F433029

General Info

Members Datasets Scaffolds Average Seq Length
394 252 788 322

Family's Representative Sequence

Representative Sequence 3300048929|Ga0496126_0011592|Ga0496126_0011592_1210_2304
Length 364
Sequence MPLLTKYLFHRRVRPEGSQLACSRHRGAASAPNDKGDDMIDFTGQTVIVTGAGRGLGRLYALDVAKRGAAVVVNDIGSTMRGDGVDAAVADSVVDEITRAGGRAVASHDSVDTAEGGAAIVDAAVDAFGRLDAVVSNAGIFGSVAFEDLSHDDWTRMLRVHLDGGFHLSQPAYRVMKANGGGRFVFISSSAGVFGQPMEAHYAAAKTGLIGLTNVIAIEGEAHGILANAVLPTGFSRMVTETVGDEKFLAESGFMRAIRPELVVPLVVFLASRACTFTHRNYSACAGRYARAFVGLSEGWLADADTEPAAEDIAEHLEQISATEKFIVPTSIVDEVLEVCDRLGVSPMPGGADVEFPEPQKQRS

Samples

Sample ID Description Type Environment
1 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
138 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
139 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
140 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
141 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
142 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
143 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
144 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
145 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
146 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
147 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
148 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
149 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
150 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
153 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
154 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
155 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
156 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
157 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
158 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
159 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
160 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
161 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
162 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
163 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
164 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
165 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
166 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
167 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
168 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
169 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
170 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
171 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
172 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
173 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
174 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
179 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
184 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
185 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
186 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
187 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
188 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
189 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
190 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
191 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
200 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
201 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
202 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
203 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
204 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
205 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
206 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
207 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
208 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
209 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
210 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
211 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
212 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
213 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
214 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
215 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
216 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
217 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
218 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
219 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
220 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
221 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
222 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
223 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
224 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
225 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
226 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
227 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
228 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
229 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
230 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
231 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
232 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
233 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
234 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
235 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
236 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
237 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
238 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
239 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
240 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
241 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
242 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
243 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
244 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
245 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
246 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
247 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
248 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
249 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
250 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
251 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
252 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.72
Metatranscriptomes 0
Isolates 2.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.65
Nodule 0.25
Rhizoplane 5.33
Rhizosphere 61.17
Stem 0
Stem Tuber 0
Unclassified 2.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496126_0011592 3300048929 Bacteria 9099
2 JGI24742J22300_10000312 3300002244 Bacteria 7224
3 Ga0070676_10004652 3300005328 Bacteria 7249
4 Ga0070683_100013750 3300005329 Bacteria 7066
5 Ga0070690_100011599 3300005330 Bacteria 5159
6 Ga0068869_100002578 3300005334 Bacteria 10941
7 Ga0070666_10006128 3300005335 Bacteria 7391
8 Ga0070680_100290933 3300005336 Bacteria 1385
9 Ga0070682_100018867 3300005337 Bacteria 4039
10 Ga0068868_100001188 3300005338 Bacteria 17852
11 Ga0070660_100023645 3300005339 Bacteria 4554
12 Ga0070668_100000350 3300005347 Bacteria 30426
13 Ga0070668_100089457 3300005347 Bacteria 2425
14 Ga0070669_100001054 3300005353 Bacteria 20175
15 Ga0070669_100008985 3300005353 Bacteria 7130
16 Ga0070675_100145174 3300005354 Bacteria 2031
17 Ga0070675_100279362 3300005354 Bacteria 1467
18 Ga0070671_100047709 3300005355 Bacteria 3561
19 Ga0070674_100000230 3300005356 Bacteria 27567
20 Ga0070667_100000073 3300005367 Bacteria 122757
21 Ga0070667_100003939 3300005367 Bacteria 12612
22 Ga0070667_100259891 3300005367 Bacteria 1554
23 Ga0070709_10131033 3300005434 Bacteria 1712
24 Ga0070714_100086280 3300005435 Bacteria 2743
25 Ga0070713_100001021 3300005436 Bacteria 17922
26 Ga0070713_100276777 3300005436 Bacteria 1538
27 Ga0070710_10000364 3300005437 Bacteria 21235
28 Ga0070710_10000886 3300005437 Bacteria 14310
29 Ga0070710_10080084 3300005437 Bacteria 1905
30 Ga0070701_10000140 3300005438 Bacteria 21847
31 Ga0070711_100000378 3300005439 Bacteria 22952
32 Ga0070700_100016239 3300005441 Bacteria 4239
33 Ga0070694_100038321 3300005444 Bacteria 3185
34 Ga0070708_100001566 3300005445 Bacteria 17536
35 Ga0070663_100192901 3300005455 Bacteria 1586
36 Ga0070678_100000472 3300005456 Bacteria 19253
37 Ga0070662_100005668 3300005457 Bacteria 7992
38 Ga0070662_100326684 3300005457 Bacteria 1252
39 Ga0068867_100003092 3300005459 Bacteria 11730
40 Ga0070685_10012084 3300005466 Bacteria 4528
41 Ga0070706_100174980 3300005467 Bacteria 2004
42 Ga0070707_100016296 3300005468 Bacteria 6976
43 Ga0068853_100026344 3300005539 Bacteria 4882
44 Ga0070686_100184349 3300005544 Bacteria 1485
45 Ga0070695_100015029 3300005545 Bacteria 4671
46 Ga0070695_100342058 3300005545 Bacteria 1118
47 Ga0070696_100003108 3300005546 Bacteria 11044
48 Ga0070696_100229884 3300005546 Bacteria 1395
49 Ga0070693_100000529 3300005547 Bacteria 17162
50 Ga0070665_100016973 3300005548 Bacteria 7299
51 Ga0070704_100000434 3300005549 Bacteria 19572
52 Ga0068855_100010826 3300005563 Bacteria 11014
53 Ga0068854_100001164 3300005578 Bacteria 15767
54 Ga0068856_100296189 3300005614 Bacteria 1635
55 Ga0070702_100000437 3300005615 Bacteria 14845
56 Ga0068859_100000755 3300005617 Bacteria 32628
57 Ga0068859_100001171 3300005617 Bacteria 26821
58 Ga0068866_10000175 3300005718 Bacteria 29959
59 Ga0068861_100000566 3300005719 Bacteria 21970
60 Ga0068851_10070359 3300005834 Bacteria 1809
61 Ga0068863_100000644 3300005841 Bacteria 35359
62 Ga0068863_100060683 3300005841 Bacteria 3576
63 Ga0068863_100165081 3300005841 Bacteria 2123
64 Ga0068858_100000340 3300005842 Bacteria 49532
65 Ga0068858_100153037 3300005842 Bacteria 2169
66 Ga0068858_100180135 3300005842 Bacteria 1995
67 Ga0068860_100000127 3300005843 Bacteria 122766
68 Ga0068860_100003040 3300005843 Bacteria 17319
69 Ga0068860_100007471 3300005843 Bacteria 10932
70 Ga0068862_100000052 3300005844 Bacteria 144622
71 Ga0081455_10002624 3300005937 Bacteria 21310
72 Ga0081455_10062070 3300005937 Bacteria 3142
73 Ga0081539_10076926 3300005985 Bacteria 1766
74 Ga0070717_10006838 3300006028 Bacteria 8417
75 Ga0075365_10000897 3300006038 Bacteria 12475
76 Ga0075365_10011950 3300006038 Bacteria 5130
77 Ga0075365_10018936 3300006038 Bacteria 4240
78 Ga0075365_10046741 3300006038 Bacteria 2843
79 Ga0075365_10180942 3300006038 Bacteria 1474
80 Ga0075368_10000066 3300006042 Bacteria 25572
81 Ga0075368_10008425 3300006042 Bacteria 3672
82 Ga0075368_10025106 3300006042 Bacteria 2286
83 Ga0075363_100000098 3300006048 Bacteria 19315
84 Ga0075363_100001217 3300006048 Bacteria 9515
85 Ga0075363_100001985 3300006048 Bacteria 8138
86 Ga0075363_100002063 3300006048 Bacteria 8033
87 Ga0075363_100002537 3300006048 Bacteria 7490
88 Ga0075363_100028337 3300006048 Bacteria 2879
89 Ga0075363_100137817 3300006048 Bacteria 1372
90 Ga0075364_10000301 3300006051 Bacteria 24078
91 Ga0075364_10007345 3300006051 Bacteria 6540
92 Ga0070712_100077614 3300006175 Bacteria 2394
93 Ga0075362_10000035 3300006177 Bacteria 49510
94 Ga0075362_10001376 3300006177 Bacteria 7712
95 Ga0075367_10004179 3300006178 Bacteria 7007
96 Ga0075367_10029425 3300006178 Bacteria 3141
97 Ga0075367_10186614 3300006178 Bacteria 1293
98 Ga0075369_10000107 3300006186 Bacteria 22435
99 Ga0075369_10002105 3300006186 Bacteria 7033
100 Ga0075369_10003948 3300006186 Bacteria 5438
101 Ga0075369_10004324 3300006186 Bacteria 5240
102 Ga0075366_10000013 3300006195 Bacteria 71214
103 Ga0075366_10057173 3300006195 Bacteria 2318
104 Ga0097621_100004868 3300006237 Bacteria 9411
105 Ga0075370_10000014 3300006353 Bacteria 62859
106 Ga0075370_10187275 3300006353 Bacteria 1219
107 Ga0068871_100048189 3300006358 Bacteria 3438
108 Ga0075428_100001695 3300006844 Bacteria 23510
109 Ga0075430_100000789 3300006846 Bacteria 24524
110 Ga0075430_100079307 3300006846 Bacteria 2752
111 Ga0075431_100050742 3300006847 Bacteria 4277
112 Ga0075429_100004188 3300006880 Bacteria 12351
113 Ga0075429_100231923 3300006880 Bacteria 1617
114 Ga0068865_100000274 3300006881 Bacteria 28350
115 Ga0097620_100000755 3300006931 Bacteria 32628
116 Ga0097620_100001171 3300006931 Bacteria 26821
117 Ga0099795_10065342 3300007788 Bacteria 1360
118 Ga0105245_10000714 3300009098 Bacteria 29897
119 Ga0105245_10166133 3300009098 Bacteria 2098
120 Ga0105247_10000066 3300009101 Bacteria 121025
121 Ga0105247_10012765 3300009101 Bacteria 5043
122 Ga0114129_10088989 3300009147 Bacteria 4280
123 Ga0105243_10003574 3300009148 Bacteria 12551
124 Ga0105241_10049717 3300009174 Bacteria 3194
125 Ga0105242_10000182 3300009176 Bacteria 47986
126 Ga0105248_10000144 3300009177 Bacteria 81953
127 Ga0105248_10034352 3300009177 Bacteria 5670
128 Ga0105238_10077101 3300009551 Bacteria 3325
129 Ga0105249_10000093 3300009553 Bacteria 122840
130 Ga0105249_10000534 3300009553 Bacteria 35070
131 Ga0105239_10005122 3300010375 Bacteria 15470
132 Ga0157369_10233298 3300013105 Bacteria 1923
133 Ga0157374_10301736 3300013296 Bacteria 1585
134 Ga0157378_10000481 3300013297 Bacteria 37930
135 Ga0157378_10257266 3300013297 Bacteria 1674
136 Ga0163162_10003622 3300013306 Bacteria 14806
137 Ga0157372_10003692 3300013307 Bacteria 16450
138 Ga0157375_10000354 3300013308 Bacteria 41651
139 Ga0157380_10000407 3300014326 Bacteria 26081
140 Ga0157380_10100318 3300014326 Bacteria 2410
141 Ga0157379_10001954 3300014968 Bacteria 17047
142 Ga0163161_10001388 3300017792 Bacteria 17863
143 Ga0213876_10000247 3300021384 Bacteria 51664
144 Ga0213876_10001545 3300021384 Bacteria 14169
145 Ga0213876_10022416 3300021384 Bacteria 3339
146 Ga0207692_10003941 3300025898 Bacteria 5828
147 Ga0207692_10016037 3300025898 Bacteria 3308
148 Ga0207692_10095099 3300025898 Bacteria 1624
149 Ga0207710_10000090 3300025900 Bacteria 121405
150 Ga0207710_10005710 3300025900 Bacteria 5344
151 Ga0207688_10000081 3300025901 Bacteria 36211
152 Ga0207680_10013260 3300025903 Bacteria 4228
153 Ga0207647_10044394 3300025904 Bacteria 2778
154 Ga0207685_10036895 3300025905 Bacteria 1796
155 Ga0207699_10020790 3300025906 Bacteria 3525
156 Ga0207699_10030324 3300025906 Bacteria 3025
157 Ga0207645_10027299 3300025907 Bacteria 3688
158 Ga0207654_10053894 3300025911 Bacteria 2323
159 Ga0207693_10000292 3300025915 Bacteria 46487
160 Ga0207693_10089354 3300025915 Bacteria 2414
161 Ga0207663_10010963 3300025916 Bacteria 4845
162 Ga0207663_10031722 3300025916 Bacteria 3130
163 Ga0207657_10108273 3300025919 Bacteria 2297
164 Ga0207646_10076886 3300025922 Bacteria 2984
165 Ga0207681_10000310 3300025923 Bacteria 35683
166 Ga0207681_10309558 3300025923 Bacteria 1252
167 Ga0207687_10011337 3300025927 Bacteria 5826
168 Ga0207687_10106913 3300025927 Bacteria 2069
169 Ga0207700_10189783 3300025928 Bacteria 1726
170 Ga0207664_10001822 3300025929 Bacteria 14046
171 Ga0207664_10114162 3300025929 Bacteria 2250
172 Ga0207706_10010998 3300025933 Bacteria 8250
173 Ga0207686_10002286 3300025934 Bacteria 10503
174 Ga0207709_10013998 3300025935 Bacteria 4428
175 Ga0207669_10004679 3300025937 Bacteria 6052
176 Ga0207704_10005771 3300025938 Bacteria 5724
177 Ga0207665_10028070 3300025939 Bacteria 3717
178 Ga0207665_10132898 3300025939 Bacteria 1768
179 Ga0207711_10002018 3300025941 Bacteria 18365
180 Ga0207711_10032178 3300025941 Bacteria 4434
181 Ga0207689_10006568 3300025942 Bacteria 10254
182 Ga0207712_10000073 3300025961 Bacteria 123046
183 Ga0207712_10056848 3300025961 Bacteria 2758
184 Ga0207668_10008469 3300025972 Bacteria 6132
185 Ga0207640_10000732 3300025981 Bacteria 18897
186 Ga0207658_10000438 3300025986 Bacteria 39371
187 Ga0207658_10040118 3300025986 Bacteria 3382
188 Ga0207658_10136681 3300025986 Bacteria 1978
189 Ga0207677_10000558 3300026023 Bacteria 23566
190 Ga0207703_10005228 3300026035 Bacteria 10483
191 Ga0207703_10046675 3300026035 Bacteria 3489
192 Ga0207639_10041172 3300026041 Bacteria 3454
193 Ga0207708_10005181 3300026075 Bacteria 9616
194 Ga0207641_10005863 3300026088 Bacteria 10424
195 Ga0207641_10220333 3300026088 Bacteria 1759
196 Ga0207641_10461499 3300026088 Bacteria 1229
197 Ga0207648_10000187 3300026089 Bacteria 65094
198 Ga0207675_100000390 3300026118 Bacteria 42092
199 Ga0207675_100176954 3300026118 Bacteria 2041
200 Ga0207683_10000502 3300026121 Bacteria 36110
201 Ga0209813_10000142 3300027866 Bacteria 25031
202 Ga0209813_10000199 3300027866 Bacteria 18582
203 Ga0209813_10013025 3300027866 Bacteria 2212
204 Ga0268266_10004888 3300028379 Bacteria 12712
205 Ga0268266_10023631 3300028379 Bacteria 5232
206 Ga0268265_10000063 3300028380 Bacteria 144643
207 Ga0268265_10046536 3300028380 Bacteria 3244
208 Ga0268264_10000007 3300028381 Bacteria 815790
209 Ga0268264_10025559 3300028381 Bacteria 4825
210 Ga0307410_10001099 3300031852 Bacteria 11807
211 Ga0316574_0050683 3300035398 Bacteria 2585
212 Ga0373931_0030766 3300035691 Bacteria 2766
213 Ga0373931_0094181 3300035691 Bacteria 1674
214 Ga0373931_0206151 3300035691 Bacteria 1177
215 Ga0436364_0826064 3300037853 Bacteria 1419
216 Ga0436365_0170799 3300039437 Bacteria 19768
217 Ga0436365_0721647 3300039437 Bacteria 32349
218 Ga0436365_1083994 3300039437 Bacteria 225582
219 Ga0436365_1183994 3300039437 Bacteria 11616
220 Ga0466967_0057380 3300045976 Bacteria 3437
221 Ga0466967_0225465 3300045976 Bacteria 1782
222 Ga0495592_0030893 3300046454 Bacteria 4052
223 Ga0495638_0082530 3300046460 Bacteria 1949
224 Ga0495638_0171923 3300046460 Bacteria 1242
225 Ga0495653_0016690 3300046463 Bacteria 5976
226 Ga0495582_0119885 3300046473 Unclassified 1482
227 Ga0495664_0211999 3300046477 Bacteria 1173
228 Ga0495608_0116940 3300046511 Bacteria 1711
229 Ga0495610_0093354 3300046512 Unclassified 1360
230 Ga0495618_0013842 3300046514 Bacteria 4910
231 Ga0495618_0203389 3300046514 Bacteria 1253
232 Ga0495628_0007564 3300046516 Bacteria 9396
233 Ga0495628_0024701 3300046516 Bacteria 4915
234 Ga0495630_0048626 3300046517 Bacteria 3174
235 Ga0495631_0024283 3300046518 Unclassified 2799
236 Ga0495666_0051028 3300046526 Bacteria 1988
237 Ga0495640_0062674 3300046533 Bacteria 2521
238 Ga0495597_0059928 3300046542 Bacteria 1661
239 Ga0495622_0011702 3300046557 Bacteria 4056
240 Ga0495622_0021036 3300046557 Bacteria 3039
241 Ga0495667_0034295 3300046559 Bacteria 3394
242 Ga0495634_0003593 3300046642 Bacteria 12389
243 Ga0495611_0106066 3300046648 Bacteria 1307
244 Ga0495625_0131127 3300046660 Unclassified 1698
245 Ga0495635_0096484 3300046663 Bacteria 2021
246 Ga0495657_0069382 3300046675 Bacteria 2307
247 Ga0495658_0089755 3300046683 Bacteria 1818
248 Ga0495613_0003048 3300046689 Bacteria 12531
249 Ga0495613_0172599 3300046689 Bacteria 1534
250 Ga0495589_0105097 3300046794 Bacteria 1365
251 Ga0495604_0068379 3300047317 Bacteria 2696
252 Ga0495674_0070545 3300047319 Bacteria 3019
253 Ga0495672_0111557 3300047320 Bacteria 1467
254 Ga0495680_0056106 3300047322 Bacteria 3051
255 Ga0495675_0127258 3300047444 Bacteria 1585
256 Ga0495684_0067960 3300047471 Bacteria 2710
257 Ga0495593_0053540 3300047673 Bacteria 2130
258 Ga0496100_0036843 3300048903 Bacteria 3088
259 Ga0496100_0121586 3300048903 Bacteria 1827
260 Ga0496101_0010467 3300048904 Bacteria 6124
261 Ga0496101_0028568 3300048904 Bacteria 3894
262 Ga0496101_0048029 3300048904 Bacteria 3066
263 Ga0496102_0000547 3300048905 Bacteria 40570
264 Ga0496102_0000810 3300048905 Bacteria 30460
265 Ga0496102_0009132 3300048905 Bacteria 8505
266 Ga0496103_0002153 3300048906 Bacteria 12518
267 Ga0496103_0002817 3300048906 Bacteria 10821
268 Ga0496104_0198075 3300048907 Bacteria 1920
269 Ga0496105_0020395 3300048908 Bacteria 5356
270 Ga0496106_0004352 3300048909 Bacteria 10520
271 Ga0496106_0017327 3300048909 Bacteria 5332
272 Ga0496107_0000176 3300048910 Bacteria 33077
273 Ga0496107_0014799 3300048910 Bacteria 5460
274 Ga0496107_0016075 3300048910 Bacteria 5251
275 Ga0496108_0246358 3300048911 Bacteria 1554
276 Ga0496114_0003004 3300048917 Bacteria 12935
277 Ga0496115_0002629 3300048918 Bacteria 12897
278 Ga0496115_0003772 3300048918 Bacteria 10892
279 Ga0496117_0000197 3300048920 Bacteria 118822
280 Ga0496117_0024840 3300048920 Bacteria 4724
281 Ga0496118_0000171 3300048921 Bacteria 117495
282 Ga0496118_0001025 3300048921 Bacteria 43475
283 Ga0496119_0003827 3300048922 Bacteria 15369
284 Ga0496120_0008602 3300048923 Bacteria 7376
285 Ga0496121_0002746 3300048924 Bacteria 26176
286 Ga0496124_0045973 3300048927 Bacteria 3740
287 Ga0496125_0024501 3300048928 Bacteria 5548
288 Ga0496126_0003402 3300048929 Bacteria 20109
289 Ga0496126_0020144 3300048929 Bacteria 6548
290 Ga0501032_0008257 3300049569 Bacteria 7590
291 Ga0501033_0020680 3300049570 Bacteria 4973
292 Ga0501034_0002703 3300049571 Bacteria 20882
293 Ga0501037_0038940 3300049573 Bacteria 3501
294 Ga0501043_0091125 3300049579 Bacteria 2397
295 Ga0501046_0001987 3300049580 Bacteria 19428
296 Ga0501047_0093403 3300049581 Bacteria 2887
297 Ga0501048_0002292 3300049582 Bacteria 14603
298 Ga0501070_0002604 3300049586 Bacteria 15762
299 Ga0501080_0291689 3300049742 Bacteria 1481
300 Ga0501035_0003484 3300049822 Bacteria 15052
301 Ga0501035_0228773 3300049822 Bacteria 1585
302 nmdc:mga03683_115_c1 3300050489 Bacteria 27616
303 nmdc:mga03683_267_c1 3300050489 Bacteria 16026
304 nmdc:mga03683_31856_c1 3300050489 Bacteria 2117
305 nmdc:mga03n38_147949_c1 3300050490 Bacteria 1179
306 nmdc:mga03n38_17135_c1 3300050490 Bacteria 2832
307 nmdc:mga03n38_17504_c1 3300050490 Unclassified 2808
308 nmdc:mga03n38_2119_c1 3300050490 Bacteria 6025
309 nmdc:mga03n38_67550_c1 3300050490 Bacteria 1645
310 nmdc:mga03n38_9717_c1 3300050490 Bacteria 3509
311 nmdc:mga00v17_1849_c1 3300050491 Bacteria 10936
312 nmdc:mga00v17_21947_c1 3300050491 Bacteria 3678
313 nmdc:mga00v17_721_c1 3300050491 Bacteria 18067
314 nmdc:mga0yw44_116850_c1 3300050492 Bacteria 1715
315 nmdc:mga0yw44_146847_c1 3300050492 Bacteria 1536
316 nmdc:mga0yw44_14983_c1 3300050492 Bacteria 4137
317 nmdc:mga0yw44_46388_c1 3300050492 Bacteria 2609
318 nmdc:mga0yw44_7098_c1 3300050492 Bacteria 5482
319 nmdc:mga0yw44_81618_c1 3300050492 Bacteria 2027
320 nmdc:mga0yw44_8321_c1 3300050492 Bacteria 5157
321 nmdc:mga0k408_157978_c1 3300050493 Bacteria 1351
322 nmdc:mga0k408_172158_c1 3300050493 Bacteria 1291
323 nmdc:mga0k408_4_c1 3300050493 Bacteria 239080
324 nmdc:mga0k408_51092_c1 3300050493 Unclassified 2394
325 nmdc:mga06z11_218_c1 3300050494 Bacteria 22852
326 nmdc:mga06z11_39_c1 3300050494 Bacteria 54540
327 nmdc:mga04h51_590_c1 3300050495 Bacteria 8657
328 nmdc:mga04h51_76_c1 3300050495 Bacteria 31783
329 nmdc:mga07m45_13248_c1 3300050496 Bacteria 4371
330 nmdc:mga07m45_20091_c1 3300050496 Bacteria 3625
331 nmdc:mga07m45_2_c1 3300050496 Bacteria 451154
332 nmdc:mga07m45_361_c1 3300050496 Bacteria 5270
333 nmdc:mga07m45_38_c1 3300050496 Bacteria 65235
334 nmdc:mga07m45_7_c1 3300050496 Bacteria 223540
335 nmdc:mga07m45_971_c1 3300050496 Bacteria 12619
336 nmdc:mga05p37_202149_c1 3300050507 Bacteria 2405
337 nmdc:mga05p37_268448_c1 3300050507 Bacteria 2040
338 nmdc:mga05p37_79823_c1 3300050507 Bacteria 4029
339 nmdc:mga09592_105997_c1 3300050508 Bacteria 2411
340 nmdc:mga09592_3137_c1 3300050508 Bacteria 13420
341 nmdc:mga0qj67_183524_c1 3300050509 Bacteria 1700
342 nmdc:mga0qj67_51577_c1 3300050509 Bacteria 3253
343 nmdc:mga0qj67_725_c1 3300050509 Bacteria 22437
344 nmdc:mga0n895_575655_c1 3300050512 Bacteria 1130
345 nmdc:mga0sz30_1082_c1 3300050516 Bacteria 9793
346 nmdc:mga0sz30_1121_c1 3300050516 Bacteria 9615
347 nmdc:mga0sz30_386_c1 3300050516 Bacteria 16779
348 nmdc:mga0sz30_85_c1 3300050516 Bacteria 36243
349 Ga0500635_0000218 3300053080 Bacteria 26828
350 Ga0495595_0012987 3300053084 Bacteria 3514
351 Ga0495619_0081658 3300053085 Bacteria 2177
352 Ga0495619_0114942 3300053085 Bacteria 1841
353 Ga0500647_0059215 3300053091 Bacteria 1842
354 Ga0500583_0004471 3300053092 Bacteria 4566
355 Ga0500651_0010184 3300053093 Bacteria 5625
356 Ga0500641_0007350 3300053096 Unclassified 3926
357 Ga0500555_002355 3300053103 Bacteria 5500
358 Ga0500556_0001777 3300053104 Bacteria 8033
359 Ga0500562_007073 3300053108 Bacteria 2831
360 Ga0500595_008118 3300053119 Bacteria 4308
361 Ga0500607_000098 3300053121 Bacteria 65919
362 Ga0500608_000166 3300053122 Bacteria 27116
363 Ga0500608_001199 3300053122 Bacteria 9265
364 Ga0500618_003106 3300053125 Bacteria 5862
365 Ga0500642_0001666 3300053130 Bacteria 6426
366 Ga0500642_0111664 3300053130 Bacteria 1277
367 Ga0500655_000101 3300053133 Bacteria 22264
368 Ga0500559_0050735 3300053136 Bacteria 1831
369 Ga0500564_001019 3300053138 Bacteria 9176
370 Ga0500568_0080015 3300053139 Bacteria 1241
371 Ga0500590_025054 3300053148 Bacteria 3097
372 Ga0500616_0019025 3300053153 Bacteria 3878
373 Ga0500616_0112879 3300053153 Bacteria 1310
374 Ga0500622_0002599 3300053156 Bacteria 12868
375 Ga0500638_060266 3300053162 Bacteria 1825
376 Ga0500639_038985 3300053163 Unclassified 2502
377 Ga0500636_0011499 3300053177 Bacteria 5181
378 Ga0500636_0033783 3300053177 Plasmid 3027
379 Ga0500636_0054889 3300053177 Bacteria 2335
380 Ga0500637_0017314 3300053178 Bacteria 3856
381 Ga0500637_0018171 3300053178 Bacteria 3773
382 Ga0500567_000823 3300053723 Bacteria 11711
383 Ga0500570_000029 3300053724 Bacteria 35078
384 Ga0500625_000005 3300053729 Bacteria 209509
385 Ga0500645_000075 3300053730 Bacteria 78736
386 2585261863 2582581305 Bacteria 4895574
387 2738706000 2738541274 Bacteria 6909446
388 2738892876 2738541308 Bacteria 7020677
389 2738893059 2738541308 Bacteria 7020677
390 2739333100 2738543028 Bacteria 6917070
391 2739651358 2739367664 Bacteria 4114334
392 2740029831 2739367865 Bacteria 4114482
393 2842137878 2842134933 Bacteria 5847019
394 2939587634 2939582691 Bacteria 7088898
395 Ga0496126_0011592
396 JGI24742J22300_10000312
397 Ga0070676_10004652
398 Ga0070683_100013750
399 Ga0070690_100011599
400 Ga0068869_100002578
401 Ga0070666_10006128
402 Ga0070680_100290933
403 Ga0070682_100018867
404 Ga0068868_100001188
405 Ga0070660_100023645
406 Ga0070668_100000350
407 Ga0070668_100089457
408 Ga0070669_100001054
409 Ga0070669_100008985
410 Ga0070675_100145174
411 Ga0070675_100279362
412 Ga0070671_100047709
413 Ga0070674_100000230
414 Ga0070667_100000073
415 Ga0070667_100003939
416 Ga0070667_100259891
417 Ga0070709_10131033
418 Ga0070714_100086280
419 Ga0070713_100001021
420 Ga0070713_100276777
421 Ga0070710_10000364
422 Ga0070710_10000886
423 Ga0070710_10080084
424 Ga0070701_10000140
425 Ga0070711_100000378
426 Ga0070700_100016239
427 Ga0070694_100038321
428 Ga0070708_100001566
429 Ga0070663_100192901
430 Ga0070678_100000472
431 Ga0070662_100005668
432 Ga0070662_100326684
433 Ga0068867_100003092
434 Ga0070685_10012084
435 Ga0070706_100174980
436 Ga0070707_100016296
437 Ga0068853_100026344
438 Ga0070686_100184349
439 Ga0070695_100015029
440 Ga0070695_100342058
441 Ga0070696_100003108
442 Ga0070696_100229884
443 Ga0070693_100000529
444 Ga0070665_100016973
445 Ga0070704_100000434
446 Ga0068855_100010826
447 Ga0068854_100001164
448 Ga0068856_100296189
449 Ga0070702_100000437
450 Ga0068859_100000755
451 Ga0068859_100001171
452 Ga0068866_10000175
453 Ga0068861_100000566
454 Ga0068851_10070359
455 Ga0068863_100000644
456 Ga0068863_100060683
457 Ga0068863_100165081
458 Ga0068858_100000340
459 Ga0068858_100153037
460 Ga0068858_100180135
461 Ga0068860_100000127
462 Ga0068860_100003040
463 Ga0068860_100007471
464 Ga0068862_100000052
465 Ga0081455_10002624
466 Ga0081455_10062070
467 Ga0081539_10076926
468 Ga0070717_10006838
469 Ga0075365_10000897
470 Ga0075365_10011950
471 Ga0075365_10018936
472 Ga0075365_10046741
473 Ga0075365_10180942
474 Ga0075368_10000066
475 Ga0075368_10008425
476 Ga0075368_10025106
477 Ga0075363_100000098
478 Ga0075363_100001217
479 Ga0075363_100001985
480 Ga0075363_100002063
481 Ga0075363_100002537
482 Ga0075363_100028337
483 Ga0075363_100137817
484 Ga0075364_10000301
485 Ga0075364_10007345
486 Ga0070712_100077614
487 Ga0075362_10000035
488 Ga0075362_10001376
489 Ga0075367_10004179
490 Ga0075367_10029425
491 Ga0075367_10186614
492 Ga0075369_10000107
493 Ga0075369_10002105
494 Ga0075369_10003948
495 Ga0075369_10004324
496 Ga0075366_10000013
497 Ga0075366_10057173
498 Ga0097621_100004868
499 Ga0075370_10000014
500 Ga0075370_10187275
501 Ga0068871_100048189
502 Ga0075428_100001695
503 Ga0075430_100000789
504 Ga0075430_100079307
505 Ga0075431_100050742
506 Ga0075429_100004188
507 Ga0075429_100231923
508 Ga0068865_100000274
509 Ga0097620_100000755
510 Ga0097620_100001171
511 Ga0099795_10065342
512 Ga0105245_10000714
513 Ga0105245_10166133
514 Ga0105247_10000066
515 Ga0105247_10012765
516 Ga0114129_10088989
517 Ga0105243_10003574
518 Ga0105241_10049717
519 Ga0105242_10000182
520 Ga0105248_10000144
521 Ga0105248_10034352
522 Ga0105238_10077101
523 Ga0105249_10000093
524 Ga0105249_10000534
525 Ga0105239_10005122
526 Ga0157369_10233298
527 Ga0157374_10301736
528 Ga0157378_10000481
529 Ga0157378_10257266
530 Ga0163162_10003622
531 Ga0157372_10003692
532 Ga0157375_10000354
533 Ga0157380_10000407
534 Ga0157380_10100318
535 Ga0157379_10001954
536 Ga0163161_10001388
537 Ga0213876_10000247
538 Ga0213876_10001545
539 Ga0213876_10022416
540 Ga0207692_10003941
541 Ga0207692_10016037
542 Ga0207692_10095099
543 Ga0207710_10000090
544 Ga0207710_10005710
545 Ga0207688_10000081
546 Ga0207680_10013260
547 Ga0207647_10044394
548 Ga0207685_10036895
549 Ga0207699_10020790
550 Ga0207699_10030324
551 Ga0207645_10027299
552 Ga0207654_10053894
553 Ga0207693_10000292
554 Ga0207693_10089354
555 Ga0207663_10010963
556 Ga0207663_10031722
557 Ga0207657_10108273
558 Ga0207646_10076886
559 Ga0207681_10000310
560 Ga0207681_10309558
561 Ga0207687_10011337
562 Ga0207687_10106913
563 Ga0207700_10189783
564 Ga0207664_10001822
565 Ga0207664_10114162
566 Ga0207706_10010998
567 Ga0207686_10002286
568 Ga0207709_10013998
569 Ga0207669_10004679
570 Ga0207704_10005771
571 Ga0207665_10028070
572 Ga0207665_10132898
573 Ga0207711_10002018
574 Ga0207711_10032178
575 Ga0207689_10006568
576 Ga0207712_10000073
577 Ga0207712_10056848
578 Ga0207668_10008469
579 Ga0207640_10000732
580 Ga0207658_10000438
581 Ga0207658_10040118
582 Ga0207658_10136681
583 Ga0207677_10000558
584 Ga0207703_10005228
585 Ga0207703_10046675
586 Ga0207639_10041172
587 Ga0207708_10005181
588 Ga0207641_10005863
589 Ga0207641_10220333
590 Ga0207641_10461499
591 Ga0207648_10000187
592 Ga0207675_100000390
593 Ga0207675_100176954
594 Ga0207683_10000502
595 Ga0209813_10000142
596 Ga0209813_10000199
597 Ga0209813_10013025
598 Ga0268266_10004888
599 Ga0268266_10023631
600 Ga0268265_10000063
601 Ga0268265_10046536
602 Ga0268264_10000007
603 Ga0268264_10025559
604 Ga0307410_10001099
605 Ga0316574_0050683
606 Ga0373931_0030766
607 Ga0373931_0094181
608 Ga0373931_0206151
609 Ga0436364_0826064
610 Ga0436365_0170799
611 Ga0436365_0721647
612 Ga0436365_1083994
613 Ga0436365_1183994
614 Ga0466967_0057380
615 Ga0466967_0225465
616 Ga0495592_0030893
617 Ga0495638_0082530
618 Ga0495638_0171923
619 Ga0495653_0016690
620 Ga0495582_0119885
621 Ga0495664_0211999
622 Ga0495608_0116940
623 Ga0495610_0093354
624 Ga0495618_0013842
625 Ga0495618_0203389
626 Ga0495628_0007564
627 Ga0495628_0024701
628 Ga0495630_0048626
629 Ga0495631_0024283
630 Ga0495666_0051028
631 Ga0495640_0062674
632 Ga0495597_0059928
633 Ga0495622_0011702
634 Ga0495622_0021036
635 Ga0495667_0034295
636 Ga0495634_0003593
637 Ga0495611_0106066
638 Ga0495625_0131127
639 Ga0495635_0096484
640 Ga0495657_0069382
641 Ga0495658_0089755
642 Ga0495613_0003048
643 Ga0495613_0172599
644 Ga0495589_0105097
645 Ga0495604_0068379
646 Ga0495674_0070545
647 Ga0495672_0111557
648 Ga0495680_0056106
649 Ga0495675_0127258
650 Ga0495684_0067960
651 Ga0495593_0053540
652 Ga0496100_0036843
653 Ga0496100_0121586
654 Ga0496101_0010467
655 Ga0496101_0028568
656 Ga0496101_0048029
657 Ga0496102_0000547
658 Ga0496102_0000810
659 Ga0496102_0009132
660 Ga0496103_0002153
661 Ga0496103_0002817
662 Ga0496104_0198075
663 Ga0496105_0020395
664 Ga0496106_0004352
665 Ga0496106_0017327
666 Ga0496107_0000176
667 Ga0496107_0014799
668 Ga0496107_0016075
669 Ga0496108_0246358
670 Ga0496114_0003004
671 Ga0496115_0002629
672 Ga0496115_0003772
673 Ga0496117_0000197
674 Ga0496117_0024840
675 Ga0496118_0000171
676 Ga0496118_0001025
677 Ga0496119_0003827
678 Ga0496120_0008602
679 Ga0496121_0002746
680 Ga0496124_0045973
681 Ga0496125_0024501
682 Ga0496126_0003402
683 Ga0496126_0020144
684 Ga0501032_0008257
685 Ga0501033_0020680
686 Ga0501034_0002703
687 Ga0501037_0038940
688 Ga0501043_0091125
689 Ga0501046_0001987
690 Ga0501047_0093403
691 Ga0501048_0002292
692 Ga0501070_0002604
693 Ga0501080_0291689
694 Ga0501035_0003484
695 Ga0501035_0228773
696 nmdc:mga03683_115_c1
697 nmdc:mga03683_267_c1
698 nmdc:mga03683_31856_c1
699 nmdc:mga03n38_147949_c1
700 nmdc:mga03n38_17135_c1
701 nmdc:mga03n38_17504_c1
702 nmdc:mga03n38_2119_c1
703 nmdc:mga03n38_67550_c1
704 nmdc:mga03n38_9717_c1
705 nmdc:mga00v17_1849_c1
706 nmdc:mga00v17_21947_c1
707 nmdc:mga00v17_721_c1
708 nmdc:mga0yw44_116850_c1
709 nmdc:mga0yw44_146847_c1
710 nmdc:mga0yw44_14983_c1
711 nmdc:mga0yw44_46388_c1
712 nmdc:mga0yw44_7098_c1
713 nmdc:mga0yw44_81618_c1
714 nmdc:mga0yw44_8321_c1
715 nmdc:mga0k408_157978_c1
716 nmdc:mga0k408_172158_c1
717 nmdc:mga0k408_4_c1
718 nmdc:mga0k408_51092_c1
719 nmdc:mga06z11_218_c1
720 nmdc:mga06z11_39_c1
721 nmdc:mga04h51_590_c1
722 nmdc:mga04h51_76_c1
723 nmdc:mga07m45_13248_c1
724 nmdc:mga07m45_20091_c1
725 nmdc:mga07m45_2_c1
726 nmdc:mga07m45_361_c1
727 nmdc:mga07m45_38_c1
728 nmdc:mga07m45_7_c1
729 nmdc:mga07m45_971_c1
730 nmdc:mga05p37_202149_c1
731 nmdc:mga05p37_268448_c1
732 nmdc:mga05p37_79823_c1
733 nmdc:mga09592_105997_c1
734 nmdc:mga09592_3137_c1
735 nmdc:mga0qj67_183524_c1
736 nmdc:mga0qj67_51577_c1
737 nmdc:mga0qj67_725_c1
738 nmdc:mga0n895_575655_c1
739 nmdc:mga0sz30_1082_c1
740 nmdc:mga0sz30_1121_c1
741 nmdc:mga0sz30_386_c1
742 nmdc:mga0sz30_85_c1
743 Ga0500635_0000218
744 Ga0495595_0012987
745 Ga0495619_0081658
746 Ga0495619_0114942
747 Ga0500647_0059215
748 Ga0500583_0004471
749 Ga0500651_0010184
750 Ga0500641_0007350
751 Ga0500555_002355
752 Ga0500556_0001777
753 Ga0500562_007073
754 Ga0500595_008118
755 Ga0500607_000098
756 Ga0500608_000166
757 Ga0500608_001199
758 Ga0500618_003106
759 Ga0500642_0001666
760 Ga0500642_0111664
761 Ga0500655_000101
762 Ga0500559_0050735
763 Ga0500564_001019
764 Ga0500568_0080015
765 Ga0500590_025054
766 Ga0500616_0019025
767 Ga0500616_0112879
768 Ga0500622_0002599
769 Ga0500638_060266
770 Ga0500639_038985
771 Ga0500636_0011499
772 Ga0500636_0033783
773 Ga0500636_0054889
774 Ga0500637_0017314
775 Ga0500637_0018171
776 Ga0500567_000823
777 Ga0500570_000029
778 Ga0500625_000005
779 Ga0500645_000075
780 2585261863
781 2738706000
782 2738892876
783 2738893059
784 2739333100
785 2739651358
786 2740029831
787 2842137878
788 2939587634

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

45

247

0.91

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

51

282

0.86

PF08659

KR

KR domain

45

225

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1gz6-assembly1.cif.gz_B (3r)-hydroxyacyl-coa dehydrogenase fragment of rat peroxisomal multifunctional enzyme type 2 0.9552 8 311
1gz6-assembly2.cif.gz_C (3r)-hydroxyacyl-coa dehydrogenase fragment of rat peroxisomal multifunctional enzyme type 2 0.9527 8 311
1gz6-assembly2.cif.gz_D (3r)-hydroxyacyl-coa dehydrogenase fragment of rat peroxisomal multifunctional enzyme type 2 0.9495 8 311
1gz6-assembly2.cif.gz_C (3r)-hydroxyacyl-coa dehydrogenase fragment of rat peroxisomal multifunctional enzyme type 2 0.9366 8 311
7djs-assembly1.cif.gz_C crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with nad 0.9354 10 250
ID Description Score Start End Superfamily
1gz6A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9686 8 257 3.40.50.720
af_C6T421_12_106_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9637 10 96 3.40.50.720
af_P96825_7_283_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9629 13 296 3.40.50.720
af_P96825_7_283_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9561 13 296 3.40.50.720
1gz6A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9528 8 257 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A520Q9R5-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9901 8 170 GO:0016491
AF-A0A382JHL0-F1-model_v4 Short-chain dehydrogenase/reductase SDR 0.9861 10 139 GO:0016491
AF-X8ARF4-F1-model_v4 deleted 0.9781 125 314
AF-A0A2N0QKI9-F1-model_v4 NAD(P)-binding protein 0.9781 10 144 GO:0005829
GO:0009688
GO:0010301
AF-A0A7C4SFP5-F1-model_v4 SDR family oxidoreductase 0.973 9 203 GO:0016616
GO:0030497

Map