F433017
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 394 | 273 | 391 | 350 |
Family's Representative Sequence
| Representative Sequence | 3300048908|Ga0496105_0160360|Ga0496105_0160360_94_1233 |
| Length | 379 |
| Sequence | MPRIVRSRAGQVGRAARCHHHRRGMNETASANPILVEVMRGPIVESRHAGAIAVSDANGRLLVAFGDVERPIYPRSAVKAMQAIPLIESGGADAFDLNDDALAVACSSHSGDAVHLEAVRSLLAKARLDESYLACGAHWPVSEEMTRALMRAGRRPQPLHNNCSGKHAGMLAAAVALGLEPRGYEQPDHPLQVMIARIISETCGTALDRGRMGVDGCSVPTWAIPLSALARGFARLGNGEGLTPELTSAMRRLVAACFASPVLVAGDGRLDTVVMAALAPEIFMKGGAEGVHCAALPELGLGIALKIDDGAKRAAERALSEVLVALVPRAMHVLAAQLEGELLNWRGISIGRLTASAELQHAVATLAQDSGLQLNRAAQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231221 | Azospirillum lipoferum 4B | Isolate | Rhizosphere |
| 2 | 2897803580 | Azospirillum doebereinerae GSF71 | Isolate | Unclassified |
| 3 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 66 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 67 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 68 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 70 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 75 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 76 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 77 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 78 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 79 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 80 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 83 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 97 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 112 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 163 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 166 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 167 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 168 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 169 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 170 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 171 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 172 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 173 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 174 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 175 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 176 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 177 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 178 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 179 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 180 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 183 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 184 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 185 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 186 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 187 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 188 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 189 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 190 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 220 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 221 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 222 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 223 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 224 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 225 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 226 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 227 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 228 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 229 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 230 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 231 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 253 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 254 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 261 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 268 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 273 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.24 |
| Metatranscriptomes | 0 |
| Isolates | 0.76 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.78 |
| Nodule | 0 |
| Rhizoplane | 7.61 |
| Rhizosphere | 89.34 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.27 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25165J46597_1004255 | 3300003214 | Bacteria | 3146 |
| 2 | JGI25165J46597_1005490 | 3300003214 | Bacteria | 2431 |
| 3 | Ga0070676_10125182 | 3300005328 | Bacteria | 1618 |
| 4 | Ga0070683_100333614 | 3300005329 | Bacteria | 1444 |
| 5 | Ga0070690_100002469 | 3300005330 | Bacteria | 9944 |
| 6 | Ga0070670_100004802 | 3300005331 | Bacteria | 11346 |
| 7 | Ga0070670_100010109 | 3300005331 | Bacteria | 8049 |
| 8 | Ga0068869_100195670 | 3300005334 | Bacteria | 1592 |
| 9 | Ga0070680_100002239 | 3300005336 | Bacteria | 14265 |
| 10 | Ga0070680_100323615 | 3300005336 | Unclassified | 1309 |
| 11 | Ga0070682_100000739 | 3300005337 | Bacteria | 19554 |
| 12 | Ga0068868_100065451 | 3300005338 | Bacteria | 2888 |
| 13 | Ga0070660_100004563 | 3300005339 | Bacteria | 9576 |
| 14 | Ga0070689_100020546 | 3300005340 | Bacteria | 4902 |
| 15 | Ga0070689_100021466 | 3300005340 | Bacteria | 4808 |
| 16 | Ga0070691_10001230 | 3300005341 | Bacteria | 10786 |
| 17 | Ga0070687_100041666 | 3300005343 | Bacteria | 2321 |
| 18 | Ga0070661_100000594 | 3300005344 | Bacteria | 27156 |
| 19 | Ga0070692_10000131 | 3300005345 | Bacteria | 17808 |
| 20 | Ga0070668_100000672 | 3300005347 | Bacteria | 23195 |
| 21 | Ga0070668_100056531 | 3300005347 | Bacteria | 3031 |
| 22 | Ga0070669_100012818 | 3300005353 | Bacteria | 5953 |
| 23 | Ga0070675_100031837 | 3300005354 | Bacteria | 4265 |
| 24 | Ga0070675_100111107 | 3300005354 | Bacteria | 2319 |
| 25 | Ga0070671_100004459 | 3300005355 | Bacteria | 11082 |
| 26 | Ga0070671_100010916 | 3300005355 | Bacteria | 7295 |
| 27 | Ga0070674_100000551 | 3300005356 | Bacteria | 18799 |
| 28 | Ga0070673_100003383 | 3300005364 | Bacteria | 9924 |
| 29 | Ga0070673_100006352 | 3300005364 | Bacteria | 7679 |
| 30 | Ga0070688_100000261 | 3300005365 | Bacteria | 27517 |
| 31 | Ga0070659_100311993 | 3300005366 | Bacteria | 1313 |
| 32 | Ga0070667_100000309 | 3300005367 | Bacteria | 54617 |
| 33 | Ga0070703_10001582 | 3300005406 | Bacteria | 6771 |
| 34 | Ga0070709_10006269 | 3300005434 | Bacteria | 6477 |
| 35 | Ga0070714_100004416 | 3300005435 | Bacteria | 10585 |
| 36 | Ga0070713_100095651 | 3300005436 | Bacteria | 2563 |
| 37 | Ga0070710_10001969 | 3300005437 | Bacteria | 9735 |
| 38 | Ga0070701_10000109 | 3300005438 | Bacteria | 23593 |
| 39 | Ga0070711_100001710 | 3300005439 | Bacteria | 12161 |
| 40 | Ga0070705_100000306 | 3300005440 | Bacteria | 28990 |
| 41 | Ga0070705_100177025 | 3300005440 | Bacteria | 1441 |
| 42 | Ga0070700_100000858 | 3300005441 | Bacteria | 15009 |
| 43 | Ga0070694_100000201 | 3300005444 | Bacteria | 31692 |
| 44 | Ga0070663_100002080 | 3300005455 | Bacteria | 11187 |
| 45 | Ga0070678_100000371 | 3300005456 | Bacteria | 20997 |
| 46 | Ga0070662_100003173 | 3300005457 | Bacteria | 10217 |
| 47 | Ga0070681_10063733 | 3300005458 | Bacteria | 3658 |
| 48 | Ga0070685_10002693 | 3300005466 | Bacteria | 9095 |
| 49 | Ga0070699_100183010 | 3300005518 | Bacteria | 1860 |
| 50 | Ga0070697_100102878 | 3300005536 | Bacteria | 2374 |
| 51 | Ga0068853_100008006 | 3300005539 | Bacteria | 8477 |
| 52 | Ga0068853_100009809 | 3300005539 | Bacteria | 7727 |
| 53 | Ga0070672_100009393 | 3300005543 | Bacteria | 6741 |
| 54 | Ga0070686_100009433 | 3300005544 | Bacteria | 5487 |
| 55 | Ga0070695_100002621 | 3300005545 | Bacteria | 10395 |
| 56 | Ga0070696_100203668 | 3300005546 | Bacteria | 1478 |
| 57 | Ga0070693_100000082 | 3300005547 | Bacteria | 39617 |
| 58 | Ga0070665_100038317 | 3300005548 | Bacteria | 4819 |
| 59 | Ga0070704_100004752 | 3300005549 | Bacteria | 7861 |
| 60 | Ga0068855_100011575 | 3300005563 | Bacteria | 10655 |
| 61 | Ga0068855_100046570 | 3300005563 | Bacteria | 5126 |
| 62 | Ga0070664_100007238 | 3300005564 | Bacteria | 8949 |
| 63 | Ga0068854_100001020 | 3300005578 | Bacteria | 16803 |
| 64 | Ga0068856_100005453 | 3300005614 | Bacteria | 12532 |
| 65 | Ga0070702_100005932 | 3300005615 | Bacteria | 5739 |
| 66 | Ga0068852_100004381 | 3300005616 | Bacteria | 9976 |
| 67 | Ga0068859_100017666 | 3300005617 | Bacteria | 7171 |
| 68 | Ga0068859_100140464 | 3300005617 | Bacteria | 2489 |
| 69 | Ga0068866_10001833 | 3300005718 | Bacteria | 8934 |
| 70 | Ga0068861_100000793 | 3300005719 | Bacteria | 19034 |
| 71 | Ga0068863_100008742 | 3300005841 | Bacteria | 9890 |
| 72 | Ga0068858_100018181 | 3300005842 | Bacteria | 6584 |
| 73 | Ga0068860_100008473 | 3300005843 | Bacteria | 10247 |
| 74 | Ga0081455_10002618 | 3300005937 | Bacteria | 21329 |
| 75 | Ga0081455_10003018 | 3300005937 | Bacteria | 19627 |
| 76 | Ga0081455_10065441 | 3300005937 | Bacteria | 3040 |
| 77 | Ga0081538_10032336 | 3300005981 | Bacteria | 3508 |
| 78 | Ga0081540_1000140 | 3300005983 | Bacteria | 75770 |
| 79 | Ga0081539_10063112 | 3300005985 | Bacteria | 2023 |
| 80 | Ga0070717_10186107 | 3300006028 | Bacteria | 1812 |
| 81 | Ga0075363_100052618 | 3300006048 | Bacteria | 2174 |
| 82 | Ga0070715_10000268 | 3300006163 | Bacteria | 12528 |
| 83 | Ga0070716_100000735 | 3300006173 | Bacteria | 13984 |
| 84 | Ga0070712_100000481 | 3300006175 | Bacteria | 22814 |
| 85 | Ga0070712_100049290 | 3300006175 | Bacteria | 2924 |
| 86 | Ga0097621_100091657 | 3300006237 | Bacteria | 2544 |
| 87 | Ga0075428_100046681 | 3300006844 | Bacteria | 4757 |
| 88 | Ga0075428_100048450 | 3300006844 | Bacteria | 4664 |
| 89 | Ga0075431_100024636 | 3300006847 | Bacteria | 6169 |
| 90 | Ga0075433_10036517 | 3300006852 | Bacteria | 4234 |
| 91 | Ga0075433_10053682 | 3300006852 | Bacteria | 3514 |
| 92 | Ga0075434_100046032 | 3300006871 | Bacteria | 4329 |
| 93 | Ga0075434_100092056 | 3300006871 | Bacteria | 3034 |
| 94 | Ga0075434_100207542 | 3300006871 | Bacteria | 1980 |
| 95 | Ga0075429_100012885 | 3300006880 | Bacteria | 7255 |
| 96 | Ga0068865_100004493 | 3300006881 | Bacteria | 8421 |
| 97 | Ga0068865_100052427 | 3300006881 | Bacteria | 2827 |
| 98 | Ga0075436_100004532 | 3300006914 | Bacteria | 9523 |
| 99 | Ga0097620_100017666 | 3300006931 | Bacteria | 7171 |
| 100 | Ga0097620_100140467 | 3300006931 | Bacteria | 2489 |
| 101 | Ga0075435_100038302 | 3300007076 | Bacteria | 3822 |
| 102 | Ga0105250_10005576 | 3300009092 | Bacteria | 5629 |
| 103 | Ga0105240_10010367 | 3300009093 | Bacteria | 13111 |
| 104 | Ga0111539_10043059 | 3300009094 | Bacteria | 5416 |
| 105 | Ga0111539_10184963 | 3300009094 | Unclassified | 2433 |
| 106 | Ga0105245_10001377 | 3300009098 | Bacteria | 22006 |
| 107 | Ga0105247_10025828 | 3300009101 | Bacteria | 3545 |
| 108 | Ga0114129_10118426 | 3300009147 | Bacteria | 3648 |
| 109 | Ga0114129_10252788 | 3300009147 | Bacteria | 2365 |
| 110 | Ga0105243_10000688 | 3300009148 | Bacteria | 32874 |
| 111 | Ga0105243_10143384 | 3300009148 | Bacteria | 2041 |
| 112 | Ga0105241_10000949 | 3300009174 | Bacteria | 21950 |
| 113 | Ga0105242_10026344 | 3300009176 | Bacteria | 4608 |
| 114 | Ga0105248_10018034 | 3300009177 | Bacteria | 7791 |
| 115 | Ga0105248_10085248 | 3300009177 | Bacteria | 3555 |
| 116 | Ga0105237_10000091 | 3300009545 | Bacteria | 122477 |
| 117 | Ga0105237_10001143 | 3300009545 | Bacteria | 35677 |
| 118 | Ga0105238_10408840 | 3300009551 | Bacteria | 1351 |
| 119 | Ga0105249_10002187 | 3300009553 | Bacteria | 16923 |
| 120 | Ga0099796_10013354 | 3300010159 | Bacteria | 2344 |
| 121 | Ga0105239_10000793 | 3300010375 | Bacteria | 44855 |
| 122 | Ga0105246_10004905 | 3300011119 | Bacteria | 8153 |
| 123 | Ga0157371_10002294 | 3300013102 | Bacteria | 18437 |
| 124 | Ga0157369_10006075 | 3300013105 | Bacteria | 14017 |
| 125 | Ga0157374_10007065 | 3300013296 | Bacteria | 9559 |
| 126 | Ga0157378_10001300 | 3300013297 | Bacteria | 22460 |
| 127 | Ga0157378_10011799 | 3300013297 | Bacteria | 7651 |
| 128 | Ga0163162_10009653 | 3300013306 | Bacteria | 9384 |
| 129 | Ga0157372_10009779 | 3300013307 | Bacteria | 10199 |
| 130 | Ga0157372_10232035 | 3300013307 | Bacteria | 2140 |
| 131 | Ga0157375_10030328 | 3300013308 | Bacteria | 5098 |
| 132 | Ga0157375_10183121 | 3300013308 | Bacteria | 2247 |
| 133 | Ga0163163_10001334 | 3300014325 | Bacteria | 20814 |
| 134 | Ga0163163_10127423 | 3300014325 | Bacteria | 2584 |
| 135 | Ga0157380_10000175 | 3300014326 | Bacteria | 37121 |
| 136 | Ga0157380_10135374 | 3300014326 | Bacteria | 2108 |
| 137 | Ga0157377_10000263 | 3300014745 | Bacteria | 25807 |
| 138 | Ga0157379_10028495 | 3300014968 | Bacteria | 4967 |
| 139 | Ga0157379_10039780 | 3300014968 | Bacteria | 4195 |
| 140 | Ga0157379_10075177 | 3300014968 | Bacteria | 3024 |
| 141 | Ga0157376_10000424 | 3300014969 | Bacteria | 27368 |
| 142 | Ga0228598_1006331 | 3300024227 | Bacteria | 2453 |
| 143 | Ga0209233_1002249 | 3300025261 | Bacteria | 7214 |
| 144 | Ga0209051_1060797 | 3300025303 | Bacteria | 1190 |
| 145 | Ga0207653_10011837 | 3300025885 | Bacteria | 2722 |
| 146 | Ga0207692_10009303 | 3300025898 | Bacteria | 4097 |
| 147 | Ga0207710_10002075 | 3300025900 | Bacteria | 9497 |
| 148 | Ga0207710_10062610 | 3300025900 | Bacteria | 1691 |
| 149 | Ga0207688_10016085 | 3300025901 | Bacteria | 4056 |
| 150 | Ga0207647_10012365 | 3300025904 | Bacteria | 5943 |
| 151 | Ga0207685_10032633 | 3300025905 | Bacteria | 1875 |
| 152 | Ga0207699_10087382 | 3300025906 | Bacteria | 1949 |
| 153 | Ga0207645_10007622 | 3300025907 | Bacteria | 7628 |
| 154 | Ga0207707_10088021 | 3300025912 | Bacteria | 2713 |
| 155 | Ga0207671_10000095 | 3300025914 | Bacteria | 137647 |
| 156 | Ga0207693_10000207 | 3300025915 | Bacteria | 53977 |
| 157 | Ga0207693_10026374 | 3300025915 | Bacteria | 4599 |
| 158 | Ga0207663_10020349 | 3300025916 | Bacteria | 3756 |
| 159 | Ga0207662_10039394 | 3300025918 | Bacteria | 2772 |
| 160 | Ga0207657_10000526 | 3300025919 | Bacteria | 40560 |
| 161 | Ga0207649_10001659 | 3300025920 | Bacteria | 12873 |
| 162 | Ga0207652_10029852 | 3300025921 | Bacteria | 4563 |
| 163 | Ga0207694_10109214 | 3300025924 | Bacteria | 2199 |
| 164 | Ga0207650_10041986 | 3300025925 | Bacteria | 3354 |
| 165 | Ga0207659_10006974 | 3300025926 | Bacteria | 6942 |
| 166 | Ga0207659_10047134 | 3300025926 | Bacteria | 3047 |
| 167 | Ga0207687_10034125 | 3300025927 | Bacteria | 3454 |
| 168 | Ga0207700_10073826 | 3300025928 | Bacteria | 2636 |
| 169 | Ga0207664_10004150 | 3300025929 | Bacteria | 9777 |
| 170 | Ga0207664_10013592 | 3300025929 | Bacteria | 5850 |
| 171 | Ga0207664_10179595 | 3300025929 | Bacteria | 1816 |
| 172 | Ga0207644_10003302 | 3300025931 | Bacteria | 10425 |
| 173 | Ga0207706_10000148 | 3300025933 | Bacteria | 76563 |
| 174 | Ga0207706_10279835 | 3300025933 | Bacteria | 1455 |
| 175 | Ga0207706_10374554 | 3300025933 | Bacteria | 1236 |
| 176 | Ga0207686_10018799 | 3300025934 | Bacteria | 3918 |
| 177 | Ga0207670_10008519 | 3300025936 | Bacteria | 5794 |
| 178 | Ga0207669_10013854 | 3300025937 | Bacteria | 4023 |
| 179 | Ga0207704_10014035 | 3300025938 | Bacteria | 4034 |
| 180 | Ga0207665_10000294 | 3300025939 | Bacteria | 34482 |
| 181 | Ga0207691_10007366 | 3300025940 | Bacteria | 10602 |
| 182 | Ga0207691_10053786 | 3300025940 | Bacteria | 3674 |
| 183 | Ga0207689_10198858 | 3300025942 | Bacteria | 1654 |
| 184 | Ga0207651_10006602 | 3300025960 | Bacteria | 6094 |
| 185 | Ga0207651_10231122 | 3300025960 | Bacteria | 1501 |
| 186 | Ga0207712_10004341 | 3300025961 | Bacteria | 8956 |
| 187 | Ga0207668_10045053 | 3300025972 | Bacteria | 3006 |
| 188 | Ga0207668_10105471 | 3300025972 | Bacteria | 2103 |
| 189 | Ga0207640_10012113 | 3300025981 | Bacteria | 4903 |
| 190 | Ga0207658_10005086 | 3300025986 | Bacteria | 9046 |
| 191 | Ga0207658_10106360 | 3300025986 | Bacteria | 2209 |
| 192 | Ga0207677_10049131 | 3300026023 | Bacteria | 2845 |
| 193 | Ga0207703_10119759 | 3300026035 | Bacteria | 2258 |
| 194 | Ga0207639_10005527 | 3300026041 | Bacteria | 8543 |
| 195 | Ga0207639_10126035 | 3300026041 | Bacteria | 2112 |
| 196 | Ga0207678_10000415 | 3300026067 | Bacteria | 38523 |
| 197 | Ga0207708_10000685 | 3300026075 | Bacteria | 25730 |
| 198 | Ga0207708_10032807 | 3300026075 | Bacteria | 3943 |
| 199 | Ga0207708_10059109 | 3300026075 | Bacteria | 2926 |
| 200 | Ga0207641_10246635 | 3300026088 | Bacteria | 1666 |
| 201 | Ga0207676_10012142 | 3300026095 | Bacteria | 6165 |
| 202 | Ga0207674_10000211 | 3300026116 | Bacteria | 71986 |
| 203 | Ga0207675_100000491 | 3300026118 | Bacteria | 38393 |
| 204 | Ga0207683_10001381 | 3300026121 | Bacteria | 21885 |
| 205 | Ga0207683_10271779 | 3300026121 | Bacteria | 1548 |
| 206 | Ga0207698_10228915 | 3300026142 | Bacteria | 1686 |
| 207 | Ga0209998_10005522 | 3300027717 | Bacteria | 2642 |
| 208 | Ga0207428_10019758 | 3300027907 | Bacteria | 5740 |
| 209 | Ga0207428_10061935 | 3300027907 | Unclassified | 2960 |
| 210 | Ga0207428_10172913 | 3300027907 | Bacteria | 1635 |
| 211 | Ga0268266_10000417 | 3300028379 | Bacteria | 64608 |
| 212 | Ga0268266_10099273 | 3300028379 | Bacteria | 2563 |
| 213 | Ga0268266_10415001 | 3300028379 | Bacteria | 1275 |
| 214 | Ga0268265_10031760 | 3300028380 | Bacteria | 3816 |
| 215 | Ga0307515_10016569 | 3300028794 | Bacteria | 13487 |
| 216 | Ga0265338_10009328 | 3300028800 | Bacteria | 11724 |
| 217 | Ga0265325_10003068 | 3300031241 | Bacteria | 11034 |
| 218 | Ga0265339_10000077 | 3300031249 | Bacteria | 84288 |
| 219 | Ga0307408_100148568 | 3300031548 | Bacteria | 1848 |
| 220 | Ga0265313_10003775 | 3300031595 | Bacteria | 12021 |
| 221 | Ga0265314_10024265 | 3300031711 | Bacteria | 4600 |
| 222 | Ga0307414_10169391 | 3300032004 | Bacteria | 1744 |
| 223 | Ga0373943_0118734 | 3300035170 | Bacteria | 1403 |
| 224 | Ga0373946_0046901 | 3300035171 | Bacteria | 1793 |
| 225 | Ga0373924_0044939 | 3300035410 | Bacteria | 1816 |
| 226 | Ga0373931_0004600 | 3300035691 | Bacteria | 6313 |
| 227 | Ga0373935_0036221 | 3300035692 | Bacteria | 3084 |
| 228 | Ga0373927_0010783 | 3300035695 | Bacteria | 6088 |
| 229 | Ga0373947_0203401 | 3300035725 | Bacteria | 1296 |
| 230 | Ga0373937_0092032 | 3300036401 | Bacteria | 2810 |
| 231 | Ga0373937_0227118 | 3300036401 | Bacteria | 1757 |
| 232 | Ga0373925_0011939 | 3300037068 | Bacteria | 6287 |
| 233 | Ga0373925_0116845 | 3300037068 | Bacteria | 2067 |
| 234 | Ga0395899_0041881 | 3300037312 | Bacteria | 3420 |
| 235 | Ga0395900_0003365 | 3300037418 | Bacteria | 17264 |
| 236 | Ga0395898_0062434 | 3300037466 | Bacteria | 3618 |
| 237 | Ga0395898_0105307 | 3300037466 | Bacteria | 2705 |
| 238 | Ga0395905_0001231 | 3300037471 | Bacteria | 31814 |
| 239 | Ga0436364_0081063 | 3300037853 | Bacteria | 4309 |
| 240 | Ga0436364_1040518 | 3300037853 | Bacteria | 5065 |
| 241 | Ga0395901_0021692 | 3300038443 | Bacteria | 6581 |
| 242 | Ga0395901_0429982 | 3300038443 | Bacteria | 1353 |
| 243 | Ga0395901_0780280 | 3300038443 | Bacteria | 946 |
| 244 | Ga0436361_0052829 | 3300039447 | Bacteria | 3937 |
| 245 | Ga0451576_0073736 | 3300045051 | Bacteria | 3552 |
| 246 | Ga0495603_0000375 | 3300046455 | Bacteria | 24256 |
| 247 | Ga0495629_0000807 | 3300046459 | Bacteria | 25356 |
| 248 | Ga0495641_0017868 | 3300046461 | Bacteria | 3677 |
| 249 | Ga0495653_0035452 | 3300046463 | Bacteria | 3937 |
| 250 | Ga0495582_0000367 | 3300046473 | Bacteria | 24654 |
| 251 | Ga0495639_0022657 | 3300046475 | Bacteria | 2756 |
| 252 | Ga0495594_0000732 | 3300046499 | Bacteria | 16836 |
| 253 | Ga0495628_0174173 | 3300046516 | Bacteria | 1630 |
| 254 | Ga0495652_0037153 | 3300046529 | Bacteria | 4227 |
| 255 | Ga0495665_0007419 | 3300046531 | Bacteria | 5930 |
| 256 | Ga0495640_0156588 | 3300046533 | Bacteria | 1462 |
| 257 | Ga0495622_0000605 | 3300046557 | Bacteria | 20910 |
| 258 | Ga0495633_0061343 | 3300046558 | Unclassified | 1761 |
| 259 | Ga0495667_0032653 | 3300046559 | Bacteria | 3487 |
| 260 | Ga0495634_0006507 | 3300046642 | Bacteria | 8873 |
| 261 | Ga0495635_0099151 | 3300046663 | Bacteria | 1991 |
| 262 | Ga0495588_0011667 | 3300046674 | Bacteria | 4130 |
| 263 | Ga0495647_0004319 | 3300046681 | Bacteria | 4606 |
| 264 | Ga0495658_0000669 | 3300046683 | Bacteria | 18610 |
| 265 | Ga0495613_0000290 | 3300046689 | Bacteria | 46122 |
| 266 | Ga0495600_0174110 | 3300046809 | Unclassified | 1388 |
| 267 | Ga0495581_0014567 | 3300047315 | Bacteria | 4559 |
| 268 | Ga0495604_0151756 | 3300047317 | Unclassified | 1645 |
| 269 | Ga0495680_0044165 | 3300047322 | Bacteria | 3525 |
| 270 | Ga0495680_0066169 | 3300047322 | Bacteria | 2766 |
| 271 | Ga0495675_0024665 | 3300047444 | Bacteria | 3835 |
| 272 | Ga0495593_0000102 | 3300047673 | Bacteria | 38953 |
| 273 | Ga0495593_0116440 | 3300047673 | Bacteria | 1362 |
| 274 | Ga0495602_0103589 | 3300048088 | Bacteria | 2329 |
| 275 | Ga0495614_0000209 | 3300048089 | Bacteria | 22625 |
| 276 | Ga0496100_0022423 | 3300048903 | Bacteria | 3821 |
| 277 | Ga0496100_0046615 | 3300048903 | Bacteria | 2788 |
| 278 | Ga0496101_0010529 | 3300048904 | Bacteria | 6108 |
| 279 | Ga0496102_0042933 | 3300048905 | Bacteria | 4098 |
| 280 | Ga0496102_0068281 | 3300048905 | Bacteria | 3261 |
| 281 | Ga0496102_0108938 | 3300048905 | Bacteria | 2580 |
| 282 | Ga0496102_0172018 | 3300048905 | Bacteria | 2039 |
| 283 | Ga0496103_0029310 | 3300048906 | Bacteria | 3344 |
| 284 | Ga0496103_0074128 | 3300048906 | Bacteria | 2133 |
| 285 | Ga0496104_0021423 | 3300048907 | Bacteria | 5933 |
| 286 | Ga0496104_0127866 | 3300048907 | Bacteria | 2440 |
| 287 | Ga0496104_0402863 | 3300048907 | Unclassified | 1280 |
| 288 | Ga0496105_0015202 | 3300048908 | Bacteria | 6129 |
| 289 | Ga0496105_0160360 | 3300048908 | Bacteria | 1846 |
| 290 | Ga0496106_0151031 | 3300048909 | Unclassified | 1832 |
| 291 | Ga0496107_0005754 | 3300048910 | Bacteria | 8480 |
| 292 | Ga0496107_0063802 | 3300048910 | Bacteria | 2670 |
| 293 | Ga0496107_0093504 | 3300048910 | Bacteria | 2198 |
| 294 | Ga0496107_0233547 | 3300048910 | Bacteria | 1368 |
| 295 | Ga0496108_0200154 | 3300048911 | Bacteria | 1733 |
| 296 | Ga0496109_0021027 | 3300048912 | Bacteria | 5769 |
| 297 | Ga0496109_0201442 | 3300048912 | Bacteria | 1871 |
| 298 | Ga0496110_0225431 | 3300048913 | Bacteria | 1704 |
| 299 | Ga0496112_0005010 | 3300048915 | Bacteria | 11368 |
| 300 | Ga0496112_0012848 | 3300048915 | Bacteria | 7708 |
| 301 | Ga0496112_0020346 | 3300048915 | Bacteria | 6289 |
| 302 | Ga0496112_0328165 | 3300048915 | Unclassified | 1474 |
| 303 | Ga0496113_0005712 | 3300048916 | Bacteria | 7793 |
| 304 | Ga0496113_0200022 | 3300048916 | Bacteria | 1588 |
| 305 | Ga0496113_0245500 | 3300048916 | Bacteria | 1429 |
| 306 | Ga0501032_0045338 | 3300049569 | Bacteria | 2974 |
| 307 | Ga0501036_0063018 | 3300049572 | Bacteria | 3140 |
| 308 | Ga0501036_0079959 | 3300049572 | Bacteria | 2764 |
| 309 | Ga0501036_0248737 | 3300049572 | Bacteria | 1490 |
| 310 | Ga0501037_0037913 | 3300049573 | Bacteria | 3553 |
| 311 | Ga0501038_0028667 | 3300049574 | Bacteria | 4945 |
| 312 | Ga0501038_0270605 | 3300049574 | Bacteria | 1340 |
| 313 | Ga0501039_0015961 | 3300049575 | Bacteria | 5750 |
| 314 | Ga0501040_0006480 | 3300049576 | Bacteria | 7603 |
| 315 | Ga0501040_0072739 | 3300049576 | Bacteria | 2375 |
| 316 | Ga0501041_0029785 | 3300049577 | Bacteria | 3293 |
| 317 | Ga0501042_0034911 | 3300049578 | Bacteria | 3567 |
| 318 | Ga0501043_0033119 | 3300049579 | Bacteria | 4065 |
| 319 | Ga0501046_0063401 | 3300049580 | Bacteria | 2886 |
| 320 | Ga0501046_0259073 | 3300049580 | Bacteria | 1278 |
| 321 | Ga0501047_0131569 | 3300049581 | Bacteria | 2382 |
| 322 | Ga0501047_0155269 | 3300049581 | Bacteria | 2162 |
| 323 | Ga0501048_0039711 | 3300049582 | Bacteria | 3374 |
| 324 | Ga0501069_0130684 | 3300049585 | Bacteria | 1438 |
| 325 | Ga0501070_0105490 | 3300049586 | Bacteria | 2330 |
| 326 | Ga0501071_0017346 | 3300049587 | Bacteria | 4963 |
| 327 | Ga0501071_0042814 | 3300049587 | Bacteria | 3245 |
| 328 | Ga0501071_0077240 | 3300049587 | Bacteria | 2432 |
| 329 | Ga0501072_0041723 | 3300049588 | Bacteria | 3604 |
| 330 | Ga0501072_0052702 | 3300049588 | Bacteria | 3203 |
| 331 | Ga0501072_0105013 | 3300049588 | Bacteria | 2246 |
| 332 | Ga0501072_0163218 | 3300049588 | Bacteria | 1777 |
| 333 | Ga0501073_0040660 | 3300049589 | Bacteria | 3289 |
| 334 | Ga0501074_0020221 | 3300049590 | Bacteria | 4837 |
| 335 | Ga0501075_0010117 | 3300049591 | Bacteria | 6617 |
| 336 | Ga0501075_0017268 | 3300049591 | Bacteria | 5211 |
| 337 | Ga0501075_0085277 | 3300049591 | Bacteria | 2393 |
| 338 | Ga0501075_0318133 | 3300049591 | Bacteria | 1186 |
| 339 | Ga0501076_0016311 | 3300049592 | Bacteria | 5631 |
| 340 | Ga0501076_0101330 | 3300049592 | Bacteria | 2321 |
| 341 | Ga0501076_0137943 | 3300049592 | Bacteria | 1981 |
| 342 | Ga0501077_0024119 | 3300049593 | Bacteria | 3861 |
| 343 | Ga0501077_0029954 | 3300049593 | Bacteria | 3462 |
| 344 | Ga0501077_0031614 | 3300049593 | Bacteria | 3369 |
| 345 | Ga0501198_000012 | 3300049649 | Bacteria | 113529 |
| 346 | Ga0501222_000010 | 3300049662 | Bacteria | 113536 |
| 347 | Ga0501079_0009321 | 3300049741 | Bacteria | 7439 |
| 348 | Ga0501079_0037633 | 3300049741 | Bacteria | 3729 |
| 349 | Ga0501079_0070257 | 3300049741 | Bacteria | 2704 |
| 350 | Ga0501079_0089608 | 3300049741 | Bacteria | 2382 |
| 351 | Ga0501079_0232810 | 3300049741 | Bacteria | 1439 |
| 352 | Ga0501080_0143762 | 3300049742 | Bacteria | 2205 |
| 353 | Ga0501080_0165420 | 3300049742 | Bacteria | 2041 |
| 354 | Ga0501080_0180333 | 3300049742 | Bacteria | 1944 |
| 355 | Ga0501080_0619800 | 3300049742 | Bacteria | 959 |
| 356 | Ga0501081_0010917 | 3300049743 | Bacteria | 5937 |
| 357 | Ga0501081_0017206 | 3300049743 | Bacteria | 4782 |
| 358 | Ga0501081_0049533 | 3300049743 | Bacteria | 2893 |
| 359 | Ga0501035_0066047 | 3300049822 | Bacteria | 3211 |
| 360 | Ga0501044_0159229 | 3300049823 | Bacteria | 2236 |
| 361 | Ga0501044_0324265 | 3300049823 | Bacteria | 1464 |
| 362 | Ga0501045_0013684 | 3300049824 | Bacteria | 5735 |
| 363 | Ga0501045_0015374 | 3300049824 | Bacteria | 5433 |
| 364 | Ga0501045_0040784 | 3300049824 | Bacteria | 3376 |
| 365 | Ga0501045_0097524 | 3300049824 | Bacteria | 2175 |
| 366 | Ga0501045_0155430 | 3300049824 | Bacteria | 1702 |
| 367 | Ga0501045_0169590 | 3300049824 | Bacteria | 1626 |
| 368 | nmdc:mga03n38_119169_c1 | 3300050490 | Bacteria | 1295 |
| 369 | nmdc:mga06r32_101912_c1 | 3300050510 | Bacteria | 2818 |
| 370 | nmdc:mga08y16_255118_c1 | 3300050511 | Bacteria | 1812 |
| 371 | nmdc:mga08y16_26430_c1 | 3300050511 | Bacteria | 6121 |
| 372 | nmdc:mga0n895_144633_c1 | 3300050512 | Bacteria | 2407 |
| 373 | nmdc:mga0n895_62624_c1 | 3300050512 | Bacteria | 3677 |
| 374 | nmdc:mga0n895_72985_c1 | 3300050512 | Bacteria | 3406 |
| 375 | nmdc:mga0rr50_224723_c1 | 3300050513 | Bacteria | 1552 |
| 376 | nmdc:mga08x19_106607_c1 | 3300050514 | Bacteria | 1865 |
| 377 | nmdc:mga0a205_8874_c1 | 3300050515 | Bacteria | 9158 |
| 378 | nmdc:mga0sz30_43838_c1 | 3300050516 | Bacteria | 1884 |
| 379 | Ga0495655_0019270 | 3300053083 | Unclassified | 1512 |
| 380 | Ga0495619_0001533 | 3300053085 | Bacteria | 15223 |
| 381 | Ga0501084_0045578 | 3300054114 | Bacteria | 3672 |
| 382 | Ga0501084_0098157 | 3300054114 | Bacteria | 2459 |
| 383 | Ga0501084_0108499 | 3300054114 | Bacteria | 2332 |
| 384 | Ga0501084_0389923 | 3300054114 | Bacteria | 1177 |
| 385 | Ga0501082_0018188 | 3300060353 | Bacteria | 6051 |
| 386 | Ga0501082_0069028 | 3300060353 | Bacteria | 3043 |
| 387 | Ga0501082_0315549 | 3300060353 | Bacteria | 1361 |
| 388 | Ga0501082_0385306 | 3300060353 | Bacteria | 1223 |
| 389 | Ga0530510_0034344 | 3300061734 | Bacteria | 3653 |
| 390 | Ga0530510_0052427 | 3300061734 | Bacteria | 2947 |
| 391 | Ga0530510_0170000 | 3300061734 | Bacteria | 1614 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300038443 | Ga0395901_0780280 | Ga0395901_0780280_63_932 | 289 |
| 2 | 3300049742 | Ga0501080_0619800 | Ga0501080_0619800_19_924 | 301 |
| 3 | 3300045051 | Ga0451576_0073736 | Ga0451576_0073736_1841_2878 | 306 |
| 4 | 3300049741 | Ga0501079_0232810 | Ga0501079_0232810_20_976 | 306 |
| 5 | 3300006048 | Ga0075363_100052618 | Ga0075363_1000526182 | 310 |
| 6 | 3300050490 | nmdc:mga03n38_119169_c1 | nmdc:mga03n38_119169_c1_16_1017 | 310 |
| 7 | 3300036401 | Ga0373937_0227118 | Ga0373937_0227118_687_1682 | 311 |
| 8 | 3300028800 | Ga0265338_10009328 | Ga0265338_1000932810 | 316 |
| 9 | 3300031241 | Ga0265325_10003068 | Ga0265325_100030686 | 316 |
| 10 | 3300031249 | Ga0265339_10000077 | Ga0265339_1000007723 | 316 |
| 11 | 3300031595 | Ga0265313_10003775 | Ga0265313_100037757 | 316 |
| 12 | 3300049591 | Ga0501075_0085277 | Ga0501075_0085277_742_1740 | 316 |
| 13 | 3300054114 | Ga0501084_0045578 | Ga0501084_0045578_2508_3506 | 316 |
| 14 | 3300010159 | Ga0099796_10013354 | Ga0099796_100133541 | 317 |
| 15 | 3300039447 | Ga0436361_0052829 | Ga0436361_0052829_207_1211 | 318 |
| 16 | 3300049581 | Ga0501047_0155269 | Ga0501047_0155269_72_1076 | 318 |
| 17 | 3300025929 | Ga0207664_10179595 | Ga0207664_101795952 | 319 |
| 18 | 3300028794 | Ga0307515_10016569 | Ga0307515_100165695 | 320 |
| 19 | 3300031711 | Ga0265314_10024265 | Ga0265314_100242652 | 320 |
| 20 | 3300005985 | Ga0081539_10063112 | Ga0081539_100631122 | 321 |
| 21 | 3300009147 | Ga0114129_10252788 | Ga0114129_102527882 | 321 |
| 22 | 3300037853 | Ga0436364_0081063 | Ga0436364_0081063_887_1891 | 321 |
| 23 | 3300037068 | Ga0373925_0116845 | Ga0373925_0116845_589_1605 | 324 |
| 24 | 3300047673 | Ga0495593_0116440 | Ga0495593_0116440_29_1045 | 324 |
| 25 | 3300050516 | nmdc:mga0sz30_43838_c1 | nmdc:mga0sz30_43838_c1_747_1724 | 325 |
| 26 | 3300005981 | Ga0081538_10032336 | Ga0081538_100323363 | 328 |
| 27 | 3300049824 | Ga0501045_0155430 | Ga0501045_0155430_571_1644 | 328 |
| 28 | 3300005331 | Ga0070670_100010109 | Ga0070670_1000101094 | 332 |
| 29 | 3300005340 | Ga0070689_100021466 | Ga0070689_1000214663 | 332 |
| 30 | 3300005354 | Ga0070675_100111107 | Ga0070675_1001111073 | 332 |
| 31 | 3300005355 | Ga0070671_100010916 | Ga0070671_1000109166 | 332 |
| 32 | 3300005364 | Ga0070673_100006352 | Ga0070673_1000063528 | 332 |
| 33 | 3300005440 | Ga0070705_100177025 | Ga0070705_1001770251 | 332 |
| 34 | 3300014325 | Ga0163163_10127423 | Ga0163163_101274233 | 332 |
| 35 | 3300025926 | Ga0207659_10047134 | Ga0207659_100471342 | 332 |
| 36 | 3300025928 | Ga0207700_10073826 | Ga0207700_100738262 | 332 |
| 37 | 3300025931 | Ga0207644_10003302 | Ga0207644_1000330210 | 332 |
| 38 | 3300025933 | Ga0207706_10374554 | Ga0207706_103745542 | 332 |
| 39 | 3300025960 | Ga0207651_10231122 | Ga0207651_102311221 | 332 |
| 40 | 3300037853 | Ga0436364_1040518 | Ga0436364_1040518_248_1246 | 332 |
| 41 | 3300048905 | Ga0496102_0172018 | Ga0496102_0172018_50_1048 | 332 |
| 42 | 3300048907 | Ga0496104_0127866 | Ga0496104_0127866_993_1991 | 332 |
| 43 | 3300048915 | Ga0496112_0020346 | Ga0496112_0020346_2030_3028 | 332 |
| 44 | 3300048916 | Ga0496113_0200022 | Ga0496113_0200022_316_1314 | 332 |
| 45 | 3300048916 | Ga0496113_0245500 | Ga0496113_0245500_216_1214 | 332 |
| 46 | 3300035410 | Ga0373924_0044939 | Ga0373924_0044939_312_1313 | 333 |
| 47 | 3300036401 | Ga0373937_0092032 | Ga0373937_0092032_388_1389 | 333 |
| 48 | 3300046529 | Ga0495652_0037153 | Ga0495652_0037153_3019_4020 | 333 |
| 49 | 3300046559 | Ga0495667_0032653 | Ga0495667_0032653_1155_2156 | 333 |
| 50 | 3300046663 | Ga0495635_0099151 | Ga0495635_0099151_374_1375 | 333 |
| 51 | 3300046809 | Ga0495600_0174110 | Ga0495600_0174110_228_1229 | 333 |
| 52 | 3300047317 | Ga0495604_0151756 | Ga0495604_0151756_389_1390 | 333 |
| 53 | 3300047322 | Ga0495680_0066169 | Ga0495680_0066169_503_1504 | 333 |
| 54 | 3300006871 | Ga0075434_100207542 | Ga0075434_1002075422 | 334 |
| 55 | 3300009094 | Ga0111539_10184963 | Ga0111539_101849633 | 334 |
| 56 | 3300027907 | Ga0207428_10172913 | Ga0207428_101729132 | 334 |
| 57 | 3300049822 | Ga0501035_0066047 | Ga0501035_0066047_1842_2846 | 334 |
| 58 | 3300050511 | nmdc:mga08y16_255118_c1 | nmdc:mga08y16_255118_c1_566_1570 | 334 |
| 59 | 3300049576 | Ga0501040_0072739 | Ga0501040_0072739_370_1377 | 335 |
| 60 | 3300005983 | Ga0081540_1000140 | Ga0081540_100014044 | 336 |
| 61 | 3300006028 | Ga0070717_10186107 | Ga0070717_101861071 | 336 |
| 62 | 3300006871 | Ga0075434_100092056 | Ga0075434_1000920562 | 336 |
| 63 | 3300024227 | Ga0228598_1006331 | Ga0228598_10063313 | 336 |
| 64 | 3300025929 | Ga0207664_10013592 | Ga0207664_100135924 | 336 |
| 65 | 3300046463 | Ga0495653_0035452 | Ga0495653_0035452_1429_2439 | 336 |
| 66 | 3300046516 | Ga0495628_0174173 | Ga0495628_0174173_473_1483 | 336 |
| 67 | 3300046533 | Ga0495640_0156588 | Ga0495640_0156588_308_1318 | 336 |
| 68 | 3300047444 | Ga0495675_0024665 | Ga0495675_0024665_2197_3207 | 336 |
| 69 | 3300048088 | Ga0495602_0103589 | Ga0495602_0103589_217_1227 | 336 |
| 70 | 3300048906 | Ga0496103_0074128 | Ga0496103_0074128_301_1365 | 336 |
| 71 | 3300050512 | nmdc:mga0n895_72985_c1 | nmdc:mga0n895_72985_c1_670_1692 | 336 |
| 72 | 3300049823 | Ga0501044_0324265 | Ga0501044_0324265_327_1448 | 337 |
| 73 | iso_pu_bacteria | 2511231221 | 2512034594 | 337 |
| 74 | iso_pu_bacteria | 8054002106 | 8054003882 | 337 |
| 75 | 3300005937 | Ga0081455_10065441 | Ga0081455_100654412 | 338 |
| 76 | 3300006844 | Ga0075428_100046681 | Ga0075428_1000466813 | 338 |
| 77 | 3300049572 | Ga0501036_0248737 | Ga0501036_0248737_400_1425 | 338 |
| 78 | 3300005328 | Ga0070676_10125182 | Ga0070676_101251822 | 339 |
| 79 | 3300005329 | Ga0070683_100333614 | Ga0070683_1003336142 | 339 |
| 80 | 3300005330 | Ga0070690_100002469 | Ga0070690_1000024697 | 339 |
| 81 | 3300005331 | Ga0070670_100004802 | Ga0070670_1000048026 | 339 |
| 82 | 3300005334 | Ga0068869_100195670 | Ga0068869_1001956702 | 339 |
| 83 | 3300005336 | Ga0070680_100002239 | Ga0070680_10000223918 | 339 |
| 84 | 3300005336 | Ga0070680_100323615 | Ga0070680_1003236151 | 339 |
| 85 | 3300005337 | Ga0070682_100000739 | Ga0070682_1000007392 | 339 |
| 86 | 3300005338 | Ga0068868_100065451 | Ga0068868_1000654512 | 339 |
| 87 | 3300005339 | Ga0070660_100004563 | Ga0070660_1000045634 | 339 |
| 88 | 3300005340 | Ga0070689_100020546 | Ga0070689_1000205462 | 339 |
| 89 | 3300005341 | Ga0070691_10001230 | Ga0070691_100012307 | 339 |
| 90 | 3300005343 | Ga0070687_100041666 | Ga0070687_1000416662 | 339 |
| 91 | 3300005344 | Ga0070661_100000594 | Ga0070661_1000005948 | 339 |
| 92 | 3300005345 | Ga0070692_10000131 | Ga0070692_100001313 | 339 |
| 93 | 3300005347 | Ga0070668_100000672 | Ga0070668_1000006722 | 339 |
| 94 | 3300005347 | Ga0070668_100056531 | Ga0070668_1000565313 | 339 |
| 95 | 3300005353 | Ga0070669_100012818 | Ga0070669_1000128182 | 339 |
| 96 | 3300005354 | Ga0070675_100031837 | Ga0070675_1000318374 | 339 |
| 97 | 3300005355 | Ga0070671_100004459 | Ga0070671_1000044595 | 339 |
| 98 | 3300005356 | Ga0070674_100000551 | Ga0070674_1000005518 | 339 |
| 99 | 3300005364 | Ga0070673_100003383 | Ga0070673_1000033832 | 339 |
| 100 | 3300005365 | Ga0070688_100000261 | Ga0070688_10000026124 | 339 |
| 101 | 3300005366 | Ga0070659_100311993 | Ga0070659_1003119931 | 339 |
| 102 | 3300005367 | Ga0070667_100000309 | Ga0070667_10000030943 | 339 |
| 103 | 3300005406 | Ga0070703_10001582 | Ga0070703_100015822 | 339 |
| 104 | 3300005434 | Ga0070709_10006269 | Ga0070709_100062693 | 339 |
| 105 | 3300005435 | Ga0070714_100004416 | Ga0070714_10000441613 | 339 |
| 106 | 3300005436 | Ga0070713_100095651 | Ga0070713_1000956512 | 339 |
| 107 | 3300005437 | Ga0070710_10001969 | Ga0070710_1000196913 | 339 |
| 108 | 3300005438 | Ga0070701_10000109 | Ga0070701_1000010915 | 339 |
| 109 | 3300005439 | Ga0070711_100001710 | Ga0070711_1000017107 | 339 |
| 110 | 3300005440 | Ga0070705_100000306 | Ga0070705_1000003067 | 339 |
| 111 | 3300005441 | Ga0070700_100000858 | Ga0070700_1000008582 | 339 |
| 112 | 3300005444 | Ga0070694_100000201 | Ga0070694_10000020119 | 339 |
| 113 | 3300005455 | Ga0070663_100002080 | Ga0070663_1000020807 | 339 |
| 114 | 3300005456 | Ga0070678_100000371 | Ga0070678_10000037118 | 339 |
| 115 | 3300005457 | Ga0070662_100003173 | Ga0070662_1000031736 | 339 |
| 116 | 3300005458 | Ga0070681_10063733 | Ga0070681_100637332 | 339 |
| 117 | 3300005466 | Ga0070685_10002693 | Ga0070685_100026937 | 339 |
| 118 | 3300005518 | Ga0070699_100183010 | Ga0070699_1001830102 | 339 |
| 119 | 3300005536 | Ga0070697_100102878 | Ga0070697_1001028782 | 339 |
| 120 | 3300005539 | Ga0068853_100009809 | Ga0068853_1000098092 | 339 |
| 121 | 3300005543 | Ga0070672_100009393 | Ga0070672_1000093934 | 339 |
| 122 | 3300005544 | Ga0070686_100009433 | Ga0070686_1000094336 | 339 |
| 123 | 3300005545 | Ga0070695_100002621 | Ga0070695_1000026213 | 339 |
| 124 | 3300005546 | Ga0070696_100203668 | Ga0070696_1002036682 | 339 |
| 125 | 3300005547 | Ga0070693_100000082 | Ga0070693_10000008216 | 339 |
| 126 | 3300005549 | Ga0070704_100004752 | Ga0070704_1000047522 | 339 |
| 127 | 3300005563 | Ga0068855_100011575 | Ga0068855_1000115752 | 339 |
| 128 | 3300005564 | Ga0070664_100007238 | Ga0070664_1000072383 | 339 |
| 129 | 3300005578 | Ga0068854_100001020 | Ga0068854_10000102012 | 339 |
| 130 | 3300005614 | Ga0068856_100005453 | Ga0068856_1000054537 | 339 |
| 131 | 3300005615 | Ga0070702_100005932 | Ga0070702_1000059325 | 339 |
| 132 | 3300005616 | Ga0068852_100004381 | Ga0068852_1000043817 | 339 |
| 133 | 3300005617 | Ga0068859_100017666 | Ga0068859_1000176666 | 339 |
| 134 | 3300005617 | Ga0068859_100140464 | Ga0068859_1001404643 | 339 |
| 135 | 3300005718 | Ga0068866_10001833 | Ga0068866_100018337 | 339 |
| 136 | 3300005719 | Ga0068861_100000793 | Ga0068861_10000079319 | 339 |
| 137 | 3300005841 | Ga0068863_100008742 | Ga0068863_1000087427 | 339 |
| 138 | 3300005842 | Ga0068858_100018181 | Ga0068858_1000181816 | 339 |
| 139 | 3300005843 | Ga0068860_100008473 | Ga0068860_1000084736 | 339 |
| 140 | 3300005937 | Ga0081455_10002618 | Ga0081455_100026188 | 339 |
| 141 | 3300005937 | Ga0081455_10003018 | Ga0081455_100030188 | 339 |
| 142 | 3300006163 | Ga0070715_10000268 | Ga0070715_100002683 | 339 |
| 143 | 3300006173 | Ga0070716_100000735 | Ga0070716_10000073513 | 339 |
| 144 | 3300006175 | Ga0070712_100000481 | Ga0070712_1000004817 | 339 |
| 145 | 3300006175 | Ga0070712_100049290 | Ga0070712_1000492903 | 339 |
| 146 | 3300006237 | Ga0097621_100091657 | Ga0097621_1000916572 | 339 |
| 147 | 3300006844 | Ga0075428_100048450 | Ga0075428_1000484507 | 339 |
| 148 | 3300006847 | Ga0075431_100024636 | Ga0075431_1000246365 | 339 |
| 149 | 3300006852 | Ga0075433_10036517 | Ga0075433_100365175 | 339 |
| 150 | 3300006852 | Ga0075433_10053682 | Ga0075433_100536822 | 339 |
| 151 | 3300006871 | Ga0075434_100046032 | Ga0075434_1000460323 | 339 |
| 152 | 3300006880 | Ga0075429_100012885 | Ga0075429_1000128853 | 339 |
| 153 | 3300006881 | Ga0068865_100004493 | Ga0068865_1000044936 | 339 |
| 154 | 3300006881 | Ga0068865_100052427 | Ga0068865_1000524273 | 339 |
| 155 | 3300006914 | Ga0075436_100004532 | Ga0075436_10000453214 | 339 |
| 156 | 3300006931 | Ga0097620_100017666 | Ga0097620_1000176666 | 339 |
| 157 | 3300006931 | Ga0097620_100140467 | Ga0097620_1001404673 | 339 |
| 158 | 3300007076 | Ga0075435_100038302 | Ga0075435_1000383023 | 339 |
| 159 | 3300009092 | Ga0105250_10005576 | Ga0105250_100055763 | 339 |
| 160 | 3300009093 | Ga0105240_10010367 | Ga0105240_1001036714 | 339 |
| 161 | 3300009094 | Ga0111539_10043059 | Ga0111539_100430597 | 339 |
| 162 | 3300009098 | Ga0105245_10001377 | Ga0105245_100013776 | 339 |
| 163 | 3300009101 | Ga0105247_10025828 | Ga0105247_100258282 | 339 |
| 164 | 3300009147 | Ga0114129_10118426 | Ga0114129_101184262 | 339 |
| 165 | 3300009148 | Ga0105243_10000688 | Ga0105243_1000068816 | 339 |
| 166 | 3300009148 | Ga0105243_10143384 | Ga0105243_101433843 | 339 |
| 167 | 3300009174 | Ga0105241_10000949 | Ga0105241_100009499 | 339 |
| 168 | 3300009176 | Ga0105242_10026344 | Ga0105242_100263442 | 339 |
| 169 | 3300009177 | Ga0105248_10018034 | Ga0105248_100180344 | 339 |
| 170 | 3300009177 | Ga0105248_10085248 | Ga0105248_100852482 | 339 |
| 171 | 3300009545 | Ga0105237_10001143 | Ga0105237_100011439 | 339 |
| 172 | 3300009551 | Ga0105238_10408840 | Ga0105238_104088402 | 339 |
| 173 | 3300009553 | Ga0105249_10002187 | Ga0105249_100021879 | 339 |
| 174 | 3300011119 | Ga0105246_10004905 | Ga0105246_100049052 | 339 |
| 175 | 3300013102 | Ga0157371_10002294 | Ga0157371_1000229418 | 339 |
| 176 | 3300013105 | Ga0157369_10006075 | Ga0157369_100060755 | 339 |
| 177 | 3300013296 | Ga0157374_10007065 | Ga0157374_100070654 | 339 |
| 178 | 3300013297 | Ga0157378_10001300 | Ga0157378_100013008 | 339 |
| 179 | 3300013297 | Ga0157378_10011799 | Ga0157378_100117998 | 339 |
| 180 | 3300013306 | Ga0163162_10009653 | Ga0163162_100096532 | 339 |
| 181 | 3300013307 | Ga0157372_10009779 | Ga0157372_1000977914 | 339 |
| 182 | 3300013307 | Ga0157372_10232035 | Ga0157372_102320353 | 339 |
| 183 | 3300013308 | Ga0157375_10030328 | Ga0157375_100303282 | 339 |
| 184 | 3300013308 | Ga0157375_10183121 | Ga0157375_101831212 | 339 |
| 185 | 3300014325 | Ga0163163_10001334 | Ga0163163_100013346 | 339 |
| 186 | 3300014326 | Ga0157380_10000175 | Ga0157380_1000017511 | 339 |
| 187 | 3300014326 | Ga0157380_10135374 | Ga0157380_101353742 | 339 |
| 188 | 3300014745 | Ga0157377_10000263 | Ga0157377_1000026324 | 339 |
| 189 | 3300014968 | Ga0157379_10028495 | Ga0157379_100284956 | 339 |
| 190 | 3300014968 | Ga0157379_10039780 | Ga0157379_100397805 | 339 |
| 191 | 3300014968 | Ga0157379_10075177 | Ga0157379_100751772 | 339 |
| 192 | 3300014969 | Ga0157376_10000424 | Ga0157376_1000042418 | 339 |
| 193 | 3300025885 | Ga0207653_10011837 | Ga0207653_100118372 | 339 |
| 194 | 3300025898 | Ga0207692_10009303 | Ga0207692_100093032 | 339 |
| 195 | 3300025900 | Ga0207710_10002075 | Ga0207710_100020755 | 339 |
| 196 | 3300025900 | Ga0207710_10062610 | Ga0207710_100626102 | 339 |
| 197 | 3300025901 | Ga0207688_10016085 | Ga0207688_100160852 | 339 |
| 198 | 3300025904 | Ga0207647_10012365 | Ga0207647_100123653 | 339 |
| 199 | 3300025905 | Ga0207685_10032633 | Ga0207685_100326332 | 339 |
| 200 | 3300025906 | Ga0207699_10087382 | Ga0207699_100873822 | 339 |
| 201 | 3300025907 | Ga0207645_10007622 | Ga0207645_100076229 | 339 |
| 202 | 3300025912 | Ga0207707_10088021 | Ga0207707_100880213 | 339 |
| 203 | 3300025915 | Ga0207693_10000207 | Ga0207693_1000020734 | 339 |
| 204 | 3300025915 | Ga0207693_10026374 | Ga0207693_100263743 | 339 |
| 205 | 3300025916 | Ga0207663_10020349 | Ga0207663_100203492 | 339 |
| 206 | 3300025918 | Ga0207662_10039394 | Ga0207662_100393942 | 339 |
| 207 | 3300025919 | Ga0207657_10000526 | Ga0207657_100005267 | 339 |
| 208 | 3300025920 | Ga0207649_10001659 | Ga0207649_100016599 | 339 |
| 209 | 3300025921 | Ga0207652_10029852 | Ga0207652_100298524 | 339 |
| 210 | 3300025924 | Ga0207694_10109214 | Ga0207694_101092142 | 339 |
| 211 | 3300025925 | Ga0207650_10041986 | Ga0207650_100419863 | 339 |
| 212 | 3300025926 | Ga0207659_10006974 | Ga0207659_100069747 | 339 |
| 213 | 3300025927 | Ga0207687_10034125 | Ga0207687_100341252 | 339 |
| 214 | 3300025929 | Ga0207664_10004150 | Ga0207664_100041503 | 339 |
| 215 | 3300025933 | Ga0207706_10000148 | Ga0207706_1000014833 | 339 |
| 216 | 3300025933 | Ga0207706_10279835 | Ga0207706_102798351 | 339 |
| 217 | 3300025934 | Ga0207686_10018799 | Ga0207686_100187994 | 339 |
| 218 | 3300025936 | Ga0207670_10008519 | Ga0207670_100085193 | 339 |
| 219 | 3300025937 | Ga0207669_10013854 | Ga0207669_100138542 | 339 |
| 220 | 3300025938 | Ga0207704_10014035 | Ga0207704_100140355 | 339 |
| 221 | 3300025939 | Ga0207665_10000294 | Ga0207665_1000029421 | 339 |
| 222 | 3300025940 | Ga0207691_10007366 | Ga0207691_100073664 | 339 |
| 223 | 3300025940 | Ga0207691_10053786 | Ga0207691_100537863 | 339 |
| 224 | 3300025942 | Ga0207689_10198858 | Ga0207689_101988582 | 339 |
| 225 | 3300025960 | Ga0207651_10006602 | Ga0207651_100066022 | 339 |
| 226 | 3300025961 | Ga0207712_10004341 | Ga0207712_100043416 | 339 |
| 227 | 3300025972 | Ga0207668_10045053 | Ga0207668_100450532 | 339 |
| 228 | 3300025972 | Ga0207668_10105471 | Ga0207668_101054712 | 339 |
| 229 | 3300025981 | Ga0207640_10012113 | Ga0207640_100121132 | 339 |
| 230 | 3300025986 | Ga0207658_10005086 | Ga0207658_100050869 | 339 |
| 231 | 3300025986 | Ga0207658_10106360 | Ga0207658_101063602 | 339 |
| 232 | 3300026023 | Ga0207677_10049131 | Ga0207677_100491312 | 339 |
| 233 | 3300026035 | Ga0207703_10119759 | Ga0207703_101197592 | 339 |
| 234 | 3300026041 | Ga0207639_10126035 | Ga0207639_101260352 | 339 |
| 235 | 3300026067 | Ga0207678_10000415 | Ga0207678_100004157 | 339 |
| 236 | 3300026075 | Ga0207708_10000685 | Ga0207708_1000068528 | 339 |
| 237 | 3300026075 | Ga0207708_10032807 | Ga0207708_100328071 | 339 |
| 238 | 3300026075 | Ga0207708_10059109 | Ga0207708_100591092 | 339 |
| 239 | 3300026088 | Ga0207641_10246635 | Ga0207641_102466352 | 339 |
| 240 | 3300026095 | Ga0207676_10012142 | Ga0207676_100121425 | 339 |
| 241 | 3300026116 | Ga0207674_10000211 | Ga0207674_1000021140 | 339 |
| 242 | 3300026118 | Ga0207675_100000491 | Ga0207675_10000049121 | 339 |
| 243 | 3300026121 | Ga0207683_10001381 | Ga0207683_1000138118 | 339 |
| 244 | 3300026121 | Ga0207683_10271779 | Ga0207683_102717791 | 339 |
| 245 | 3300026142 | Ga0207698_10228915 | Ga0207698_102289152 | 339 |
| 246 | 3300027717 | Ga0209998_10005522 | Ga0209998_100055222 | 339 |
| 247 | 3300027907 | Ga0207428_10019758 | Ga0207428_100197586 | 339 |
| 248 | 3300027907 | Ga0207428_10061935 | Ga0207428_100619352 | 339 |
| 249 | 3300028379 | Ga0268266_10099273 | Ga0268266_100992732 | 339 |
| 250 | 3300028379 | Ga0268266_10415001 | Ga0268266_104150012 | 339 |
| 251 | 3300028380 | Ga0268265_10031760 | Ga0268265_100317603 | 339 |
| 252 | 3300032004 | Ga0307414_10169391 | Ga0307414_101693912 | 339 |
| 253 | 3300035170 | Ga0373943_0118734 | Ga0373943_0118734_254_1300 | 339 |
| 254 | 3300035171 | Ga0373946_0046901 | Ga0373946_0046901_174_1220 | 339 |
| 255 | 3300035691 | Ga0373931_0004600 | Ga0373931_0004600_2260_3327 | 339 |
| 256 | 3300035692 | Ga0373935_0036221 | Ga0373935_0036221_854_1900 | 339 |
| 257 | 3300035695 | Ga0373927_0010783 | Ga0373927_0010783_4973_6019 | 339 |
| 258 | 3300035725 | Ga0373947_0203401 | Ga0373947_0203401_136_1182 | 339 |
| 259 | 3300037068 | Ga0373925_0011939 | Ga0373925_0011939_4944_5990 | 339 |
| 260 | 3300037418 | Ga0395900_0003365 | Ga0395900_0003365_14381_15448 | 339 |
| 261 | 3300037466 | Ga0395898_0062434 | Ga0395898_0062434_1092_2159 | 339 |
| 262 | 3300037471 | Ga0395905_0001231 | Ga0395905_0001231_13854_14921 | 339 |
| 263 | 3300038443 | Ga0395901_0021692 | Ga0395901_0021692_5203_6270 | 339 |
| 264 | 3300046455 | Ga0495603_0000375 | Ga0495603_0000375_2011_3057 | 339 |
| 265 | 3300046459 | Ga0495629_0000807 | Ga0495629_0000807_23241_24287 | 339 |
| 266 | 3300046461 | Ga0495641_0017868 | Ga0495641_0017868_528_1574 | 339 |
| 267 | 3300046473 | Ga0495582_0000367 | Ga0495582_0000367_5289_6335 | 339 |
| 268 | 3300046475 | Ga0495639_0022657 | Ga0495639_0022657_1444_2490 | 339 |
| 269 | 3300046499 | Ga0495594_0000732 | Ga0495594_0000732_5329_6375 | 339 |
| 270 | 3300046531 | Ga0495665_0007419 | Ga0495665_0007419_945_1991 | 339 |
| 271 | 3300046557 | Ga0495622_0000605 | Ga0495622_0000605_10979_12025 | 339 |
| 272 | 3300046558 | Ga0495633_0061343 | Ga0495633_0061343_292_1359 | 339 |
| 273 | 3300046642 | Ga0495634_0006507 | Ga0495634_0006507_1217_2263 | 339 |
| 274 | 3300046674 | Ga0495588_0011667 | Ga0495588_0011667_2116_3162 | 339 |
| 275 | 3300046681 | Ga0495647_0004319 | Ga0495647_0004319_1725_2771 | 339 |
| 276 | 3300046683 | Ga0495658_0000669 | Ga0495658_0000669_1966_3012 | 339 |
| 277 | 3300046689 | Ga0495613_0000290 | Ga0495613_0000290_1656_2702 | 339 |
| 278 | 3300047315 | Ga0495581_0014567 | Ga0495581_0014567_2946_3992 | 339 |
| 279 | 3300047322 | Ga0495680_0044165 | Ga0495680_0044165_244_1290 | 339 |
| 280 | 3300047673 | Ga0495593_0000102 | Ga0495593_0000102_35879_36925 | 339 |
| 281 | 3300048089 | Ga0495614_0000209 | Ga0495614_0000209_8209_9255 | 339 |
| 282 | 3300048903 | Ga0496100_0022423 | Ga0496100_0022423_660_1733 | 339 |
| 283 | 3300048903 | Ga0496100_0046615 | Ga0496100_0046615_1476_2543 | 339 |
| 284 | 3300048904 | Ga0496101_0010529 | Ga0496101_0010529_3303_4376 | 339 |
| 285 | 3300048905 | Ga0496102_0042933 | Ga0496102_0042933_1294_2367 | 339 |
| 286 | 3300048905 | Ga0496102_0068281 | Ga0496102_0068281_954_2009 | 339 |
| 287 | 3300048905 | Ga0496102_0108938 | Ga0496102_0108938_840_1907 | 339 |
| 288 | 3300048906 | Ga0496103_0029310 | Ga0496103_0029310_802_1869 | 339 |
| 289 | 3300048907 | Ga0496104_0021423 | Ga0496104_0021423_4493_5560 | 339 |
| 290 | 3300048907 | Ga0496104_0402863 | Ga0496104_0402863_16_1056 | 339 |
| 291 | 3300048908 | Ga0496105_0015202 | Ga0496105_0015202_1585_2658 | 339 |
| 292 | 3300048908 | Ga0496105_0160360 | Ga0496105_0160360_94_1233 | 339 |
| 293 | 3300048909 | Ga0496106_0151031 | Ga0496106_0151031_343_1398 | 339 |
| 294 | 3300048910 | Ga0496107_0005754 | Ga0496107_0005754_1374_2447 | 339 |
| 295 | 3300048910 | Ga0496107_0063802 | Ga0496107_0063802_1525_2565 | 339 |
| 296 | 3300048910 | Ga0496107_0093504 | Ga0496107_0093504_686_1753 | 339 |
| 297 | 3300048910 | Ga0496107_0233547 | Ga0496107_0233547_95_1150 | 339 |
| 298 | 3300048911 | Ga0496108_0200154 | Ga0496108_0200154_272_1345 | 339 |
| 299 | 3300048912 | Ga0496109_0021027 | Ga0496109_0021027_1137_2204 | 339 |
| 300 | 3300048912 | Ga0496109_0201442 | Ga0496109_0201442_388_1461 | 339 |
| 301 | 3300048913 | Ga0496110_0225431 | Ga0496110_0225431_501_1631 | 339 |
| 302 | 3300048915 | Ga0496112_0005010 | Ga0496112_0005010_9032_10072 | 339 |
| 303 | 3300048915 | Ga0496112_0012848 | Ga0496112_0012848_614_1681 | 339 |
| 304 | 3300048915 | Ga0496112_0328165 | Ga0496112_0328165_123_1163 | 339 |
| 305 | 3300048916 | Ga0496113_0005712 | Ga0496113_0005712_2195_3268 | 339 |
| 306 | 3300049572 | Ga0501036_0063018 | Ga0501036_0063018_612_1676 | 339 |
| 307 | 3300049572 | Ga0501036_0079959 | Ga0501036_0079959_174_1241 | 339 |
| 308 | 3300049573 | Ga0501037_0037913 | Ga0501037_0037913_1015_2079 | 339 |
| 309 | 3300049574 | Ga0501038_0028667 | Ga0501038_0028667_1429_2493 | 339 |
| 310 | 3300049574 | Ga0501038_0270605 | Ga0501038_0270605_142_1197 | 339 |
| 311 | 3300049575 | Ga0501039_0015961 | Ga0501039_0015961_3095_4159 | 339 |
| 312 | 3300049576 | Ga0501040_0006480 | Ga0501040_0006480_3559_4623 | 339 |
| 313 | 3300049577 | Ga0501041_0029785 | Ga0501041_0029785_1905_2969 | 339 |
| 314 | 3300049578 | Ga0501042_0034911 | Ga0501042_0034911_850_1914 | 339 |
| 315 | 3300049579 | Ga0501043_0033119 | Ga0501043_0033119_1933_2997 | 339 |
| 316 | 3300049580 | Ga0501046_0063401 | Ga0501046_0063401_1262_2329 | 339 |
| 317 | 3300049580 | Ga0501046_0259073 | Ga0501046_0259073_146_1210 | 339 |
| 318 | 3300049582 | Ga0501048_0039711 | Ga0501048_0039711_1432_2496 | 339 |
| 319 | 3300049585 | Ga0501069_0130684 | Ga0501069_0130684_269_1333 | 339 |
| 320 | 3300049586 | Ga0501070_0105490 | Ga0501070_0105490_1150_2214 | 339 |
| 321 | 3300049587 | Ga0501071_0017346 | Ga0501071_0017346_1854_2918 | 339 |
| 322 | 3300049587 | Ga0501071_0042814 | Ga0501071_0042814_1602_2666 | 339 |
| 323 | 3300049587 | Ga0501071_0077240 | Ga0501071_0077240_357_1424 | 339 |
| 324 | 3300049588 | Ga0501072_0041723 | Ga0501072_0041723_594_1658 | 339 |
| 325 | 3300049588 | Ga0501072_0052702 | Ga0501072_0052702_889_1944 | 339 |
| 326 | 3300049588 | Ga0501072_0105013 | Ga0501072_0105013_1129_2193 | 339 |
| 327 | 3300049588 | Ga0501072_0163218 | Ga0501072_0163218_469_1536 | 339 |
| 328 | 3300049589 | Ga0501073_0040660 | Ga0501073_0040660_1962_3026 | 339 |
| 329 | 3300049590 | Ga0501074_0020221 | Ga0501074_0020221_1456_2520 | 339 |
| 330 | 3300049591 | Ga0501075_0010117 | Ga0501075_0010117_2852_3916 | 339 |
| 331 | 3300049591 | Ga0501075_0017268 | Ga0501075_0017268_2883_3950 | 339 |
| 332 | 3300049591 | Ga0501075_0318133 | Ga0501075_0318133_82_1143 | 339 |
| 333 | 3300049592 | Ga0501076_0016311 | Ga0501076_0016311_2507_3571 | 339 |
| 334 | 3300049592 | Ga0501076_0101330 | Ga0501076_0101330_350_1405 | 339 |
| 335 | 3300049592 | Ga0501076_0137943 | Ga0501076_0137943_219_1289 | 339 |
| 336 | 3300049593 | Ga0501077_0024119 | Ga0501077_0024119_2088_3152 | 339 |
| 337 | 3300049593 | Ga0501077_0029954 | Ga0501077_0029954_2320_3384 | 339 |
| 338 | 3300049593 | Ga0501077_0031614 | Ga0501077_0031614_399_1463 | 339 |
| 339 | 3300049649 | Ga0501198_000012 | Ga0501198_000012_97775_98827 | 339 |
| 340 | 3300049662 | Ga0501222_000010 | Ga0501222_000010_97781_98833 | 339 |
| 341 | 3300049741 | Ga0501079_0009321 | Ga0501079_0009321_1548_2603 | 339 |
| 342 | 3300049741 | Ga0501079_0037633 | Ga0501079_0037633_1916_2980 | 339 |
| 343 | 3300049741 | Ga0501079_0070257 | Ga0501079_0070257_1396_2460 | 339 |
| 344 | 3300049741 | Ga0501079_0089608 | Ga0501079_0089608_976_2040 | 339 |
| 345 | 3300049742 | Ga0501080_0143762 | Ga0501080_0143762_201_1265 | 339 |
| 346 | 3300049742 | Ga0501080_0165420 | Ga0501080_0165420_535_1599 | 339 |
| 347 | 3300049742 | Ga0501080_0180333 | Ga0501080_0180333_357_1424 | 339 |
| 348 | 3300049743 | Ga0501081_0010917 | Ga0501081_0010917_3099_4163 | 339 |
| 349 | 3300049743 | Ga0501081_0017206 | Ga0501081_0017206_1409_2473 | 339 |
| 350 | 3300049743 | Ga0501081_0049533 | Ga0501081_0049533_662_1726 | 339 |
| 351 | 3300049823 | Ga0501044_0159229 | Ga0501044_0159229_541_1605 | 339 |
| 352 | 3300049824 | Ga0501045_0013684 | Ga0501045_0013684_2022_3086 | 339 |
| 353 | 3300049824 | Ga0501045_0015374 | Ga0501045_0015374_3422_4489 | 339 |
| 354 | 3300049824 | Ga0501045_0040784 | Ga0501045_0040784_341_1405 | 339 |
| 355 | 3300049824 | Ga0501045_0097524 | Ga0501045_0097524_694_1752 | 339 |
| 356 | 3300049824 | Ga0501045_0169590 | Ga0501045_0169590_212_1273 | 339 |
| 357 | 3300050510 | nmdc:mga06r32_101912_c1 | nmdc:mga06r32_101912_c1_265_1332 | 339 |
| 358 | 3300050511 | nmdc:mga08y16_26430_c1 | nmdc:mga08y16_26430_c1_5043_6104 | 339 |
| 359 | 3300050512 | nmdc:mga0n895_144633_c1 | nmdc:mga0n895_144633_c1_968_2035 | 339 |
| 360 | 3300050512 | nmdc:mga0n895_62624_c1 | nmdc:mga0n895_62624_c1_1182_2243 | 339 |
| 361 | 3300050513 | nmdc:mga0rr50_224723_c1 | nmdc:mga0rr50_224723_c1_76_1143 | 339 |
| 362 | 3300050514 | nmdc:mga08x19_106607_c1 | nmdc:mga08x19_106607_c1_357_1424 | 339 |
| 363 | 3300050515 | nmdc:mga0a205_8874_c1 | nmdc:mga0a205_8874_c1_6886_7947 | 339 |
| 364 | 3300053083 | Ga0495655_0019270 | Ga0495655_0019270_294_1361 | 339 |
| 365 | 3300053085 | Ga0495619_0001533 | Ga0495619_0001533_11299_12345 | 339 |
| 366 | 3300054114 | Ga0501084_0098157 | Ga0501084_0098157_201_1265 | 339 |
| 367 | 3300054114 | Ga0501084_0108499 | Ga0501084_0108499_201_1268 | 339 |
| 368 | 3300054114 | Ga0501084_0389923 | Ga0501084_0389923_84_1157 | 339 |
| 369 | 3300060353 | Ga0501082_0018188 | Ga0501082_0018188_293_1357 | 339 |
| 370 | 3300060353 | Ga0501082_0069028 | Ga0501082_0069028_1506_2561 | 339 |
| 371 | 3300060353 | Ga0501082_0315549 | Ga0501082_0315549_40_1104 | 339 |
| 372 | 3300060353 | Ga0501082_0385306 | Ga0501082_0385306_34_1098 | 339 |
| 373 | 3300061734 | Ga0530510_0034344 | Ga0530510_0034344_2400_3473 | 339 |
| 374 | 3300061734 | Ga0530510_0052427 | Ga0530510_0052427_113_1168 | 339 |
| 375 | 3300061734 | Ga0530510_0170000 | Ga0530510_0170000_10_1074 | 339 |
| 376 | 3300005548 | Ga0070665_100038317 | Ga0070665_1000383174 | 340 |
| 377 | 3300009545 | Ga0105237_10000091 | Ga0105237_1000009125 | 340 |
| 378 | 3300010375 | Ga0105239_10000793 | Ga0105239_100007939 | 340 |
| 379 | 3300025914 | Ga0207671_10000095 | Ga0207671_1000009574 | 340 |
| 380 | 3300028379 | Ga0268266_10000417 | Ga0268266_1000041749 | 340 |
| 381 | 3300005539 | Ga0068853_100008006 | Ga0068853_1000080062 | 341 |
| 382 | 3300005563 | Ga0068855_100046570 | Ga0068855_1000465706 | 341 |
| 383 | 3300026041 | Ga0207639_10005527 | Ga0207639_100055272 | 341 |
| 384 | 3300037312 | Ga0395899_0041881 | Ga0395899_0041881_810_1835 | 341 |
| 385 | 3300037466 | Ga0395898_0105307 | Ga0395898_0105307_83_1123 | 341 |
| 386 | 3300038443 | Ga0395901_0429982 | Ga0395901_0429982_267_1307 | 341 |
| 387 | 3300049569 | Ga0501032_0045338 | Ga0501032_0045338_1261_2286 | 341 |
| 388 | 3300049581 | Ga0501047_0131569 | Ga0501047_0131569_557_1582 | 341 |
| 389 | 3300003214 | JGI25165J46597_1004255 | JGI25165J46597_10042554 | 342 |
| 390 | 3300003214 | JGI25165J46597_1005490 | JGI25165J46597_10054901 | 342 |
| 391 | 3300025261 | Ga0209233_1002249 | Ga0209233_10022493 | 342 |
| 392 | 3300025303 | Ga0209051_1060797 | Ga0209051_10607971 | 342 |
| 393 | 3300031548 | Ga0307408_100148568 | Ga0307408_1001485683 | 342 |
| 394 | iso_pu_bacteria | 2897803580 | 2897808628 | 342 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8col-assembly2.cif.gz_DDD | crystal structure of rhizobium etli constitutive l-asparaginase reaiv (orthorombic form r4op-2) | 0.9503 | 3 | 338 |
| 8col-assembly2.cif.gz_DDD | crystal structure of rhizobium etli constitutive l-asparaginase reaiv (orthorombic form r4op-2) | 0.9449 | 3 | 338 |
| 7os6-assembly2.cif.gz_AAA | crystal structure of rhizobium etli inducible l-asparaginase reav (monoclinic form mp1) | 0.9153 | 4 | 331 |
| 7os3-assembly1.cif.gz_AAA | crystal structure of rhizobium etli inducible l-asparaginase reav solved by s-sad (orthorhombic form start) | 0.9124 | 6 | 330 |
| 7os6-assembly1.cif.gz_CCC | crystal structure of rhizobium etli inducible l-asparaginase reav (monoclinic form mp1) | 0.9102 | 6 | 331 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4f3lA02 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain | 0.82 | 22 | 37 | 3.30.450.20 |
| af_Q9VZ85_1793_1984_2.30.29.30 | Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) | 0.6356 | 253 | 282 | 2.30.29.30 |
| af_Q86YR7_827_974_2.30.29.30 | Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) | 0.5623 | 253 | 278 | 2.30.29.30 |
| af_Q9LTJ6_57_381_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.5487 | 248 | 283 | 2.130.10.10 |
| 3ih9B01 | Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily | 0.5487 | 21 | 281 | 3.40.710.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A085FIS8-F1-model_v4 | L-asparaginase II | 0.9846 | 1 | 331 |
|
| AF-A0A2D8YKU0-F1-model_v4 | deleted | 0.9816 | 1 | 336 |
|
| AF-A0A085FIS8-F1-model_v4 | L-asparaginase II | 0.9787 | 1 | 331 |
|
| AF-A0A3D3SP59-F1-model_v4 | deleted | 0.9767 | 1 | 276 |
|
| AF-A0A504H937-F1-model_v4 | Asparaginase | 0.9734 | 3 | 295 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar