c1
761 nmdc:mga03n38_108560_c1
762 nmdc:mga03n38_36262_c1
763 nmdc:mga00v17_13300_c1
764 nmdc:mga00v17_394692_c1
765 nmdc:mga0yw44_679814_c1
766 nmdc:mga0yw44_81576_c1
767 nmdc:mga0yw44_82666_c1
768 Ga0495619_0095764
769 Ga0501082_0085095
770 Ga0501082_0086518
771 Ga0501082_0952818
772 Ga0501082_1609626
773 Ga0466962_0229270
774 Ga0530510_0954598
775 2586062867
776 2643825438
777 2644114892
778 2644456677
779 2644531435
780 2739205438
781 2739362134
782 2774393510
783 2809195598
784 2809587958
785 2812350497
786 2891971902
787 2899376356
788 2915774619
789 2928144846
790 2990258765

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02033

RBFA

Ribosome-binding factor A

5

108

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dyj-assembly2.cif.gz_B crystal structure of ribosome-binding factor a from thermus thermophilus hb8 0.9154 6 94
8bxa-assembly1.cif.gz_A crystal structure of ribosome binding factor a (rbfa) from s. aureus 0.9151 1 95
2dyj-assembly1.cif.gz_A crystal structure of ribosome-binding factor a from thermus thermophilus hb8 0.8832 6 98
1jos-assembly1.cif.gz_A ribosome binding factor a(rbfa) 0.8775 6 99
7afq-assembly1.cif.gz_V ribosome binding factor a (rbfa) 0.8771 7 95
ID Description Score Start End Superfamily
2dyjB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9154 6 94 3.30.300.20
af_P0A7G2_1_108_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8676 2 103 3.30.300.20
2dyjB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8587 6 94 3.30.300.20
af_A0A0G2K1B0_81_186_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8337 5 95 3.30.300.20
2kzfA00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8334 1 99 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A7W1JKP3-F1-model_v4 30S ribosome-binding factor RbfA 0.967 1 98 GO:0005829
GO:0006364
GO:0043024
AF-A0A1V4MYM7-F1-model_v4 Ribosome-binding factor A 0.9638 1 95 GO:0005829
GO:0030490
GO:0043024
AF-A0A1F5VEF0-F1-model_v4 Ribosome-binding factor A 0.9617 1 95 GO:0005829
GO:0030490
GO:0043024
AF-A0A7W1JKP3-F1-model_v4 30S ribosome-binding factor RbfA 0.9574 1 98 GO:0005829
GO:0006364
GO:0043024
AF-A0A7Z9LZB6-F1-model_v4 30S ribosome-binding factor RbfA 0.9536 1 93 GO:0005829
GO:0006364
GO:0043024

Map