F432983

General Info

Members Datasets Scaffolds Average Seq Length
394 195 788 491

Family's Representative Sequence

Representative Sequence 3300044706|Ga0466964_0001198|Ga0466964_0001198_4957_6555
Length 532
Sequence MERKWRVLIVVCVAVFMLLLDITVVNVALPEIDKELSTSFTDLQWVVDAYALTLAATMLNAGSLGDLLGRKRVFLVAIALFTGASALCGAAQSPLWLILARGAQGIGGAGMFAVSLAIISQEFHGRERGTAFGIWGATVGMAVAIGPLVGGALTTYVGWRWIFFVNIPIGVACVAGGVRELHESRNEEHGGADLPGLLTWTGALFALVLGLFRGADWGWSSGRIIGLFAAAAVLLTAFVAIELRSRAPMLDLRLFRVPTFTGAQITAFVMSAGMFAQFLFLAVYLENVLGYSAVKTGVIFLPLSLVSFVVAPIAGRLSARMPVRILLGGGLAVIGVALLLMHGISLGSTWTTLLAGFILGGIGIGLVNAPLASTSVSVVEPRRAGMASGINNTFRQVGIATGIAALGAIFQSQIASYLTSVGLVQPFAGKLAQGIASGGGMKVGSGLVGQAFQNERGLTPNKIHLEELSRQSFIHGLNAILFVAAFVLFAGAILAFVLVRQRDFVASGPAAETATQSPAGGXXSATRAATRR

Samples

Sample ID Description Type Environment
1 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
51 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
84 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
85 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
86 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
87 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
88 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
89 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
90 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
91 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
92 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
93 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
94 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
95 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
96 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
97 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
98 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
99 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
100 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
101 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
102 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
103 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
104 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
105 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
113 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
114 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
115 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
116 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
117 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
118 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
119 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
120 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
121 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
122 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
123 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
124 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
125 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
126 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
127 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
128 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
129 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
130 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
131 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
132 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
133 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
134 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
135 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
136 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
137 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
138 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
139 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
140 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
141 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
142 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
143 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
144 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
145 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
146 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
147 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
148 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
149 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
150 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
151 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
152 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
153 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
154 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
155 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
156 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
157 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
158 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
159 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
160 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
161 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
179 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
180 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
181 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
182 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
183 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
184 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
185 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
186 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
187 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
188 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
189 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
190 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
191 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
192 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
193 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
194 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
195 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.49
Metatranscriptomes 0.51
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 12.18
Rhizosphere 87.82
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466964_0001198 3300044706 Bacteria 8768
2 Ga0070658_10034700 3300005327 Bacteria 4059
3 Ga0070683_100019154 3300005329 Bacteria 6075
4 Ga0070683_100041628 3300005329 Bacteria 4227
5 Ga0070683_100113482 3300005329 Bacteria 2558
6 Ga0068869_100031115 3300005334 Bacteria 3753
7 Ga0070680_100006365 3300005336 Bacteria 8969
8 Ga0070680_100040211 3300005336 Bacteria 3785
9 Ga0070680_100084043 3300005336 Bacteria 2629
10 Ga0070682_100023465 3300005337 Bacteria 3661
11 Ga0070682_100089920 3300005337 Bacteria 2006
12 Ga0068868_100006200 3300005338 Bacteria 8456
13 Ga0070660_100002706 3300005339 Bacteria 12171
14 Ga0070660_100015286 3300005339 Bacteria 5538
15 Ga0070660_100042908 3300005339 Bacteria 3454
16 Ga0070661_100073361 3300005344 Bacteria 2520
17 Ga0070661_100108787 3300005344 Bacteria 2068
18 Ga0070673_100106708 3300005364 Bacteria 2316
19 Ga0070659_100031108 3300005366 Bacteria 4133
20 Ga0070659_100059946 3300005366 Bacteria 3005
21 Ga0070709_10000689 3300005434 Bacteria 19202
22 Ga0070714_100006808 3300005435 Bacteria 8858
23 Ga0070714_100009619 3300005435 Bacteria 7609
24 Ga0070714_100026295 3300005435 Bacteria 4809
25 Ga0070714_100030091 3300005435 Bacteria 4518
26 Ga0070714_100039580 3300005435 Bacteria 3969
27 Ga0070714_100041812 3300005435 Bacteria 3870
28 Ga0070714_100057706 3300005435 Bacteria 3323
29 Ga0070714_100117590 3300005435 Bacteria 2361
30 Ga0070713_100008556 3300005436 Bacteria 7262
31 Ga0070713_100160933 3300005436 Bacteria 2004
32 Ga0070710_10003396 3300005437 Bacteria 7544
33 Ga0070710_10012260 3300005437 Bacteria 4251
34 Ga0070711_100007112 3300005439 Bacteria 6790
35 Ga0070711_100031482 3300005439 Bacteria 3522
36 Ga0070700_100002478 3300005441 Bacteria 9386
37 Ga0070663_100049366 3300005455 Bacteria 2988
38 Ga0070678_100125475 3300005456 Bacteria 2031
39 Ga0070678_100176525 3300005456 Bacteria 1745
40 Ga0070662_100014097 3300005457 Bacteria 5331
41 Ga0070681_10083330 3300005458 Bacteria 3151
42 Ga0070681_10093334 3300005458 Bacteria 2958
43 Ga0070707_100000126 3300005468 Bacteria 71727
44 Ga0070679_100002041 3300005530 Bacteria 18130
45 Ga0070679_100139435 3300005530 Bacteria 2405
46 Ga0070679_100162459 3300005530 Bacteria 2208
47 Ga0070679_100166551 3300005530 Bacteria 2177
48 Ga0070679_100190402 3300005530 Bacteria 2021
49 Ga0070679_100278957 3300005530 Bacteria 1624
50 Ga0070684_100009331 3300005535 Bacteria 7722
51 Ga0070684_100017101 3300005535 Bacteria 5945
52 Ga0070684_100024024 3300005535 Bacteria 5108
53 Ga0070684_100164899 3300005535 Bacteria 2011
54 Ga0070684_100193827 3300005535 Bacteria 1850
55 Ga0070695_100000007 3300005545 Bacteria 89343
56 Ga0068855_100027649 3300005563 Bacteria 6785
57 Ga0068855_100091677 3300005563 Bacteria 3505
58 Ga0068857_100114869 3300005577 Bacteria 2421
59 Ga0068854_100065542 3300005578 Bacteria 2641
60 Ga0068856_100007960 3300005614 Bacteria 10350
61 Ga0068856_100069893 3300005614 Bacteria 3472
62 Ga0068852_100036257 3300005616 Bacteria 4125
63 Ga0068852_100061539 3300005616 Bacteria 3263
64 Ga0081540_1012791 3300005983 Bacteria 5492
65 Ga0070717_10002838 3300006028 Bacteria 12277
66 Ga0070717_10109480 3300006028 Bacteria 2355
67 Ga0070716_100018442 3300006173 Bacteria 3636
68 Ga0075434_100018950 3300006871 Bacteria 6651
69 Ga0075434_100019806 3300006871 Bacteria 6514
70 Ga0075435_100011907 3300007076 Bacteria 6424
71 Ga0105240_10008296 3300009093 Bacteria 14868
72 Ga0105240_10013248 3300009093 Bacteria 11338
73 Ga0105245_10017903 3300009098 Bacteria 6186
74 Ga0105245_10065494 3300009098 Bacteria 3286
75 Ga0105245_10092857 3300009098 Bacteria 2780
76 Ga0105245_10111135 3300009098 Bacteria 2548
77 Ga0114129_10149127 3300009147 Bacteria 3201
78 Ga0105243_10018143 3300009148 Bacteria 5326
79 Ga0105248_10042955 3300009177 Bacteria 5069
80 Ga0105237_10013161 3300009545 Bacteria 8680
81 Ga0105238_10136802 3300009551 Bacteria 2427
82 Ga0105249_10079768 3300009553 Bacteria 3039
83 Ga0105239_10010709 3300010375 Bacteria 10244
84 Ga0157370_10048744 3300013104 Bacteria 4057
85 Ga0157370_10154544 3300013104 Bacteria 2135
86 Ga0157369_10074885 3300013105 Bacteria 3631
87 Ga0157369_10110219 3300013105 Bacteria 2926
88 Ga0157369_10193412 3300013105 Bacteria 2137
89 Ga0157374_10013766 3300013296 Bacteria 7065
90 Ga0157374_10032952 3300013296 Bacteria 4722
91 Ga0157372_10212546 3300013307 Bacteria 2242
92 Ga0157375_10010221 3300013308 Bacteria 8256
93 Ga0182008_10010112 3300014497 Bacteria 5061
94 Ga0182008_10085325 3300014497 Bacteria 1555
95 Ga0157377_10000810 3300014745 Bacteria 12925
96 Ga0157376_10111738 3300014969 Bacteria 2406
97 Ga0206353_10441195 3300020082 Bacteria 3086
98 Ga0206353_11060569 3300020082 Bacteria 2436
99 Ga0207692_10001599 3300025898 Bacteria 8539
100 Ga0207692_10024668 3300025898 Bacteria 2799
101 Ga0207699_10001223 3300025906 Bacteria 12182
102 Ga0207645_10113387 3300025907 Bacteria 1756
103 Ga0207707_10009080 3300025912 Bacteria 8638
104 Ga0207707_10019495 3300025912 Bacteria 5922
105 Ga0207707_10029301 3300025912 Bacteria 4812
106 Ga0207707_10049336 3300025912 Bacteria 3667
107 Ga0207695_10025914 3300025913 Bacteria 6554
108 Ga0207671_10050658 3300025914 Bacteria 3075
109 Ga0207693_10000427 3300025915 Bacteria 38281
110 Ga0207693_10002501 3300025915 Bacteria 16001
111 Ga0207693_10115247 3300025915 Bacteria 2110
112 Ga0207663_10000562 3300025916 Bacteria 16417
113 Ga0207660_10032552 3300025917 Bacteria 3599
114 Ga0207657_10000892 3300025919 Bacteria 31592
115 Ga0207657_10003107 3300025919 Bacteria 17755
116 Ga0207657_10004922 3300025919 Bacteria 14041
117 Ga0207657_10005481 3300025919 Bacteria 13249
118 Ga0207657_10088057 3300025919 Bacteria 2596
119 Ga0207649_10086447 3300025920 Bacteria 2043
120 Ga0207649_10121388 3300025920 Bacteria 1762
121 Ga0207652_10007356 3300025921 Bacteria 8878
122 Ga0207652_10027318 3300025921 Bacteria 4754
123 Ga0207652_10142768 3300025921 Bacteria 2142
124 Ga0207652_10147543 3300025921 Bacteria 2105
125 Ga0207652_10155605 3300025921 Bacteria 2048
126 Ga0207646_10000268 3300025922 Bacteria 71093
127 Ga0207687_10033076 3300025927 Bacteria 3506
128 Ga0207687_10062474 3300025927 Bacteria 2634
129 Ga0207687_10076229 3300025927 Bacteria 2408
130 Ga0207700_10004371 3300025928 Bacteria 8322
131 Ga0207664_10003138 3300025929 Bacteria 10979
132 Ga0207664_10003335 3300025929 Bacteria 10679
133 Ga0207664_10012355 3300025929 Bacteria 6102
134 Ga0207664_10012442 3300025929 Bacteria 6083
135 Ga0207664_10048844 3300025929 Bacteria 3329
136 Ga0207664_10048867 3300025929 Bacteria 3329
137 Ga0207664_10053159 3300025929 Bacteria 3205
138 Ga0207644_10042844 3300025931 Bacteria 3210
139 Ga0207690_10034494 3300025932 Bacteria 3261
140 Ga0207665_10000096 3300025939 Bacteria 57067
141 Ga0207661_10009929 3300025944 Bacteria 6836
142 Ga0207661_10011220 3300025944 Bacteria 6483
143 Ga0207651_10063588 3300025960 Bacteria 2578
144 Ga0207677_10012152 3300026023 Bacteria 4937
145 Ga0207678_10009684 3300026067 Bacteria 8476
146 Ga0207708_10023291 3300026075 Bacteria 4678
147 Ga0207702_10043944 3300026078 Bacteria 3753
148 Ga0207676_10124807 3300026095 Bacteria 2178
149 Ga0207674_10119391 3300026116 Bacteria 2606
150 Ga0207683_10214267 3300026121 Bacteria 1753
151 Ga0207698_10032727 3300026142 Bacteria 3770
152 Ga0265319_1004155 3300028563 Bacteria 7260
153 Ga0265319_1011925 3300028563 Bacteria 3534
154 Ga0265334_10019048 3300028573 Bacteria 2826
155 Ga0265318_10007305 3300028577 Bacteria 5004
156 Ga0265336_10001548 3300028666 Bacteria 10319
157 Ga0265338_10002536 3300028800 Bacteria 27065
158 Ga0265338_10023092 3300028800 Bacteria 6406
159 Ga0265338_10063808 3300028800 Bacteria 3209
160 Ga0265330_10024422 3300031235 Bacteria 2742
161 Ga0265332_10012919 3300031238 Bacteria 3702
162 Ga0265328_10002677 3300031239 Bacteria 7968
163 Ga0265320_10013012 3300031240 Bacteria 4804
164 Ga0265320_10021338 3300031240 Bacteria 3487
165 Ga0265320_10046094 3300031240 Bacteria 2139
166 Ga0265325_10001119 3300031241 Bacteria 19210
167 Ga0265325_10036537 3300031241 Bacteria 2601
168 Ga0265329_10018257 3300031242 Bacteria 2401
169 Ga0265340_10013926 3300031247 Bacteria 4213
170 Ga0265327_10009733 3300031251 Bacteria 6879
171 Ga0265313_10024037 3300031595 Bacteria 3264
172 Ga0265313_10024929 3300031595 Bacteria 3182
173 Ga0265313_10025195 3300031595 Bacteria 3160
174 Ga0316576_10012133 3300031727 Bacteria 5683
175 Ga0307406_10111986 3300031901 Bacteria 1881
176 Ga0373923_0054741 3300035111 Bacteria 1680
177 Ga0373945_0032370 3300035116 Bacteria 1852
178 Ga0373943_0000820 3300035170 Bacteria 13654
179 Ga0316574_0030032 3300035398 Bacteria 3288
180 Ga0373935_0040236 3300035692 Bacteria 2934
181 Ga0373927_0042616 3300035695 Bacteria 2941
182 Ga0373947_0002723 3300035725 Bacteria 10605
183 Ga0373947_0119314 3300035725 Bacteria 1674
184 Ga0373937_0001522 3300036401 Bacteria 19491
185 Ga0395899_0046373 3300037312 Bacteria 3237
186 Ga0395900_0069655 3300037418 Bacteria 3615
187 Ga0395900_0150680 3300037418 Bacteria 2376
188 Ga0395898_0110920 3300037466 Bacteria 2629
189 Ga0395905_0049912 3300037471 Bacteria 3921
190 Ga0395901_0004621 3300038443 Bacteria 13897
191 Ga0395901_0235766 3300038443 Bacteria 1909
192 Ga0466966_0013795 3300044684 Bacteria 5347
193 Ga0466966_0018689 3300044684 Bacteria 4567
194 Ga0466961_0003386 3300044693 Bacteria 9953
195 Ga0466961_0070030 3300044693 Bacteria 2226
196 Ga0466963_0002185 3300044694 Bacteria 10812
197 Ga0466963_0003268 3300044694 Bacteria 9242
198 Ga0466963_0003748 3300044694 Bacteria 8750
199 Ga0466963_0019445 3300044694 Bacteria 4261
200 Ga0466963_0023355 3300044694 Bacteria 3926
201 Ga0466963_0056028 3300044694 Bacteria 2622
202 Ga0466963_0072100 3300044694 Bacteria 2326
203 Ga0466964_0000488 3300044706 Bacteria 12266
204 Ga0466964_0065624 3300044706 Bacteria 1521
205 Ga0466971_0003550 3300044719 Bacteria 6666
206 Ga0466971_0004307 3300044719 Bacteria 6135
207 Ga0466971_0049806 3300044719 Bacteria 1885
208 Ga0466968_0001616 3300044735 Bacteria 8140
209 Ga0466968_0010991 3300044735 Bacteria 3519
210 Ga0466968_0012002 3300044735 Bacteria 3384
211 Ga0466968_0013597 3300044735 Bacteria 3201
212 Ga0466957_0013191 3300044842 Bacteria 4792
213 Ga0466957_0028512 3300044842 Bacteria 3325
214 Ga0466957_0032283 3300044842 Bacteria 3135
215 Ga0466957_0056797 3300044842 Bacteria 2394
216 Ga0466960_0047508 3300044901 Bacteria 2059
217 Ga0466959_0002923 3300045049 Bacteria 11015
218 Ga0466959_0030392 3300045049 Bacteria 3999
219 Ga0466959_0088668 3300045049 Bacteria 2224
220 Ga0466958_0002904 3300045836 Bacteria 8754
221 Ga0466958_0005917 3300045836 Bacteria 6611
222 Ga0466958_0008123 3300045836 Bacteria 5808
223 Ga0466958_0009590 3300045836 Bacteria 5398
224 Ga0466958_0016087 3300045836 Bacteria 4302
225 Ga0466958_0019200 3300045836 Bacteria 3977
226 Ga0466958_0020573 3300045836 Bacteria 3850
227 Ga0466958_0023123 3300045836 Bacteria 3645
228 Ga0466958_0040569 3300045836 Bacteria 2797
229 Ga0466958_0046528 3300045836 Bacteria 2618
230 Ga0466967_0000598 3300045976 Bacteria 17926
231 Ga0466967_0001409 3300045976 Bacteria 13908
232 Ga0466967_0004625 3300045976 Bacteria 9330
233 Ga0466967_0012252 3300045976 Bacteria 6547
234 Ga0466967_0013732 3300045976 Bacteria 6274
235 Ga0466967_0022571 3300045976 Bacteria 5138
236 Ga0466967_0026642 3300045976 Bacteria 4792
237 Ga0466967_0032101 3300045976 Bacteria 4430
238 Ga0466967_0034902 3300045976 Bacteria 4274
239 Ga0466967_0043823 3300045976 Bacteria 3876
240 Ga0466967_0052201 3300045976 Bacteria 3587
241 Ga0466967_0057382 3300045976 Bacteria 3437
242 Ga0466967_0060970 3300045976 Bacteria 3345
243 Ga0466967_0060999 3300045976 Bacteria 3344
244 Ga0466967_0074527 3300045976 Bacteria 3048
245 Ga0466967_0075179 3300045976 Bacteria 3036
246 Ga0466967_0138870 3300045976 Bacteria 2262
247 Ga0466967_0248235 3300045976 Bacteria 1699
248 Ga0495592_0000168 3300046454 Bacteria 58320
249 Ga0495592_0044188 3300046454 Bacteria 3330
250 Ga0495592_0045408 3300046454 Bacteria 3278
251 Ga0495603_0012829 3300046455 Bacteria 5067
252 Ga0495629_0037851 3300046459 Bacteria 3399
253 Ga0495629_0077750 3300046459 Bacteria 2316
254 Ga0495641_0003142 3300046461 Bacteria 12574
255 Ga0495651_0000011 3300046462 Bacteria 147193
256 Ga0495651_0031871 3300046462 Bacteria 4110
257 Ga0495651_0041762 3300046462 Bacteria 3562
258 Ga0495653_0031587 3300046463 Bacteria 4208
259 Ga0495653_0035631 3300046463 Bacteria 3924
260 Ga0495580_0016677 3300046472 Bacteria 5512
261 Ga0495639_0000660 3300046475 Bacteria 15951
262 Ga0495608_0055832 3300046511 Bacteria 2609
263 Ga0495618_0000815 3300046514 Bacteria 21740
264 Ga0495618_0005822 3300046514 Bacteria 7494
265 Ga0495618_0008889 3300046514 Bacteria 6061
266 Ga0495618_0075344 3300046514 Bacteria 2149
267 Ga0495628_0000024 3300046516 Bacteria 130196
268 Ga0495628_0033490 3300046516 Bacteria 4140
269 Ga0495628_0081931 3300046516 Bacteria 2506
270 Ga0495630_0003658 3300046517 Bacteria 10719
271 Ga0495630_0029642 3300046517 Bacteria 4067
272 Ga0495630_0030919 3300046517 Bacteria 3985
273 Ga0495644_0000976 3300046523 Bacteria 11863
274 Ga0495666_0002055 3300046526 Bacteria 9963
275 Ga0495652_0000050 3300046529 Bacteria 120480
276 Ga0495652_0005871 3300046529 Bacteria 11484
277 Ga0495652_0113816 3300046529 Bacteria 2171
278 Ga0495665_0012499 3300046531 Bacteria 4594
279 Ga0495640_0010751 3300046533 Bacteria 7061
280 Ga0495640_0030251 3300046533 Bacteria 3878
281 Ga0495587_0000353 3300046536 Bacteria 32872
282 Ga0495587_0012886 3300046536 Bacteria 5258
283 Ga0495645_0000376 3300046543 Bacteria 31025
284 Ga0495667_0060927 3300046559 Bacteria 2475
285 Ga0495667_0128254 3300046559 Bacteria 1636
286 Ga0495634_0024465 3300046642 Bacteria 4236
287 Ga0495634_0027841 3300046642 Bacteria 3929
288 Ga0495634_0047249 3300046642 Bacteria 2901
289 Ga0495634_0057650 3300046642 Bacteria 2591
290 Ga0495635_0020109 3300046663 Bacteria 4653
291 Ga0495635_0028242 3300046663 Bacteria 3899
292 Ga0495635_0048378 3300046663 Bacteria 2931
293 Ga0495657_0039840 3300046675 Bacteria 3227
294 Ga0495599_0000009 3300046678 Bacteria 217299
295 Ga0495599_0108199 3300046678 Bacteria 1732
296 Ga0495623_0000039 3300046679 Bacteria 80360
297 Ga0495646_0005554 3300046680 Bacteria 7975
298 Ga0495647_0001917 3300046681 Bacteria 6481
299 Ga0495658_0001187 3300046683 Bacteria 13726
300 Ga0495658_0065023 3300046683 Bacteria 2103
301 Ga0495658_0153437 3300046683 Bacteria 1416
302 Ga0495624_0004415 3300046690 Bacteria 10289
303 Ga0495624_0031138 3300046690 Bacteria 3472
304 Ga0495600_0064149 3300046809 Bacteria 2401
305 Ga0495581_0003173 3300047315 Bacteria 9409
306 Ga0495604_0000183 3300047317 Bacteria 55826
307 Ga0495674_0019684 3300047319 Bacteria 6260
308 Ga0495674_0042159 3300047319 Bacteria 4072
309 Ga0495676_0003806 3300047321 Bacteria 13711
310 Ga0495680_0005667 3300047322 Bacteria 11698
311 Ga0495680_0018241 3300047322 Bacteria 5965
312 Ga0495680_0018242 3300047322 Bacteria 5965
313 Ga0495680_0029107 3300047322 Bacteria 4525
314 Ga0495680_0068435 3300047322 Bacteria 2712
315 Ga0495675_0000167 3300047444 Bacteria 47216
316 Ga0495684_0078751 3300047471 Bacteria 2501
317 Ga0495593_0006038 3300047673 Bacteria 7124
318 Ga0495602_0000477 3300048088 Bacteria 37020
319 Ga0496100_0006808 3300048903 Bacteria 6262
320 Ga0496100_0097685 3300048903 Bacteria 2017
321 Ga0496100_0126335 3300048903 Bacteria 1795
322 Ga0496100_0165977 3300048903 Bacteria 1586
323 Ga0496101_0023086 3300048904 Bacteria 4292
324 Ga0496102_0005196 3300048905 Bacteria 11051
325 Ga0496102_0018600 3300048905 Bacteria 6109
326 Ga0496103_0003798 3300048906 Bacteria 9192
327 Ga0496103_0036026 3300048906 Bacteria 3030
328 Ga0496104_0017890 3300048907 Bacteria 6462
329 Ga0496104_0044233 3300048907 Bacteria 4184
330 Ga0496104_0049078 3300048907 Bacteria 3980
331 Ga0496104_0088472 3300048907 Bacteria 2958
332 Ga0496105_0008582 3300048908 Bacteria 7938
333 Ga0496105_0010599 3300048908 Bacteria 7252
334 Ga0496105_0138632 3300048908 Bacteria 2003
335 Ga0496106_0002005 3300048909 Bacteria 15309
336 Ga0496106_0006728 3300048909 Bacteria 8515
337 Ga0496107_0003855 3300048910 Bacteria 10077
338 Ga0496107_0010515 3300048910 Bacteria 6430
339 Ga0496108_0005965 3300048911 Bacteria 9870
340 Ga0496108_0031249 3300048911 Bacteria 4416
341 Ga0496108_0091670 3300048911 Bacteria 2583
342 Ga0496108_0091900 3300048911 Bacteria 2580
343 Ga0496108_0155851 3300048911 Bacteria 1972
344 Ga0496108_0235625 3300048911 Bacteria 1592
345 Ga0496109_0005912 3300048912 Bacteria 10265
346 Ga0496109_0015109 3300048912 Bacteria 6719
347 Ga0496109_0069587 3300048912 Bacteria 3228
348 Ga0496110_0010362 3300048913 Bacteria 7579
349 Ga0496110_0025305 3300048913 Bacteria 5071
350 Ga0496110_0032077 3300048913 Bacteria 4534
351 Ga0496111_0022522 3300048914 Bacteria 4412
352 Ga0496111_0030047 3300048914 Bacteria 3863
353 Ga0496111_0040200 3300048914 Bacteria 3354
354 Ga0496112_0001180 3300048915 Bacteria 19585
355 Ga0496112_0004449 3300048915 Bacteria 11877
356 Ga0496112_0006711 3300048915 Bacteria 10136
357 Ga0496112_0022658 3300048915 Bacteria 5989
358 Ga0496112_0075162 3300048915 Bacteria 3341
359 Ga0496112_0113419 3300048915 Bacteria 2681
360 Ga0496113_0001330 3300048916 Bacteria 13671
361 Ga0496113_0012212 3300048916 Bacteria 5765
362 Ga0496114_0003341 3300048917 Bacteria 12329
363 Ga0496115_0004187 3300048918 Bacteria 10427
364 Ga0496115_0072794 3300048918 Bacteria 2788
365 Ga0496115_0080097 3300048918 Bacteria 2659
366 Ga0496115_0195038 3300048918 Bacteria 1673
367 Ga0501034_0022429 3300049571 Bacteria 6434
368 Ga0501069_0085947 3300049585 Bacteria 1775
369 Ga0501070_0065782 3300049586 Bacteria 3002
370 Ga0501072_0003024 3300049588 Bacteria 12688
371 Ga0501073_0034393 3300049589 Bacteria 3607
372 Ga0501074_0178033 3300049590 Bacteria 1517
373 Ga0501080_0001936 3300049742 Bacteria 17881
374 Ga0501080_0150230 3300049742 Bacteria 2153
375 Ga0501083_0006785 3300049744 Bacteria 8125
376 nmdc:mga05p37_134584_c1 3300050507 Bacteria 3032
377 nmdc:mga0n895_34153_c1 3300050512 Bacteria 4894
378 nmdc:mga0rr50_69011_c1 3300050513 Bacteria 2689
379 nmdc:mga0a205_129331_c1 3300050515 Bacteria 2426
380 Ga0495601_0000094 3300053077 Bacteria 48572
381 Ga0495601_0009685 3300053077 Bacteria 5701
382 Ga0495601_0018045 3300053077 Bacteria 4290
383 Ga0495601_0090919 3300053077 Bacteria 1964
384 Ga0495612_0002938 3300053078 Bacteria 7070
385 Ga0495612_0021121 3300053078 Bacteria 2612
386 Ga0495655_0000809 3300053083 Bacteria 4913
387 Ga0495595_0030993 3300053084 Bacteria 2401
388 Ga0495595_0038442 3300053084 Bacteria 2180
389 Ga0495619_0000651 3300053085 Bacteria 22807
390 Ga0495619_0001933 3300053085 Bacteria 13813
391 Ga0501082_0131488 3300060353 Bacteria 2172
392 Ga0466962_0002362 3300061719 Bacteria 8955
393 Ga0466962_0005821 3300061719 Bacteria 5923
394 Ga0466962_0070398 3300061719 Bacteria 1671
395 Ga0466964_0001198
396 Ga0070658_10034700
397 Ga0070683_100019154
398 Ga0070683_100041628
399 Ga0070683_100113482
400 Ga0068869_100031115
401 Ga0070680_100006365
402 Ga0070680_100040211
403 Ga0070680_100084043
404 Ga0070682_100023465
405 Ga0070682_100089920
406 Ga0068868_100006200
407 Ga0070660_100002706
408 Ga0070660_100015286
409 Ga0070660_100042908
410 Ga0070661_100073361
411 Ga0070661_100108787
412 Ga0070673_100106708
413 Ga0070659_100031108
414 Ga0070659_100059946
415 Ga0070709_10000689
416 Ga0070714_100006808
417 Ga0070714_100009619
418 Ga0070714_100026295
419 Ga0070714_100030091
420 Ga0070714_100039580
421 Ga0070714_100041812
422 Ga0070714_100057706
423 Ga0070714_100117590
424 Ga0070713_100008556
425 Ga0070713_100160933
426 Ga0070710_10003396
427 Ga0070710_10012260
428 Ga0070711_100007112
429 Ga0070711_100031482
430 Ga0070700_100002478
431 Ga0070663_100049366
432 Ga0070678_100125475
433 Ga0070678_100176525
434 Ga0070662_100014097
435 Ga0070681_10083330
436 Ga0070681_10093334
437 Ga0070707_100000126
438 Ga0070679_100002041
439 Ga0070679_100139435
440 Ga0070679_100162459
441 Ga0070679_100166551
442 Ga0070679_100190402
443 Ga0070679_100278957
444 Ga0070684_100009331
445 Ga0070684_100017101
446 Ga0070684_100024024
447 Ga0070684_100164899
448 Ga0070684_100193827
449 Ga0070695_100000007
450 Ga0068855_100027649
451 Ga0068855_100091677
452 Ga0068857_100114869
453 Ga0068854_100065542
454 Ga0068856_100007960
455 Ga0068856_100069893
456 Ga0068852_100036257
457 Ga0068852_100061539
458 Ga0081540_1012791
459 Ga0070717_10002838
460 Ga0070717_10109480
461 Ga0070716_100018442
462 Ga0075434_100018950
463 Ga0075434_100019806
464 Ga0075435_100011907
465 Ga0105240_10008296
466 Ga0105240_10013248
467 Ga0105245_10017903
468 Ga0105245_10065494
469 Ga0105245_10092857
470 Ga0105245_10111135
471 Ga0114129_10149127
472 Ga0105243_10018143
473 Ga0105248_10042955
474 Ga0105237_10013161
475 Ga0105238_10136802
476 Ga0105249_10079768
477 Ga0105239_10010709
478 Ga0157370_10048744
479 Ga0157370_10154544
480 Ga0157369_10074885
481 Ga0157369_10110219
482 Ga0157369_10193412
483 Ga0157374_10013766
484 Ga0157374_10032952
485 Ga0157372_10212546
486 Ga0157375_10010221
487 Ga0182008_10010112
488 Ga0182008_10085325
489 Ga0157377_10000810
490 Ga0157376_10111738
491 Ga0206353_10441195
492 Ga0206353_11060569
493 Ga0207692_10001599
494 Ga0207692_10024668
495 Ga0207699_10001223
496 Ga0207645_10113387
497 Ga0207707_10009080
498 Ga0207707_10019495
499 Ga0207707_10029301
500 Ga0207707_10049336
501 Ga0207695_10025914
502 Ga0207671_10050658
503 Ga0207693_10000427
504 Ga0207693_10002501
505 Ga0207693_10115247
506 Ga0207663_10000562
507 Ga0207660_10032552
508 Ga0207657_10000892
509 Ga0207657_10003107
510 Ga0207657_10004922
511 Ga0207657_10005481
512 Ga0207657_10088057
513 Ga0207649_10086447
514 Ga0207649_10121388
515 Ga0207652_10007356
516 Ga0207652_10027318
517 Ga0207652_10142768
518 Ga0207652_10147543
519 Ga0207652_10155605
520 Ga0207646_10000268
521 Ga0207687_10033076
522 Ga0207687_10062474
523 Ga0207687_10076229
524 Ga0207700_10004371
525 Ga0207664_10003138
526 Ga0207664_10003335
527 Ga0207664_10012355
528 Ga0207664_10012442
529 Ga0207664_10048844
530 Ga0207664_10048867
531 Ga0207664_10053159
532 Ga0207644_10042844
533 Ga0207690_10034494
534 Ga0207665_10000096
535 Ga0207661_10009929
536 Ga0207661_10011220
537 Ga0207651_10063588
538 Ga0207677_10012152
539 Ga0207678_10009684
540 Ga0207708_10023291
541 Ga0207702_10043944
542 Ga0207676_10124807
543 Ga0207674_10119391
544 Ga0207683_10214267
545 Ga0207698_10032727
546 Ga0265319_1004155
547 Ga0265319_1011925
548 Ga0265334_10019048
549 Ga0265318_10007305
550 Ga0265336_10001548
551 Ga0265338_10002536
552 Ga0265338_10023092
553 Ga0265338_10063808
554 Ga0265330_10024422
555 Ga0265332_10012919
556 Ga0265328_10002677
557 Ga0265320_10013012
558 Ga0265320_10021338
559 Ga0265320_10046094
560 Ga0265325_10001119
561 Ga0265325_10036537
562 Ga0265329_10018257
563 Ga0265340_10013926
564 Ga0265327_10009733
565 Ga0265313_10024037
566 Ga0265313_10024929
567 Ga0265313_10025195
568 Ga0316576_10012133
569 Ga0307406_10111986
570 Ga0373923_0054741
571 Ga0373945_0032370
572 Ga0373943_0000820
573 Ga0316574_0030032
574 Ga0373935_0040236
575 Ga0373927_0042616
576 Ga0373947_0002723
577 Ga0373947_0119314
578 Ga0373937_0001522
579 Ga0395899_0046373
580 Ga0395900_0069655
581 Ga0395900_0150680
582 Ga0395898_0110920
583 Ga0395905_0049912
584 Ga0395901_0004621
585 Ga0395901_0235766
586 Ga0466966_0013795
587 Ga0466966_0018689
588 Ga0466961_0003386
589 Ga0466961_0070030
590 Ga0466963_0002185
591 Ga0466963_0003268
592 Ga0466963_0003748
593 Ga0466963_0019445
594 Ga0466963_0023355
595 Ga0466963_0056028
596 Ga0466963_0072100
597 Ga0466964_0000488
598 Ga0466964_0065624
599 Ga0466971_0003550
600 Ga0466971_0004307
601 Ga0466971_0049806
602 Ga0466968_0001616
603 Ga0466968_0010991
604 Ga0466968_0012002
605 Ga0466968_0013597
606 Ga0466957_0013191
607 Ga0466957_0028512
608 Ga0466957_0032283
609 Ga0466957_0056797
610 Ga0466960_0047508
611 Ga0466959_0002923
612 Ga0466959_0030392
613 Ga0466959_0088668
614 Ga0466958_0002904
615 Ga0466958_0005917
616 Ga0466958_0008123
617 Ga0466958_0009590
618 Ga0466958_0016087
619 Ga0466958_0019200
620 Ga0466958_0020573
621 Ga0466958_0023123
622 Ga0466958_0040569
623 Ga0466958_0046528
624 Ga0466967_0000598
625 Ga0466967_0001409
626 Ga0466967_0004625
627 Ga0466967_0012252
628 Ga0466967_0013732
629 Ga0466967_0022571
630 Ga0466967_0026642
631 Ga0466967_0032101
632 Ga0466967_0034902
633 Ga0466967_0043823
634 Ga0466967_0052201
635 Ga0466967_0057382
636 Ga0466967_0060970
637 Ga0466967_0060999
638 Ga0466967_0074527
639 Ga0466967_0075179
640 Ga0466967_0138870
641 Ga0466967_0248235
642 Ga0495592_0000168
643 Ga0495592_0044188
644 Ga0495592_0045408
645 Ga0495603_0012829
646 Ga0495629_0037851
647 Ga0495629_0077750
648 Ga0495641_0003142
649 Ga0495651_0000011
650 Ga0495651_0031871
651 Ga0495651_0041762
652 Ga0495653_0031587
653 Ga0495653_0035631
654 Ga0495580_0016677
655 Ga0495639_0000660
656 Ga0495608_0055832
657 Ga0495618_0000815
658 Ga0495618_0005822
659 Ga0495618_0008889
660 Ga0495618_0075344
661 Ga0495628_0000024
662 Ga0495628_0033490
663 Ga0495628_0081931
664 Ga0495630_0003658
665 Ga0495630_0029642
666 Ga0495630_0030919
667 Ga0495644_0000976
668 Ga0495666_0002055
669 Ga0495652_0000050
670 Ga0495652_0005871
671 Ga0495652_0113816
672 Ga0495665_0012499
673 Ga0495640_0010751
674 Ga0495640_0030251
675 Ga0495587_0000353
676 Ga0495587_0012886
677 Ga0495645_0000376
678 Ga0495667_0060927
679 Ga0495667_0128254
680 Ga0495634_0024465
681 Ga0495634_0027841
682 Ga0495634_0047249
683 Ga0495634_0057650
684 Ga0495635_0020109
685 Ga0495635_0028242
686 Ga0495635_0048378
687 Ga0495657_0039840
688 Ga0495599_0000009
689 Ga0495599_0108199
690 Ga0495623_0000039
691 Ga0495646_0005554
692 Ga0495647_0001917
693 Ga0495658_0001187
694 Ga0495658_0065023
695 Ga0495658_0153437
696 Ga0495624_0004415
697 Ga0495624_0031138
698 Ga0495600_0064149
699 Ga0495581_0003173
700 Ga0495604_0000183
701 Ga0495674_0019684
702 Ga0495674_0042159
703 Ga0495676_0003806
704 Ga0495680_0005667
705 Ga0495680_0018241
706 Ga0495680_0018242
707 Ga0495680_0029107
708 Ga0495680_0068435
709 Ga0495675_0000167
710 Ga0495684_0078751
711 Ga0495593_0006038
712 Ga0495602_0000477
713 Ga0496100_0006808
714 Ga0496100_0097685
715 Ga0496100_0126335
716 Ga0496100_0165977
717 Ga0496101_0023086
718 Ga0496102_0005196
719 Ga0496102_0018600
720 Ga0496103_0003798
721 Ga0496103_0036026
722 Ga0496104_0017890
723 Ga0496104_0044233
724 Ga0496104_0049078
725 Ga0496104_0088472
726 Ga0496105_0008582
727 Ga0496105_0010599
728 Ga0496105_0138632
729 Ga0496106_0002005
730 Ga0496106_0006728
731 Ga0496107_0003855
732 Ga0496107_0010515
733 Ga0496108_0005965
734 Ga0496108_0031249
735 Ga0496108_0091670
736 Ga0496108_0091900
737 Ga0496108_0155851
738 Ga0496108_0235625
739 Ga0496109_0005912
740 Ga0496109_0015109
741 Ga0496109_0069587
742 Ga0496110_0010362
743 Ga0496110_0025305
744 Ga0496110_0032077
745 Ga0496111_0022522
746 Ga0496111_0030047
747 Ga0496111_0040200
748 Ga0496112_0001180
749 Ga0496112_0004449
750 Ga0496112_0006711
751 Ga0496112_0022658
752 Ga0496112_0075162
753 Ga0496112_0113419
754 Ga0496113_0001330
755 Ga0496113_0012212
756 Ga0496114_0003341
757 Ga0496115_0004187
758 Ga0496115_0072794
759 Ga0496115_0080097
760 Ga0496115_0195038
761 Ga0501034_0022429
762 Ga0501069_0085947
763 Ga0501070_0065782
764 Ga0501072_0003024
765 Ga0501073_0034393
766 Ga0501074_0178033
767 Ga0501080_0001936
768 Ga0501080_0150230
769 Ga0501083_0006785
770 nmdc:mga05p37_134584_c1
771 nmdc:mga0n895_34153_c1
772 nmdc:mga0rr50_69011_c1
773 nmdc:mga0a205_129331_c1
774 Ga0495601_0000094
775 Ga0495601_0009685
776 Ga0495601_0018045
777 Ga0495601_0090919
778 Ga0495612_0002938
779 Ga0495612_0021121
780 Ga0495655_0000809
781 Ga0495595_0030993
782 Ga0495595_0038442
783 Ga0495619_0000651
784 Ga0495619_0001933
785 Ga0501082_0131488
786 Ga0466962_0002362
787 Ga0466962_0005821
788 Ga0466962_0070398

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00083

Sugar_tr

Sugar (and other) transporter

7

185

0.86

PF07690

MFS_1

Major Facilitator Superfamily

11

403

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7y58-assembly1.cif.gz_A cryoem structure of qaca (d411n), an antibacterial efflux transporter from staphylococcus aureus 0.886 1 457
7y58-assembly1.cif.gz_A cryoem structure of qaca (d411n), an antibacterial efflux transporter from staphylococcus aureus 0.851 1 457
7d5q-assembly1.cif.gz_A structure of norc transporter (k398a mutant) in an outward-open conformation in complex with a single-chain indian camelid antibody 0.8279 7 456
6vs2-assembly1.cif.gz_A protein d 0.8249 4 453
6kki-assembly1.cif.gz_A crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward-occluded conformation 0.8247 4 457
ID Description Score Start End Superfamily
af_P9WG87_21_208_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9724 10 194 1.20.1250.20
af_Q04301_34_211_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9643 4 179 1.20.1250.20
af_P9WG91_8_214_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9623 8 207 1.20.1250.20
af_A0A1D8PEJ7_80_330_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9518 9 251 1.20.1250.20
af_Q03263_69_259_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9477 5 182 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A2V7LDE2-F1-model_v4 Multidrug efflux MFS transporter 0.9774 2 162 GO:0005886
GO:0022857
AF-A0A538CW67-F1-model_v4 MFS transporter 0.9676 2 188 GO:0016020
GO:0022857
AF-A0A3S1U0X0-F1-model_v4 MFS transporter 0.9601 14 149 GO:0005886
GO:0022857
AF-A0A4Q3HNF4-F1-model_v4 deleted 0.9466 2 164
AF-A0A2V7WUS4-F1-model_v4 MFS transporter 0.9444 1 173 GO:0016020
GO:0022857

Map