F433017

General Info

Members Datasets Scaffolds Average Seq Length
394 273 391 350

Family's Representative Sequence

Representative Sequence 3300048908|Ga0496105_0160360|Ga0496105_0160360_94_1233
Length 379
Sequence MPRIVRSRAGQVGRAARCHHHRRGMNETASANPILVEVMRGPIVESRHAGAIAVSDANGRLLVAFGDVERPIYPRSAVKAMQAIPLIESGGADAFDLNDDALAVACSSHSGDAVHLEAVRSLLAKARLDESYLACGAHWPVSEEMTRALMRAGRRPQPLHNNCSGKHAGMLAAAVALGLEPRGYEQPDHPLQVMIARIISETCGTALDRGRMGVDGCSVPTWAIPLSALARGFARLGNGEGLTPELTSAMRRLVAACFASPVLVAGDGRLDTVVMAALAPEIFMKGGAEGVHCAALPELGLGIALKIDDGAKRAAERALSEVLVALVPRAMHVLAAQLEGELLNWRGISIGRLTASAELQHAVATLAQDSGLQLNRAAQ

Samples

Sample ID Description Type Environment
1 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
2 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
112 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
113 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
166 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
167 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
168 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
169 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
170 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
171 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
172 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
173 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
174 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
175 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
176 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
177 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
178 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
179 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
183 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
184 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
185 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
186 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
187 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
188 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
189 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
190 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
191 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
192 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
193 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
194 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
195 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
196 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
197 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
198 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
199 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
200 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
201 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
202 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
203 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
204 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
205 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
206 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
207 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
210 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
211 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
212 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
213 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
214 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
215 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
216 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
217 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
218 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
219 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
222 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
223 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
224 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
225 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
226 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
227 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
228 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
229 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
230 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
231 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
244 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
245 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
246 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
247 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
248 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
249 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
250 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
251 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
252 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
253 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
254 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
255 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
256 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
257 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
260 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
261 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
262 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
263 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
264 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
265 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
266 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
267 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
268 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
269 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
270 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
271 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
272 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
273 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.24
Metatranscriptomes 0
Isolates 0.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.78
Nodule 0
Rhizoplane 7.61
Rhizosphere 89.34
Stem 0
Stem Tuber 0
Unclassified 1.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1004255 3300003214 Bacteria 3146
2 JGI25165J46597_1005490 3300003214 Bacteria 2431
3 Ga0070676_10125182 3300005328 Bacteria 1618
4 Ga0070683_100333614 3300005329 Bacteria 1444
5 Ga0070690_100002469 3300005330 Bacteria 9944
6 Ga0070670_100004802 3300005331 Bacteria 11346
7 Ga0070670_100010109 3300005331 Bacteria 8049
8 Ga0068869_100195670 3300005334 Bacteria 1592
9 Ga0070680_100002239 3300005336 Bacteria 14265
10 Ga0070680_100323615 3300005336 Unclassified 1309
11 Ga0070682_100000739 3300005337 Bacteria 19554
12 Ga0068868_100065451 3300005338 Bacteria 2888
13 Ga0070660_100004563 3300005339 Bacteria 9576
14 Ga0070689_100020546 3300005340 Bacteria 4902
15 Ga0070689_100021466 3300005340 Bacteria 4808
16 Ga0070691_10001230 3300005341 Bacteria 10786
17 Ga0070687_100041666 3300005343 Bacteria 2321
18 Ga0070661_100000594 3300005344 Bacteria 27156
19 Ga0070692_10000131 3300005345 Bacteria 17808
20 Ga0070668_100000672 3300005347 Bacteria 23195
21 Ga0070668_100056531 3300005347 Bacteria 3031
22 Ga0070669_100012818 3300005353 Bacteria 5953
23 Ga0070675_100031837 3300005354 Bacteria 4265
24 Ga0070675_100111107 3300005354 Bacteria 2319
25 Ga0070671_100004459 3300005355 Bacteria 11082
26 Ga0070671_100010916 3300005355 Bacteria 7295
27 Ga0070674_100000551 3300005356 Bacteria 18799
28 Ga0070673_100003383 3300005364 Bacteria 9924
29 Ga0070673_100006352 3300005364 Bacteria 7679
30 Ga0070688_100000261 3300005365 Bacteria 27517
31 Ga0070659_100311993 3300005366 Bacteria 1313
32 Ga0070667_100000309 3300005367 Bacteria 54617
33 Ga0070703_10001582 3300005406 Bacteria 6771
34 Ga0070709_10006269 3300005434 Bacteria 6477
35 Ga0070714_100004416 3300005435 Bacteria 10585
36 Ga0070713_100095651 3300005436 Bacteria 2563
37 Ga0070710_10001969 3300005437 Bacteria 9735
38 Ga0070701_10000109 3300005438 Bacteria 23593
39 Ga0070711_100001710 3300005439 Bacteria 12161
40 Ga0070705_100000306 3300005440 Bacteria 28990
41 Ga0070705_100177025 3300005440 Bacteria 1441
42 Ga0070700_100000858 3300005441 Bacteria 15009
43 Ga0070694_100000201 3300005444 Bacteria 31692
44 Ga0070663_100002080 3300005455 Bacteria 11187
45 Ga0070678_100000371 3300005456 Bacteria 20997
46 Ga0070662_100003173 3300005457 Bacteria 10217
47 Ga0070681_10063733 3300005458 Bacteria 3658
48 Ga0070685_10002693 3300005466 Bacteria 9095
49 Ga0070699_100183010 3300005518 Bacteria 1860
50 Ga0070697_100102878 3300005536 Bacteria 2374
51 Ga0068853_100008006 3300005539 Bacteria 8477
52 Ga0068853_100009809 3300005539 Bacteria 7727
53 Ga0070672_100009393 3300005543 Bacteria 6741
54 Ga0070686_100009433 3300005544 Bacteria 5487
55 Ga0070695_100002621 3300005545 Bacteria 10395
56 Ga0070696_100203668 3300005546 Bacteria 1478
57 Ga0070693_100000082 3300005547 Bacteria 39617
58 Ga0070665_100038317 3300005548 Bacteria 4819
59 Ga0070704_100004752 3300005549 Bacteria 7861
60 Ga0068855_100011575 3300005563 Bacteria 10655
61 Ga0068855_100046570 3300005563 Bacteria 5126
62 Ga0070664_100007238 3300005564 Bacteria 8949
63 Ga0068854_100001020 3300005578 Bacteria 16803
64 Ga0068856_100005453 3300005614 Bacteria 12532
65 Ga0070702_100005932 3300005615 Bacteria 5739
66 Ga0068852_100004381 3300005616 Bacteria 9976
67 Ga0068859_100017666 3300005617 Bacteria 7171
68 Ga0068859_100140464 3300005617 Bacteria 2489
69 Ga0068866_10001833 3300005718 Bacteria 8934
70 Ga0068861_100000793 3300005719 Bacteria 19034
71 Ga0068863_100008742 3300005841 Bacteria 9890
72 Ga0068858_100018181 3300005842 Bacteria 6584
73 Ga0068860_100008473 3300005843 Bacteria 10247
74 Ga0081455_10002618 3300005937 Bacteria 21329
75 Ga0081455_10003018 3300005937 Bacteria 19627
76 Ga0081455_10065441 3300005937 Bacteria 3040
77 Ga0081538_10032336 3300005981 Bacteria 3508
78 Ga0081540_1000140 3300005983 Bacteria 75770
79 Ga0081539_10063112 3300005985 Bacteria 2023
80 Ga0070717_10186107 3300006028 Bacteria 1812
81 Ga0075363_100052618 3300006048 Bacteria 2174
82 Ga0070715_10000268 3300006163 Bacteria 12528
83 Ga0070716_100000735 3300006173 Bacteria 13984
84 Ga0070712_100000481 3300006175 Bacteria 22814
85 Ga0070712_100049290 3300006175 Bacteria 2924
86 Ga0097621_100091657 3300006237 Bacteria 2544
87 Ga0075428_100046681 3300006844 Bacteria 4757
88 Ga0075428_100048450 3300006844 Bacteria 4664
89 Ga0075431_100024636 3300006847 Bacteria 6169
90 Ga0075433_10036517 3300006852 Bacteria 4234
91 Ga0075433_10053682 3300006852 Bacteria 3514
92 Ga0075434_100046032 3300006871 Bacteria 4329
93 Ga0075434_100092056 3300006871 Bacteria 3034
94 Ga0075434_100207542 3300006871 Bacteria 1980
95 Ga0075429_100012885 3300006880 Bacteria 7255
96 Ga0068865_100004493 3300006881 Bacteria 8421
97 Ga0068865_100052427 3300006881 Bacteria 2827
98 Ga0075436_100004532 3300006914 Bacteria 9523
99 Ga0097620_100017666 3300006931 Bacteria 7171
100 Ga0097620_100140467 3300006931 Bacteria 2489
101 Ga0075435_100038302 3300007076 Bacteria 3822
102 Ga0105250_10005576 3300009092 Bacteria 5629
103 Ga0105240_10010367 3300009093 Bacteria 13111
104 Ga0111539_10043059 3300009094 Bacteria 5416
105 Ga0111539_10184963 3300009094 Unclassified 2433
106 Ga0105245_10001377 3300009098 Bacteria 22006
107 Ga0105247_10025828 3300009101 Bacteria 3545
108 Ga0114129_10118426 3300009147 Bacteria 3648
109 Ga0114129_10252788 3300009147 Bacteria 2365
110 Ga0105243_10000688 3300009148 Bacteria 32874
111 Ga0105243_10143384 3300009148 Bacteria 2041
112 Ga0105241_10000949 3300009174 Bacteria 21950
113 Ga0105242_10026344 3300009176 Bacteria 4608
114 Ga0105248_10018034 3300009177 Bacteria 7791
115 Ga0105248_10085248 3300009177 Bacteria 3555
116 Ga0105237_10000091 3300009545 Bacteria 122477
117 Ga0105237_10001143 3300009545 Bacteria 35677
118 Ga0105238_10408840 3300009551 Bacteria 1351
119 Ga0105249_10002187 3300009553 Bacteria 16923
120 Ga0099796_10013354 3300010159 Bacteria 2344
121 Ga0105239_10000793 3300010375 Bacteria 44855
122 Ga0105246_10004905 3300011119 Bacteria 8153
123 Ga0157371_10002294 3300013102 Bacteria 18437
124 Ga0157369_10006075 3300013105 Bacteria 14017
125 Ga0157374_10007065 3300013296 Bacteria 9559
126 Ga0157378_10001300 3300013297 Bacteria 22460
127 Ga0157378_10011799 3300013297 Bacteria 7651
128 Ga0163162_10009653 3300013306 Bacteria 9384
129 Ga0157372_10009779 3300013307 Bacteria 10199
130 Ga0157372_10232035 3300013307 Bacteria 2140
131 Ga0157375_10030328 3300013308 Bacteria 5098
132 Ga0157375_10183121 3300013308 Bacteria 2247
133 Ga0163163_10001334 3300014325 Bacteria 20814
134 Ga0163163_10127423 3300014325 Bacteria 2584
135 Ga0157380_10000175 3300014326 Bacteria 37121
136 Ga0157380_10135374 3300014326 Bacteria 2108
137 Ga0157377_10000263 3300014745 Bacteria 25807
138 Ga0157379_10028495 3300014968 Bacteria 4967
139 Ga0157379_10039780 3300014968 Bacteria 4195
140 Ga0157379_10075177 3300014968 Bacteria 3024
141 Ga0157376_10000424 3300014969 Bacteria 27368
142 Ga0228598_1006331 3300024227 Bacteria 2453
143 Ga0209233_1002249 3300025261 Bacteria 7214
144 Ga0209051_1060797 3300025303 Bacteria 1190
145 Ga0207653_10011837 3300025885 Bacteria 2722
146 Ga0207692_10009303 3300025898 Bacteria 4097
147 Ga0207710_10002075 3300025900 Bacteria 9497
148 Ga0207710_10062610 3300025900 Bacteria 1691
149 Ga0207688_10016085 3300025901 Bacteria 4056
150 Ga0207647_10012365 3300025904 Bacteria 5943
151 Ga0207685_10032633 3300025905 Bacteria 1875
152 Ga0207699_10087382 3300025906 Bacteria 1949
153 Ga0207645_10007622 3300025907 Bacteria 7628
154 Ga0207707_10088021 3300025912 Bacteria 2713
155 Ga0207671_10000095 3300025914 Bacteria 137647
156 Ga0207693_10000207 3300025915 Bacteria 53977
157 Ga0207693_10026374 3300025915 Bacteria 4599
158 Ga0207663_10020349 3300025916 Bacteria 3756
159 Ga0207662_10039394 3300025918 Bacteria 2772
160 Ga0207657_10000526 3300025919 Bacteria 40560
161 Ga0207649_10001659 3300025920 Bacteria 12873
162 Ga0207652_10029852 3300025921 Bacteria 4563
163 Ga0207694_10109214 3300025924 Bacteria 2199
164 Ga0207650_10041986 3300025925 Bacteria 3354
165 Ga0207659_10006974 3300025926 Bacteria 6942
166 Ga0207659_10047134 3300025926 Bacteria 3047
167 Ga0207687_10034125 3300025927 Bacteria 3454
168 Ga0207700_10073826 3300025928 Bacteria 2636
169 Ga0207664_10004150 3300025929 Bacteria 9777
170 Ga0207664_10013592 3300025929 Bacteria 5850
171 Ga0207664_10179595 3300025929 Bacteria 1816
172 Ga0207644_10003302 3300025931 Bacteria 10425
173 Ga0207706_10000148 3300025933 Bacteria 76563
174 Ga0207706_10279835 3300025933 Bacteria 1455
175 Ga0207706_10374554 3300025933 Bacteria 1236
176 Ga0207686_10018799 3300025934 Bacteria 3918
177 Ga0207670_10008519 3300025936 Bacteria 5794
178 Ga0207669_10013854 3300025937 Bacteria 4023
179 Ga0207704_10014035 3300025938 Bacteria 4034
180 Ga0207665_10000294 3300025939 Bacteria 34482
181 Ga0207691_10007366 3300025940 Bacteria 10602
182 Ga0207691_10053786 3300025940 Bacteria 3674
183 Ga0207689_10198858 3300025942 Bacteria 1654
184 Ga0207651_10006602 3300025960 Bacteria 6094
185 Ga0207651_10231122 3300025960 Bacteria 1501
186 Ga0207712_10004341 3300025961 Bacteria 8956
187 Ga0207668_10045053 3300025972 Bacteria 3006
188 Ga0207668_10105471 3300025972 Bacteria 2103
189 Ga0207640_10012113 3300025981 Bacteria 4903
190 Ga0207658_10005086 3300025986 Bacteria 9046
191 Ga0207658_10106360 3300025986 Bacteria 2209
192 Ga0207677_10049131 3300026023 Bacteria 2845
193 Ga0207703_10119759 3300026035 Bacteria 2258
194 Ga0207639_10005527 3300026041 Bacteria 8543
195 Ga0207639_10126035 3300026041 Bacteria 2112
196 Ga0207678_10000415 3300026067 Bacteria 38523
197 Ga0207708_10000685 3300026075 Bacteria 25730
198 Ga0207708_10032807 3300026075 Bacteria 3943
199 Ga0207708_10059109 3300026075 Bacteria 2926
200 Ga0207641_10246635 3300026088 Bacteria 1666
201 Ga0207676_10012142 3300026095 Bacteria 6165
202 Ga0207674_10000211 3300026116 Bacteria 71986
203 Ga0207675_100000491 3300026118 Bacteria 38393
204 Ga0207683_10001381 3300026121 Bacteria 21885
205 Ga0207683_10271779 3300026121 Bacteria 1548
206 Ga0207698_10228915 3300026142 Bacteria 1686
207 Ga0209998_10005522 3300027717 Bacteria 2642
208 Ga0207428_10019758 3300027907 Bacteria 5740
209 Ga0207428_10061935 3300027907 Unclassified 2960
210 Ga0207428_10172913 3300027907 Bacteria 1635
211 Ga0268266_10000417 3300028379 Bacteria 64608
212 Ga0268266_10099273 3300028379 Bacteria 2563
213 Ga0268266_10415001 3300028379 Bacteria 1275
214 Ga0268265_10031760 3300028380 Bacteria 3816
215 Ga0307515_10016569 3300028794 Bacteria 13487
216 Ga0265338_10009328 3300028800 Bacteria 11724
217 Ga0265325_10003068 3300031241 Bacteria 11034
218 Ga0265339_10000077 3300031249 Bacteria 84288
219 Ga0307408_100148568 3300031548 Bacteria 1848
220 Ga0265313_10003775 3300031595 Bacteria 12021
221 Ga0265314_10024265 3300031711 Bacteria 4600
222 Ga0307414_10169391 3300032004 Bacteria 1744
223 Ga0373943_0118734 3300035170 Bacteria 1403
224 Ga0373946_0046901 3300035171 Bacteria 1793
225 Ga0373924_0044939 3300035410 Bacteria 1816
226 Ga0373931_0004600 3300035691 Bacteria 6313
227 Ga0373935_0036221 3300035692 Bacteria 3084
228 Ga0373927_0010783 3300035695 Bacteria 6088
229 Ga0373947_0203401 3300035725 Bacteria 1296
230 Ga0373937_0092032 3300036401 Bacteria 2810
231 Ga0373937_0227118 3300036401 Bacteria 1757
232 Ga0373925_0011939 3300037068 Bacteria 6287
233 Ga0373925_0116845 3300037068 Bacteria 2067
234 Ga0395899_0041881 3300037312 Bacteria 3420
235 Ga0395900_0003365 3300037418 Bacteria 17264
236 Ga0395898_0062434 3300037466 Bacteria 3618
237 Ga0395898_0105307 3300037466 Bacteria 2705
238 Ga0395905_0001231 3300037471 Bacteria 31814
239 Ga0436364_0081063 3300037853 Bacteria 4309
240 Ga0436364_1040518 3300037853 Bacteria 5065
241 Ga0395901_0021692 3300038443 Bacteria 6581
242 Ga0395901_0429982 3300038443 Bacteria 1353
243 Ga0395901_0780280 3300038443 Bacteria 946
244 Ga0436361_0052829 3300039447 Bacteria 3937
245 Ga0451576_0073736 3300045051 Bacteria 3552
246 Ga0495603_0000375 3300046455 Bacteria 24256
247 Ga0495629_0000807 3300046459 Bacteria 25356
248 Ga0495641_0017868 3300046461 Bacteria 3677
249 Ga0495653_0035452 3300046463 Bacteria 3937
250 Ga0495582_0000367 3300046473 Bacteria 24654
251 Ga0495639_0022657 3300046475 Bacteria 2756
252 Ga0495594_0000732 3300046499 Bacteria 16836
253 Ga0495628_0174173 3300046516 Bacteria 1630
254 Ga0495652_0037153 3300046529 Bacteria 4227
255 Ga0495665_0007419 3300046531 Bacteria 5930
256 Ga0495640_0156588 3300046533 Bacteria 1462
257 Ga0495622_0000605 3300046557 Bacteria 20910
258 Ga0495633_0061343 3300046558 Unclassified 1761
259 Ga0495667_0032653 3300046559 Bacteria 3487
260 Ga0495634_0006507 3300046642 Bacteria 8873
261 Ga0495635_0099151 3300046663 Bacteria 1991
262 Ga0495588_0011667 3300046674 Bacteria 4130
263 Ga0495647_0004319 3300046681 Bacteria 4606
264 Ga0495658_0000669 3300046683 Bacteria 18610
265 Ga0495613_0000290 3300046689 Bacteria 46122
266 Ga0495600_0174110 3300046809 Unclassified 1388
267 Ga0495581_0014567 3300047315 Bacteria 4559
268 Ga0495604_0151756 3300047317 Unclassified 1645
269 Ga0495680_0044165 3300047322 Bacteria 3525
270 Ga0495680_0066169 3300047322 Bacteria 2766
271 Ga0495675_0024665 3300047444 Bacteria 3835
272 Ga0495593_0000102 3300047673 Bacteria 38953
273 Ga0495593_0116440 3300047673 Bacteria 1362
274 Ga0495602_0103589 3300048088 Bacteria 2329
275 Ga0495614_0000209 3300048089 Bacteria 22625
276 Ga0496100_0022423 3300048903 Bacteria 3821
277 Ga0496100_0046615 3300048903 Bacteria 2788
278 Ga0496101_0010529 3300048904 Bacteria 6108
279 Ga0496102_0042933 3300048905 Bacteria 4098
280 Ga0496102_0068281 3300048905 Bacteria 3261
281 Ga0496102_0108938 3300048905 Bacteria 2580
282 Ga0496102_0172018 3300048905 Bacteria 2039
283 Ga0496103_0029310 3300048906 Bacteria 3344
284 Ga0496103_0074128 3300048906 Bacteria 2133
285 Ga0496104_0021423 3300048907 Bacteria 5933
286 Ga0496104_0127866 3300048907 Bacteria 2440
287 Ga0496104_0402863 3300048907 Unclassified 1280
288 Ga0496105_0015202 3300048908 Bacteria 6129
289 Ga0496105_0160360 3300048908 Bacteria 1846
290 Ga0496106_0151031 3300048909 Unclassified 1832
291 Ga0496107_0005754 3300048910 Bacteria 8480
292 Ga0496107_0063802 3300048910 Bacteria 2670
293 Ga0496107_0093504 3300048910 Bacteria 2198
294 Ga0496107_0233547 3300048910 Bacteria 1368
295 Ga0496108_0200154 3300048911 Bacteria 1733
296 Ga0496109_0021027 3300048912 Bacteria 5769
297 Ga0496109_0201442 3300048912 Bacteria 1871
298 Ga0496110_0225431 3300048913 Bacteria 1704
299 Ga0496112_0005010 3300048915 Bacteria 11368
300 Ga0496112_0012848 3300048915 Bacteria 7708
301 Ga0496112_0020346 3300048915 Bacteria 6289
302 Ga0496112_0328165 3300048915 Unclassified 1474
303 Ga0496113_0005712 3300048916 Bacteria 7793
304 Ga0496113_0200022 3300048916 Bacteria 1588
305 Ga0496113_0245500 3300048916 Bacteria 1429
306 Ga0501032_0045338 3300049569 Bacteria 2974
307 Ga0501036_0063018 3300049572 Bacteria 3140
308 Ga0501036_0079959 3300049572 Bacteria 2764
309 Ga0501036_0248737 3300049572 Bacteria 1490
310 Ga0501037_0037913 3300049573 Bacteria 3553
311 Ga0501038_0028667 3300049574 Bacteria 4945
312 Ga0501038_0270605 3300049574 Bacteria 1340
313 Ga0501039_0015961 3300049575 Bacteria 5750
314 Ga0501040_0006480 3300049576 Bacteria 7603
315 Ga0501040_0072739 3300049576 Bacteria 2375
316 Ga0501041_0029785 3300049577 Bacteria 3293
317 Ga0501042_0034911 3300049578 Bacteria 3567
318 Ga0501043_0033119 3300049579 Bacteria 4065
319 Ga0501046_0063401 3300049580 Bacteria 2886
320 Ga0501046_0259073 3300049580 Bacteria 1278
321 Ga0501047_0131569 3300049581 Bacteria 2382
322 Ga0501047_0155269 3300049581 Bacteria 2162
323 Ga0501048_0039711 3300049582 Bacteria 3374
324 Ga0501069_0130684 3300049585 Bacteria 1438
325 Ga0501070_0105490 3300049586 Bacteria 2330
326 Ga0501071_0017346 3300049587 Bacteria 4963
327 Ga0501071_0042814 3300049587 Bacteria 3245
328 Ga0501071_0077240 3300049587 Bacteria 2432
329 Ga0501072_0041723 3300049588 Bacteria 3604
330 Ga0501072_0052702 3300049588 Bacteria 3203
331 Ga0501072_0105013 3300049588 Bacteria 2246
332 Ga0501072_0163218 3300049588 Bacteria 1777
333 Ga0501073_0040660 3300049589 Bacteria 3289
334 Ga0501074_0020221 3300049590 Bacteria 4837
335 Ga0501075_0010117 3300049591 Bacteria 6617
336 Ga0501075_0017268 3300049591 Bacteria 5211
337 Ga0501075_0085277 3300049591 Bacteria 2393
338 Ga0501075_0318133 3300049591 Bacteria 1186
339 Ga0501076_0016311 3300049592 Bacteria 5631
340 Ga0501076_0101330 3300049592 Bacteria 2321
341 Ga0501076_0137943 3300049592 Bacteria 1981
342 Ga0501077_0024119 3300049593 Bacteria 3861
343 Ga0501077_0029954 3300049593 Bacteria 3462
344 Ga0501077_0031614 3300049593 Bacteria 3369
345 Ga0501198_000012 3300049649 Bacteria 113529
346 Ga0501222_000010 3300049662 Bacteria 113536
347 Ga0501079_0009321 3300049741 Bacteria 7439
348 Ga0501079_0037633 3300049741 Bacteria 3729
349 Ga0501079_0070257 3300049741 Bacteria 2704
350 Ga0501079_0089608 3300049741 Bacteria 2382
351 Ga0501079_0232810 3300049741 Bacteria 1439
352 Ga0501080_0143762 3300049742 Bacteria 2205
353 Ga0501080_0165420 3300049742 Bacteria 2041
354 Ga0501080_0180333 3300049742 Bacteria 1944
355 Ga0501080_0619800 3300049742 Bacteria 959
356 Ga0501081_0010917 3300049743 Bacteria 5937
357 Ga0501081_0017206 3300049743 Bacteria 4782
358 Ga0501081_0049533 3300049743 Bacteria 2893
359 Ga0501035_0066047 3300049822 Bacteria 3211
360 Ga0501044_0159229 3300049823 Bacteria 2236
361 Ga0501044_0324265 3300049823 Bacteria 1464
362 Ga0501045_0013684 3300049824 Bacteria 5735
363 Ga0501045_0015374 3300049824 Bacteria 5433
364 Ga0501045_0040784 3300049824 Bacteria 3376
365 Ga0501045_0097524 3300049824 Bacteria 2175
366 Ga0501045_0155430 3300049824 Bacteria 1702
367 Ga0501045_0169590 3300049824 Bacteria 1626
368 nmdc:mga03n38_119169_c1 3300050490 Bacteria 1295
369 nmdc:mga06r32_101912_c1 3300050510 Bacteria 2818
370 nmdc:mga08y16_255118_c1 3300050511 Bacteria 1812
371 nmdc:mga08y16_26430_c1 3300050511 Bacteria 6121
372 nmdc:mga0n895_144633_c1 3300050512 Bacteria 2407
373 nmdc:mga0n895_62624_c1 3300050512 Bacteria 3677
374 nmdc:mga0n895_72985_c1 3300050512 Bacteria 3406
375 nmdc:mga0rr50_224723_c1 3300050513 Bacteria 1552
376 nmdc:mga08x19_106607_c1 3300050514 Bacteria 1865
377 nmdc:mga0a205_8874_c1 3300050515 Bacteria 9158
378 nmdc:mga0sz30_43838_c1 3300050516 Bacteria 1884
379 Ga0495655_0019270 3300053083 Unclassified 1512
380 Ga0495619_0001533 3300053085 Bacteria 15223
381 Ga0501084_0045578 3300054114 Bacteria 3672
382 Ga0501084_0098157 3300054114 Bacteria 2459
383 Ga0501084_0108499 3300054114 Bacteria 2332
384 Ga0501084_0389923 3300054114 Bacteria 1177
385 Ga0501082_0018188 3300060353 Bacteria 6051
386 Ga0501082_0069028 3300060353 Bacteria 3043
387 Ga0501082_0315549 3300060353 Bacteria 1361
388 Ga0501082_0385306 3300060353 Bacteria 1223
389 Ga0530510_0034344 3300061734 Bacteria 3653
390 Ga0530510_0052427 3300061734 Bacteria 2947
391 Ga0530510_0170000 3300061734 Bacteria 1614

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038443 Ga0395901_0780280 Ga0395901_0780280_63_932 289
2 3300049742 Ga0501080_0619800 Ga0501080_0619800_19_924 301
3 3300045051 Ga0451576_0073736 Ga0451576_0073736_1841_2878 306
4 3300049741 Ga0501079_0232810 Ga0501079_0232810_20_976 306
5 3300006048 Ga0075363_100052618 Ga0075363_1000526182 310
6 3300050490 nmdc:mga03n38_119169_c1 nmdc:mga03n38_119169_c1_16_1017 310
7 3300036401 Ga0373937_0227118 Ga0373937_0227118_687_1682 311
8 3300028800 Ga0265338_10009328 Ga0265338_1000932810 316
9 3300031241 Ga0265325_10003068 Ga0265325_100030686 316
10 3300031249 Ga0265339_10000077 Ga0265339_1000007723 316
11 3300031595 Ga0265313_10003775 Ga0265313_100037757 316
12 3300049591 Ga0501075_0085277 Ga0501075_0085277_742_1740 316
13 3300054114 Ga0501084_0045578 Ga0501084_0045578_2508_3506 316
14 3300010159 Ga0099796_10013354 Ga0099796_100133541 317
15 3300039447 Ga0436361_0052829 Ga0436361_0052829_207_1211 318
16 3300049581 Ga0501047_0155269 Ga0501047_0155269_72_1076 318
17 3300025929 Ga0207664_10179595 Ga0207664_101795952 319
18 3300028794 Ga0307515_10016569 Ga0307515_100165695 320
19 3300031711 Ga0265314_10024265 Ga0265314_100242652 320
20 3300005985 Ga0081539_10063112 Ga0081539_100631122 321
21 3300009147 Ga0114129_10252788 Ga0114129_102527882 321
22 3300037853 Ga0436364_0081063 Ga0436364_0081063_887_1891 321
23 3300037068 Ga0373925_0116845 Ga0373925_0116845_589_1605 324
24 3300047673 Ga0495593_0116440 Ga0495593_0116440_29_1045 324
25 3300050516 nmdc:mga0sz30_43838_c1 nmdc:mga0sz30_43838_c1_747_1724 325
26 3300005981 Ga0081538_10032336 Ga0081538_100323363 328
27 3300049824 Ga0501045_0155430 Ga0501045_0155430_571_1644 328
28 3300005331 Ga0070670_100010109 Ga0070670_1000101094 332
29 3300005340 Ga0070689_100021466 Ga0070689_1000214663 332
30 3300005354 Ga0070675_100111107 Ga0070675_1001111073 332
31 3300005355 Ga0070671_100010916 Ga0070671_1000109166 332
32 3300005364 Ga0070673_100006352 Ga0070673_1000063528 332
33 3300005440 Ga0070705_100177025 Ga0070705_1001770251 332
34 3300014325 Ga0163163_10127423 Ga0163163_101274233 332
35 3300025926 Ga0207659_10047134 Ga0207659_100471342 332
36 3300025928 Ga0207700_10073826 Ga0207700_100738262 332
37 3300025931 Ga0207644_10003302 Ga0207644_1000330210 332
38 3300025933 Ga0207706_10374554 Ga0207706_103745542 332
39 3300025960 Ga0207651_10231122 Ga0207651_102311221 332
40 3300037853 Ga0436364_1040518 Ga0436364_1040518_248_1246 332
41 3300048905 Ga0496102_0172018 Ga0496102_0172018_50_1048 332
42 3300048907 Ga0496104_0127866 Ga0496104_0127866_993_1991 332
43 3300048915 Ga0496112_0020346 Ga0496112_0020346_2030_3028 332
44 3300048916 Ga0496113_0200022 Ga0496113_0200022_316_1314 332
45 3300048916 Ga0496113_0245500 Ga0496113_0245500_216_1214 332
46 3300035410 Ga0373924_0044939 Ga0373924_0044939_312_1313 333
47 3300036401 Ga0373937_0092032 Ga0373937_0092032_388_1389 333
48 3300046529 Ga0495652_0037153 Ga0495652_0037153_3019_4020 333
49 3300046559 Ga0495667_0032653 Ga0495667_0032653_1155_2156 333
50 3300046663 Ga0495635_0099151 Ga0495635_0099151_374_1375 333
51 3300046809 Ga0495600_0174110 Ga0495600_0174110_228_1229 333
52 3300047317 Ga0495604_0151756 Ga0495604_0151756_389_1390 333
53 3300047322 Ga0495680_0066169 Ga0495680_0066169_503_1504 333
54 3300006871 Ga0075434_100207542 Ga0075434_1002075422 334
55 3300009094 Ga0111539_10184963 Ga0111539_101849633 334
56 3300027907 Ga0207428_10172913 Ga0207428_101729132 334
57 3300049822 Ga0501035_0066047 Ga0501035_0066047_1842_2846 334
58 3300050511 nmdc:mga08y16_255118_c1 nmdc:mga08y16_255118_c1_566_1570 334
59 3300049576 Ga0501040_0072739 Ga0501040_0072739_370_1377 335
60 3300005983 Ga0081540_1000140 Ga0081540_100014044 336
61 3300006028 Ga0070717_10186107 Ga0070717_101861071 336
62 3300006871 Ga0075434_100092056 Ga0075434_1000920562 336
63 3300024227 Ga0228598_1006331 Ga0228598_10063313 336
64 3300025929 Ga0207664_10013592 Ga0207664_100135924 336
65 3300046463 Ga0495653_0035452 Ga0495653_0035452_1429_2439 336
66 3300046516 Ga0495628_0174173 Ga0495628_0174173_473_1483 336
67 3300046533 Ga0495640_0156588 Ga0495640_0156588_308_1318 336
68 3300047444 Ga0495675_0024665 Ga0495675_0024665_2197_3207 336
69 3300048088 Ga0495602_0103589 Ga0495602_0103589_217_1227 336
70 3300048906 Ga0496103_0074128 Ga0496103_0074128_301_1365 336
71 3300050512 nmdc:mga0n895_72985_c1 nmdc:mga0n895_72985_c1_670_1692 336
72 3300049823 Ga0501044_0324265 Ga0501044_0324265_327_1448 337
73 iso_pu_bacteria 2511231221 2512034594 337
74 iso_pu_bacteria 8054002106 8054003882 337
75 3300005937 Ga0081455_10065441 Ga0081455_100654412 338
76 3300006844 Ga0075428_100046681 Ga0075428_1000466813 338
77 3300049572 Ga0501036_0248737 Ga0501036_0248737_400_1425 338
78 3300005328 Ga0070676_10125182 Ga0070676_101251822 339
79 3300005329 Ga0070683_100333614 Ga0070683_1003336142 339
80 3300005330 Ga0070690_100002469 Ga0070690_1000024697 339
81 3300005331 Ga0070670_100004802 Ga0070670_1000048026 339
82 3300005334 Ga0068869_100195670 Ga0068869_1001956702 339
83 3300005336 Ga0070680_100002239 Ga0070680_10000223918 339
84 3300005336 Ga0070680_100323615 Ga0070680_1003236151 339
85 3300005337 Ga0070682_100000739 Ga0070682_1000007392 339
86 3300005338 Ga0068868_100065451 Ga0068868_1000654512 339
87 3300005339 Ga0070660_100004563 Ga0070660_1000045634 339
88 3300005340 Ga0070689_100020546 Ga0070689_1000205462 339
89 3300005341 Ga0070691_10001230 Ga0070691_100012307 339
90 3300005343 Ga0070687_100041666 Ga0070687_1000416662 339
91 3300005344 Ga0070661_100000594 Ga0070661_1000005948 339
92 3300005345 Ga0070692_10000131 Ga0070692_100001313 339
93 3300005347 Ga0070668_100000672 Ga0070668_1000006722 339
94 3300005347 Ga0070668_100056531 Ga0070668_1000565313 339
95 3300005353 Ga0070669_100012818 Ga0070669_1000128182 339
96 3300005354 Ga0070675_100031837 Ga0070675_1000318374 339
97 3300005355 Ga0070671_100004459 Ga0070671_1000044595 339
98 3300005356 Ga0070674_100000551 Ga0070674_1000005518 339
99 3300005364 Ga0070673_100003383 Ga0070673_1000033832 339
100 3300005365 Ga0070688_100000261 Ga0070688_10000026124 339
101 3300005366 Ga0070659_100311993 Ga0070659_1003119931 339
102 3300005367 Ga0070667_100000309 Ga0070667_10000030943 339
103 3300005406 Ga0070703_10001582 Ga0070703_100015822 339
104 3300005434 Ga0070709_10006269 Ga0070709_100062693 339
105 3300005435 Ga0070714_100004416 Ga0070714_10000441613 339
106 3300005436 Ga0070713_100095651 Ga0070713_1000956512 339
107 3300005437 Ga0070710_10001969 Ga0070710_1000196913 339
108 3300005438 Ga0070701_10000109 Ga0070701_1000010915 339
109 3300005439 Ga0070711_100001710 Ga0070711_1000017107 339
110 3300005440 Ga0070705_100000306 Ga0070705_1000003067 339
111 3300005441 Ga0070700_100000858 Ga0070700_1000008582 339
112 3300005444 Ga0070694_100000201 Ga0070694_10000020119 339
113 3300005455 Ga0070663_100002080 Ga0070663_1000020807 339
114 3300005456 Ga0070678_100000371 Ga0070678_10000037118 339
115 3300005457 Ga0070662_100003173 Ga0070662_1000031736 339
116 3300005458 Ga0070681_10063733 Ga0070681_100637332 339
117 3300005466 Ga0070685_10002693 Ga0070685_100026937 339
118 3300005518 Ga0070699_100183010 Ga0070699_1001830102 339
119 3300005536 Ga0070697_100102878 Ga0070697_1001028782 339
120 3300005539 Ga0068853_100009809 Ga0068853_1000098092 339
121 3300005543 Ga0070672_100009393 Ga0070672_1000093934 339
122 3300005544 Ga0070686_100009433 Ga0070686_1000094336 339
123 3300005545 Ga0070695_100002621 Ga0070695_1000026213 339
124 3300005546 Ga0070696_100203668 Ga0070696_1002036682 339
125 3300005547 Ga0070693_100000082 Ga0070693_10000008216 339
126 3300005549 Ga0070704_100004752 Ga0070704_1000047522 339
127 3300005563 Ga0068855_100011575 Ga0068855_1000115752 339
128 3300005564 Ga0070664_100007238 Ga0070664_1000072383 339
129 3300005578 Ga0068854_100001020 Ga0068854_10000102012 339
130 3300005614 Ga0068856_100005453 Ga0068856_1000054537 339
131 3300005615 Ga0070702_100005932 Ga0070702_1000059325 339
132 3300005616 Ga0068852_100004381 Ga0068852_1000043817 339
133 3300005617 Ga0068859_100017666 Ga0068859_1000176666 339
134 3300005617 Ga0068859_100140464 Ga0068859_1001404643 339
135 3300005718 Ga0068866_10001833 Ga0068866_100018337 339
136 3300005719 Ga0068861_100000793 Ga0068861_10000079319 339
137 3300005841 Ga0068863_100008742 Ga0068863_1000087427 339
138 3300005842 Ga0068858_100018181 Ga0068858_1000181816 339
139 3300005843 Ga0068860_100008473 Ga0068860_1000084736 339
140 3300005937 Ga0081455_10002618 Ga0081455_100026188 339
141 3300005937 Ga0081455_10003018 Ga0081455_100030188 339
142 3300006163 Ga0070715_10000268 Ga0070715_100002683 339
143 3300006173 Ga0070716_100000735 Ga0070716_10000073513 339
144 3300006175 Ga0070712_100000481 Ga0070712_1000004817 339
145 3300006175 Ga0070712_100049290 Ga0070712_1000492903 339
146 3300006237 Ga0097621_100091657 Ga0097621_1000916572 339
147 3300006844 Ga0075428_100048450 Ga0075428_1000484507 339
148 3300006847 Ga0075431_100024636 Ga0075431_1000246365 339
149 3300006852 Ga0075433_10036517 Ga0075433_100365175 339
150 3300006852 Ga0075433_10053682 Ga0075433_100536822 339
151 3300006871 Ga0075434_100046032 Ga0075434_1000460323 339
152 3300006880 Ga0075429_100012885 Ga0075429_1000128853 339
153 3300006881 Ga0068865_100004493 Ga0068865_1000044936 339
154 3300006881 Ga0068865_100052427 Ga0068865_1000524273 339
155 3300006914 Ga0075436_100004532 Ga0075436_10000453214 339
156 3300006931 Ga0097620_100017666 Ga0097620_1000176666 339
157 3300006931 Ga0097620_100140467 Ga0097620_1001404673 339
158 3300007076 Ga0075435_100038302 Ga0075435_1000383023 339
159 3300009092 Ga0105250_10005576 Ga0105250_100055763 339
160 3300009093 Ga0105240_10010367 Ga0105240_1001036714 339
161 3300009094 Ga0111539_10043059 Ga0111539_100430597 339
162 3300009098 Ga0105245_10001377 Ga0105245_100013776 339
163 3300009101 Ga0105247_10025828 Ga0105247_100258282 339
164 3300009147 Ga0114129_10118426 Ga0114129_101184262 339
165 3300009148 Ga0105243_10000688 Ga0105243_1000068816 339
166 3300009148 Ga0105243_10143384 Ga0105243_101433843 339
167 3300009174 Ga0105241_10000949 Ga0105241_100009499 339
168 3300009176 Ga0105242_10026344 Ga0105242_100263442 339
169 3300009177 Ga0105248_10018034 Ga0105248_100180344 339
170 3300009177 Ga0105248_10085248 Ga0105248_100852482 339
171 3300009545 Ga0105237_10001143 Ga0105237_100011439 339
172 3300009551 Ga0105238_10408840 Ga0105238_104088402 339
173 3300009553 Ga0105249_10002187 Ga0105249_100021879 339
174 3300011119 Ga0105246_10004905 Ga0105246_100049052 339
175 3300013102 Ga0157371_10002294 Ga0157371_1000229418 339
176 3300013105 Ga0157369_10006075 Ga0157369_100060755 339
177 3300013296 Ga0157374_10007065 Ga0157374_100070654 339
178 3300013297 Ga0157378_10001300 Ga0157378_100013008 339
179 3300013297 Ga0157378_10011799 Ga0157378_100117998 339
180 3300013306 Ga0163162_10009653 Ga0163162_100096532 339
181 3300013307 Ga0157372_10009779 Ga0157372_1000977914 339
182 3300013307 Ga0157372_10232035 Ga0157372_102320353 339
183 3300013308 Ga0157375_10030328 Ga0157375_100303282 339
184 3300013308 Ga0157375_10183121 Ga0157375_101831212 339
185 3300014325 Ga0163163_10001334 Ga0163163_100013346 339
186 3300014326 Ga0157380_10000175 Ga0157380_1000017511 339
187 3300014326 Ga0157380_10135374 Ga0157380_101353742 339
188 3300014745 Ga0157377_10000263 Ga0157377_1000026324 339
189 3300014968 Ga0157379_10028495 Ga0157379_100284956 339
190 3300014968 Ga0157379_10039780 Ga0157379_100397805 339
191 3300014968 Ga0157379_10075177 Ga0157379_100751772 339
192 3300014969 Ga0157376_10000424 Ga0157376_1000042418 339
193 3300025885 Ga0207653_10011837 Ga0207653_100118372 339
194 3300025898 Ga0207692_10009303 Ga0207692_100093032 339
195 3300025900 Ga0207710_10002075 Ga0207710_100020755 339
196 3300025900 Ga0207710_10062610 Ga0207710_100626102 339
197 3300025901 Ga0207688_10016085 Ga0207688_100160852 339
198 3300025904 Ga0207647_10012365 Ga0207647_100123653 339
199 3300025905 Ga0207685_10032633 Ga0207685_100326332 339
200 3300025906 Ga0207699_10087382 Ga0207699_100873822 339
201 3300025907 Ga0207645_10007622 Ga0207645_100076229 339
202 3300025912 Ga0207707_10088021 Ga0207707_100880213 339
203 3300025915 Ga0207693_10000207 Ga0207693_1000020734 339
204 3300025915 Ga0207693_10026374 Ga0207693_100263743 339
205 3300025916 Ga0207663_10020349 Ga0207663_100203492 339
206 3300025918 Ga0207662_10039394 Ga0207662_100393942 339
207 3300025919 Ga0207657_10000526 Ga0207657_100005267 339
208 3300025920 Ga0207649_10001659 Ga0207649_100016599 339
209 3300025921 Ga0207652_10029852 Ga0207652_100298524 339
210 3300025924 Ga0207694_10109214 Ga0207694_101092142 339
211 3300025925 Ga0207650_10041986 Ga0207650_100419863 339
212 3300025926 Ga0207659_10006974 Ga0207659_100069747 339
213 3300025927 Ga0207687_10034125 Ga0207687_100341252 339
214 3300025929 Ga0207664_10004150 Ga0207664_100041503 339
215 3300025933 Ga0207706_10000148 Ga0207706_1000014833 339
216 3300025933 Ga0207706_10279835 Ga0207706_102798351 339
217 3300025934 Ga0207686_10018799 Ga0207686_100187994 339
218 3300025936 Ga0207670_10008519 Ga0207670_100085193 339
219 3300025937 Ga0207669_10013854 Ga0207669_100138542 339
220 3300025938 Ga0207704_10014035 Ga0207704_100140355 339
221 3300025939 Ga0207665_10000294 Ga0207665_1000029421 339
222 3300025940 Ga0207691_10007366 Ga0207691_100073664 339
223 3300025940 Ga0207691_10053786 Ga0207691_100537863 339
224 3300025942 Ga0207689_10198858 Ga0207689_101988582 339
225 3300025960 Ga0207651_10006602 Ga0207651_100066022 339
226 3300025961 Ga0207712_10004341 Ga0207712_100043416 339
227 3300025972 Ga0207668_10045053 Ga0207668_100450532 339
228 3300025972 Ga0207668_10105471 Ga0207668_101054712 339
229 3300025981 Ga0207640_10012113 Ga0207640_100121132 339
230 3300025986 Ga0207658_10005086 Ga0207658_100050869 339
231 3300025986 Ga0207658_10106360 Ga0207658_101063602 339
232 3300026023 Ga0207677_10049131 Ga0207677_100491312 339
233 3300026035 Ga0207703_10119759 Ga0207703_101197592 339
234 3300026041 Ga0207639_10126035 Ga0207639_101260352 339
235 3300026067 Ga0207678_10000415 Ga0207678_100004157 339
236 3300026075 Ga0207708_10000685 Ga0207708_1000068528 339
237 3300026075 Ga0207708_10032807 Ga0207708_100328071 339
238 3300026075 Ga0207708_10059109 Ga0207708_100591092 339
239 3300026088 Ga0207641_10246635 Ga0207641_102466352 339
240 3300026095 Ga0207676_10012142 Ga0207676_100121425 339
241 3300026116 Ga0207674_10000211 Ga0207674_1000021140 339
242 3300026118 Ga0207675_100000491 Ga0207675_10000049121 339
243 3300026121 Ga0207683_10001381 Ga0207683_1000138118 339
244 3300026121 Ga0207683_10271779 Ga0207683_102717791 339
245 3300026142 Ga0207698_10228915 Ga0207698_102289152 339
246 3300027717 Ga0209998_10005522 Ga0209998_100055222 339
247 3300027907 Ga0207428_10019758 Ga0207428_100197586 339
248 3300027907 Ga0207428_10061935 Ga0207428_100619352 339
249 3300028379 Ga0268266_10099273 Ga0268266_100992732 339
250 3300028379 Ga0268266_10415001 Ga0268266_104150012 339
251 3300028380 Ga0268265_10031760 Ga0268265_100317603 339
252 3300032004 Ga0307414_10169391 Ga0307414_101693912 339
253 3300035170 Ga0373943_0118734 Ga0373943_0118734_254_1300 339
254 3300035171 Ga0373946_0046901 Ga0373946_0046901_174_1220 339
255 3300035691 Ga0373931_0004600 Ga0373931_0004600_2260_3327 339
256 3300035692 Ga0373935_0036221 Ga0373935_0036221_854_1900 339
257 3300035695 Ga0373927_0010783 Ga0373927_0010783_4973_6019 339
258 3300035725 Ga0373947_0203401 Ga0373947_0203401_136_1182 339
259 3300037068 Ga0373925_0011939 Ga0373925_0011939_4944_5990 339
260 3300037418 Ga0395900_0003365 Ga0395900_0003365_14381_15448 339
261 3300037466 Ga0395898_0062434 Ga0395898_0062434_1092_2159 339
262 3300037471 Ga0395905_0001231 Ga0395905_0001231_13854_14921 339
263 3300038443 Ga0395901_0021692 Ga0395901_0021692_5203_6270 339
264 3300046455 Ga0495603_0000375 Ga0495603_0000375_2011_3057 339
265 3300046459 Ga0495629_0000807 Ga0495629_0000807_23241_24287 339
266 3300046461 Ga0495641_0017868 Ga0495641_0017868_528_1574 339
267 3300046473 Ga0495582_0000367 Ga0495582_0000367_5289_6335 339
268 3300046475 Ga0495639_0022657 Ga0495639_0022657_1444_2490 339
269 3300046499 Ga0495594_0000732 Ga0495594_0000732_5329_6375 339
270 3300046531 Ga0495665_0007419 Ga0495665_0007419_945_1991 339
271 3300046557 Ga0495622_0000605 Ga0495622_0000605_10979_12025 339
272 3300046558 Ga0495633_0061343 Ga0495633_0061343_292_1359 339
273 3300046642 Ga0495634_0006507 Ga0495634_0006507_1217_2263 339
274 3300046674 Ga0495588_0011667 Ga0495588_0011667_2116_3162 339
275 3300046681 Ga0495647_0004319 Ga0495647_0004319_1725_2771 339
276 3300046683 Ga0495658_0000669 Ga0495658_0000669_1966_3012 339
277 3300046689 Ga0495613_0000290 Ga0495613_0000290_1656_2702 339
278 3300047315 Ga0495581_0014567 Ga0495581_0014567_2946_3992 339
279 3300047322 Ga0495680_0044165 Ga0495680_0044165_244_1290 339
280 3300047673 Ga0495593_0000102 Ga0495593_0000102_35879_36925 339
281 3300048089 Ga0495614_0000209 Ga0495614_0000209_8209_9255 339
282 3300048903 Ga0496100_0022423 Ga0496100_0022423_660_1733 339
283 3300048903 Ga0496100_0046615 Ga0496100_0046615_1476_2543 339
284 3300048904 Ga0496101_0010529 Ga0496101_0010529_3303_4376 339
285 3300048905 Ga0496102_0042933 Ga0496102_0042933_1294_2367 339
286 3300048905 Ga0496102_0068281 Ga0496102_0068281_954_2009 339
287 3300048905 Ga0496102_0108938 Ga0496102_0108938_840_1907 339
288 3300048906 Ga0496103_0029310 Ga0496103_0029310_802_1869 339
289 3300048907 Ga0496104_0021423 Ga0496104_0021423_4493_5560 339
290 3300048907 Ga0496104_0402863 Ga0496104_0402863_16_1056 339
291 3300048908 Ga0496105_0015202 Ga0496105_0015202_1585_2658 339
292 3300048908 Ga0496105_0160360 Ga0496105_0160360_94_1233 339
293 3300048909 Ga0496106_0151031 Ga0496106_0151031_343_1398 339
294 3300048910 Ga0496107_0005754 Ga0496107_0005754_1374_2447 339
295 3300048910 Ga0496107_0063802 Ga0496107_0063802_1525_2565 339
296 3300048910 Ga0496107_0093504 Ga0496107_0093504_686_1753 339
297 3300048910 Ga0496107_0233547 Ga0496107_0233547_95_1150 339
298 3300048911 Ga0496108_0200154 Ga0496108_0200154_272_1345 339
299 3300048912 Ga0496109_0021027 Ga0496109_0021027_1137_2204 339
300 3300048912 Ga0496109_0201442 Ga0496109_0201442_388_1461 339
301 3300048913 Ga0496110_0225431 Ga0496110_0225431_501_1631 339
302 3300048915 Ga0496112_0005010 Ga0496112_0005010_9032_10072 339
303 3300048915 Ga0496112_0012848 Ga0496112_0012848_614_1681 339
304 3300048915 Ga0496112_0328165 Ga0496112_0328165_123_1163 339
305 3300048916 Ga0496113_0005712 Ga0496113_0005712_2195_3268 339
306 3300049572 Ga0501036_0063018 Ga0501036_0063018_612_1676 339
307 3300049572 Ga0501036_0079959 Ga0501036_0079959_174_1241 339
308 3300049573 Ga0501037_0037913 Ga0501037_0037913_1015_2079 339
309 3300049574 Ga0501038_0028667 Ga0501038_0028667_1429_2493 339
310 3300049574 Ga0501038_0270605 Ga0501038_0270605_142_1197 339
311 3300049575 Ga0501039_0015961 Ga0501039_0015961_3095_4159 339
312 3300049576 Ga0501040_0006480 Ga0501040_0006480_3559_4623 339
313 3300049577 Ga0501041_0029785 Ga0501041_0029785_1905_2969 339
314 3300049578 Ga0501042_0034911 Ga0501042_0034911_850_1914 339
315 3300049579 Ga0501043_0033119 Ga0501043_0033119_1933_2997 339
316 3300049580 Ga0501046_0063401 Ga0501046_0063401_1262_2329 339
317 3300049580 Ga0501046_0259073 Ga0501046_0259073_146_1210 339
318 3300049582 Ga0501048_0039711 Ga0501048_0039711_1432_2496 339
319 3300049585 Ga0501069_0130684 Ga0501069_0130684_269_1333 339
320 3300049586 Ga0501070_0105490 Ga0501070_0105490_1150_2214 339
321 3300049587 Ga0501071_0017346 Ga0501071_0017346_1854_2918 339
322 3300049587 Ga0501071_0042814 Ga0501071_0042814_1602_2666 339
323 3300049587 Ga0501071_0077240 Ga0501071_0077240_357_1424 339
324 3300049588 Ga0501072_0041723 Ga0501072_0041723_594_1658 339
325 3300049588 Ga0501072_0052702 Ga0501072_0052702_889_1944 339
326 3300049588 Ga0501072_0105013 Ga0501072_0105013_1129_2193 339
327 3300049588 Ga0501072_0163218 Ga0501072_0163218_469_1536 339
328 3300049589 Ga0501073_0040660 Ga0501073_0040660_1962_3026 339
329 3300049590 Ga0501074_0020221 Ga0501074_0020221_1456_2520 339
330 3300049591 Ga0501075_0010117 Ga0501075_0010117_2852_3916 339
331 3300049591 Ga0501075_0017268 Ga0501075_0017268_2883_3950 339
332 3300049591 Ga0501075_0318133 Ga0501075_0318133_82_1143 339
333 3300049592 Ga0501076_0016311 Ga0501076_0016311_2507_3571 339
334 3300049592 Ga0501076_0101330 Ga0501076_0101330_350_1405 339
335 3300049592 Ga0501076_0137943 Ga0501076_0137943_219_1289 339
336 3300049593 Ga0501077_0024119 Ga0501077_0024119_2088_3152 339
337 3300049593 Ga0501077_0029954 Ga0501077_0029954_2320_3384 339
338 3300049593 Ga0501077_0031614 Ga0501077_0031614_399_1463 339
339 3300049649 Ga0501198_000012 Ga0501198_000012_97775_98827 339
340 3300049662 Ga0501222_000010 Ga0501222_000010_97781_98833 339
341 3300049741 Ga0501079_0009321 Ga0501079_0009321_1548_2603 339
342 3300049741 Ga0501079_0037633 Ga0501079_0037633_1916_2980 339
343 3300049741 Ga0501079_0070257 Ga0501079_0070257_1396_2460 339
344 3300049741 Ga0501079_0089608 Ga0501079_0089608_976_2040 339
345 3300049742 Ga0501080_0143762 Ga0501080_0143762_201_1265 339
346 3300049742 Ga0501080_0165420 Ga0501080_0165420_535_1599 339
347 3300049742 Ga0501080_0180333 Ga0501080_0180333_357_1424 339
348 3300049743 Ga0501081_0010917 Ga0501081_0010917_3099_4163 339
349 3300049743 Ga0501081_0017206 Ga0501081_0017206_1409_2473 339
350 3300049743 Ga0501081_0049533 Ga0501081_0049533_662_1726 339
351 3300049823 Ga0501044_0159229 Ga0501044_0159229_541_1605 339
352 3300049824 Ga0501045_0013684 Ga0501045_0013684_2022_3086 339
353 3300049824 Ga0501045_0015374 Ga0501045_0015374_3422_4489 339
354 3300049824 Ga0501045_0040784 Ga0501045_0040784_341_1405 339
355 3300049824 Ga0501045_0097524 Ga0501045_0097524_694_1752 339
356 3300049824 Ga0501045_0169590 Ga0501045_0169590_212_1273 339
357 3300050510 nmdc:mga06r32_101912_c1 nmdc:mga06r32_101912_c1_265_1332 339
358 3300050511 nmdc:mga08y16_26430_c1 nmdc:mga08y16_26430_c1_5043_6104 339
359 3300050512 nmdc:mga0n895_144633_c1 nmdc:mga0n895_144633_c1_968_2035 339
360 3300050512 nmdc:mga0n895_62624_c1 nmdc:mga0n895_62624_c1_1182_2243 339
361 3300050513 nmdc:mga0rr50_224723_c1 nmdc:mga0rr50_224723_c1_76_1143 339
362 3300050514 nmdc:mga08x19_106607_c1 nmdc:mga08x19_106607_c1_357_1424 339
363 3300050515 nmdc:mga0a205_8874_c1 nmdc:mga0a205_8874_c1_6886_7947 339
364 3300053083 Ga0495655_0019270 Ga0495655_0019270_294_1361 339
365 3300053085 Ga0495619_0001533 Ga0495619_0001533_11299_12345 339
366 3300054114 Ga0501084_0098157 Ga0501084_0098157_201_1265 339
367 3300054114 Ga0501084_0108499 Ga0501084_0108499_201_1268 339
368 3300054114 Ga0501084_0389923 Ga0501084_0389923_84_1157 339
369 3300060353 Ga0501082_0018188 Ga0501082_0018188_293_1357 339
370 3300060353 Ga0501082_0069028 Ga0501082_0069028_1506_2561 339
371 3300060353 Ga0501082_0315549 Ga0501082_0315549_40_1104 339
372 3300060353 Ga0501082_0385306 Ga0501082_0385306_34_1098 339
373 3300061734 Ga0530510_0034344 Ga0530510_0034344_2400_3473 339
374 3300061734 Ga0530510_0052427 Ga0530510_0052427_113_1168 339
375 3300061734 Ga0530510_0170000 Ga0530510_0170000_10_1074 339
376 3300005548 Ga0070665_100038317 Ga0070665_1000383174 340
377 3300009545 Ga0105237_10000091 Ga0105237_1000009125 340
378 3300010375 Ga0105239_10000793 Ga0105239_100007939 340
379 3300025914 Ga0207671_10000095 Ga0207671_1000009574 340
380 3300028379 Ga0268266_10000417 Ga0268266_1000041749 340
381 3300005539 Ga0068853_100008006 Ga0068853_1000080062 341
382 3300005563 Ga0068855_100046570 Ga0068855_1000465706 341
383 3300026041 Ga0207639_10005527 Ga0207639_100055272 341
384 3300037312 Ga0395899_0041881 Ga0395899_0041881_810_1835 341
385 3300037466 Ga0395898_0105307 Ga0395898_0105307_83_1123 341
386 3300038443 Ga0395901_0429982 Ga0395901_0429982_267_1307 341
387 3300049569 Ga0501032_0045338 Ga0501032_0045338_1261_2286 341
388 3300049581 Ga0501047_0131569 Ga0501047_0131569_557_1582 341
389 3300003214 JGI25165J46597_1004255 JGI25165J46597_10042554 342
390 3300003214 JGI25165J46597_1005490 JGI25165J46597_10054901 342
391 3300025261 Ga0209233_1002249 Ga0209233_10022493 342
392 3300025303 Ga0209051_1060797 Ga0209051_10607971 342
393 3300031548 Ga0307408_100148568 Ga0307408_1001485683 342
394 iso_pu_bacteria 2897803580 2897808628 342

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06089

Asparaginase_II

L-asparaginase II

36

355

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8col-assembly2.cif.gz_DDD crystal structure of rhizobium etli constitutive l-asparaginase reaiv (orthorombic form r4op-2) 0.9503 3 338
8col-assembly2.cif.gz_DDD crystal structure of rhizobium etli constitutive l-asparaginase reaiv (orthorombic form r4op-2) 0.9449 3 338
7os6-assembly2.cif.gz_AAA crystal structure of rhizobium etli inducible l-asparaginase reav (monoclinic form mp1) 0.9153 4 331
7os3-assembly1.cif.gz_AAA crystal structure of rhizobium etli inducible l-asparaginase reav solved by s-sad (orthorhombic form start) 0.9124 6 330
7os6-assembly1.cif.gz_CCC crystal structure of rhizobium etli inducible l-asparaginase reav (monoclinic form mp1) 0.9102 6 331
ID Description Score Start End Superfamily
4f3lA02 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.82 22 37 3.30.450.20
af_Q9VZ85_1793_1984_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.6356 253 282 2.30.29.30
af_Q86YR7_827_974_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.5623 253 278 2.30.29.30
af_Q9LTJ6_57_381_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.5487 248 283 2.130.10.10
3ih9B01 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.5487 21 281 3.40.710.10
ID Description Score Start End GO Terms
AF-A0A085FIS8-F1-model_v4 L-asparaginase II 0.9846 1 331
AF-A0A2D8YKU0-F1-model_v4 deleted 0.9816 1 336
AF-A0A085FIS8-F1-model_v4 L-asparaginase II 0.9787 1 331
AF-A0A3D3SP59-F1-model_v4 deleted 0.9767 1 276
AF-A0A504H937-F1-model_v4 Asparaginase 0.9734 3 295

Feature Viewer

pLDDT pTM Quality
95.16 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map