F432980

General Info

Members Datasets Scaffolds Average Seq Length
394 263 788 341

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0017731|Ga0466969_0017731_2046_3143
Length 365
Sequence MTMNYRVLGATGIEVSTYALGTMMFGRIGNPDHADSERIIHAALDAGINFVDTADMYSTGESEEIVGKALKGRRDDIVLATKVHFSLDDKRNHSGNSRRYITRAVEDSLRRLQTDWIDLYQIHRPDPKTDIEETLGVLTDLVRAGKIRSFGSSTFPAEHLVEAWHVAERRGLMKFRTEQPPYSILSRGIEAAVLPTAERLNMGVLTWSPLAWGFLSGKYRRGTEVDLTTGRAALRSDRFDPALPANAAKYDAVEELAKLAEDLGTTLPHLATAFPLAHPAVTSVIIGPRTMEQLESSLAGRDLVLDDATLDRIDEIVPPGTDLVWTAEGGGWLPPALSRPGLRRRAVGDRAGGSADSAEGAGGAQ

Samples

Sample ID Description Type Environment
1 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
58 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
61 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
94 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
95 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
96 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
97 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
98 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
99 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
100 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
101 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
102 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
103 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
104 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
105 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
106 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
107 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
109 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
110 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
111 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
112 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
113 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
114 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
115 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
119 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
120 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
121 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
122 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
123 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
124 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
125 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
126 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
127 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
128 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
129 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
130 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
131 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
132 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
133 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
134 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
135 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
136 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
137 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
138 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
139 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
140 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
141 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
142 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
143 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
144 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
145 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
146 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
147 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
148 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
149 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
150 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
151 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
152 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
153 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
154 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
155 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
156 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
157 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
158 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
159 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
160 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
161 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
162 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
163 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
164 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
165 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
166 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
167 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
168 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
169 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
170 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
175 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
176 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
177 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
183 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
184 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
185 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
186 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
187 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
188 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
189 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
190 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
191 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
192 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
193 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
194 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
195 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
196 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
210 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
211 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
212 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
213 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
214 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
215 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
216 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
217 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
218 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
219 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
220 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
221 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
222 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
223 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
224 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
225 2508501039 Frankia saprophytica CN3 Isolate Nodule
226 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
227 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
228 2558860280 Kutzneria sp. 744 Isolate Unclassified
229 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
230 2619618881 Frankia sp. ACN1ag Isolate Unclassified
231 2619619003 Frankia sp. CpI1-P Isolate Nodule
232 2626541554 Frankia sp. AvcI.1 Isolate Nodule
233 2643221578 Streptomyces sp. Root63 Isolate Unclassified
234 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
235 2687453737 Frankia sp. BMG5.36 Isolate Nodule
236 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
237 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
238 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
239 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
240 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
241 2808606372 Agromyces sp. 23-23 Isolate Unclassified
242 2808606448 Streptomyces sp. 193411 Isolate Unclassified
243 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
244 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
245 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
246 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
247 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
248 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
249 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
250 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
251 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
252 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
253 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
254 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
255 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
256 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
257 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
258 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
259 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
260 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
261 8054920844 Frankia tisae Agncl-8 Isolate Nodule
262 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
263 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.58
Metatranscriptomes 0.51
Isolates 10.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.57
Nodule 2.28
Rhizoplane 10.66
Rhizosphere 69.29
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466969_0017731 3300044656 Bacteria 3714
2 JGI24740J21852_10021924 3300001979 Bacteria 2207
3 JGI24739J22299_10020034 3300001989 Bacteria 2390
4 JGI25406J46586_10004562 3300003203 Bacteria 6447
5 JGI25406J46586_10007573 3300003203 Bacteria 4946
6 rootH2_10139728 3300003320 Bacteria 2723
7 Ga0055540_1008703 3300003792 Bacteria 3615
8 Ga0055540_1011528 3300003792 Bacteria 2842
9 Ga0070658_10040410 3300005327 Bacteria 3762
10 Ga0070676_10107145 3300005328 Bacteria 1735
11 Ga0070683_100036040 3300005329 Bacteria 4525
12 Ga0070683_100251014 3300005329 Bacteria 1683
13 Ga0068868_100307807 3300005338 Bacteria 1347
14 Ga0070668_100002213 3300005347 Bacteria 14281
15 Ga0070669_100004217 3300005353 Bacteria 10399
16 Ga0070669_100207795 3300005353 Bacteria 1543
17 Ga0070671_100002883 3300005355 Bacteria 13387
18 Ga0070667_100000056 3300005367 Bacteria 150952
19 Ga0070667_100007990 3300005367 Bacteria 8773
20 Ga0070667_100028302 3300005367 Bacteria 4665
21 Ga0070703_10045191 3300005406 Bacteria 1388
22 Ga0070709_10000253 3300005434 Bacteria 34511
23 Ga0070714_100001552 3300005435 Bacteria 16724
24 Ga0070714_100066990 3300005435 Bacteria 3095
25 Ga0070714_100170648 3300005435 Bacteria 1974
26 Ga0070714_100323878 3300005435 Bacteria 1442
27 Ga0070714_100337490 3300005435 Bacteria 1413
28 Ga0070713_100003431 3300005436 Bacteria 10462
29 Ga0070713_100031894 3300005436 Bacteria 4202
30 Ga0070710_10000803 3300005437 Bacteria 15077
31 Ga0070710_10036836 3300005437 Bacteria 2676
32 Ga0070710_10138923 3300005437 Bacteria 1488
33 Ga0070711_100001328 3300005439 Bacteria 13497
34 Ga0070663_100060129 3300005455 Bacteria 2732
35 Ga0070679_100061894 3300005530 Bacteria 3730
36 Ga0070684_100255287 3300005535 Bacteria 1603
37 Ga0068853_100005735 3300005539 Bacteria 9775
38 Ga0068853_100023186 3300005539 Bacteria 5193
39 Ga0070665_100003218 3300005548 Bacteria 17552
40 Ga0070665_100068074 3300005548 Bacteria 3570
41 Ga0070665_100080279 3300005548 Bacteria 3267
42 Ga0070665_100087565 3300005548 Bacteria 3120
43 Ga0070665_100432426 3300005548 Bacteria 1325
44 Ga0068857_100107774 3300005577 Bacteria 2502
45 Ga0068854_100006263 3300005578 Bacteria 7561
46 Ga0068854_100173234 3300005578 Bacteria 1680
47 Ga0068852_100134268 3300005616 Bacteria 2283
48 Ga0068859_100001827 3300005617 Bacteria 21681
49 Ga0068863_100000200 3300005841 Bacteria 63948
50 Ga0068863_100004041 3300005841 Bacteria 14483
51 Ga0068863_100023145 3300005841 Bacteria 5936
52 Ga0068858_100000644 3300005842 Bacteria 36378
53 Ga0068858_100060307 3300005842 Bacteria 3507
54 Ga0068858_100118960 3300005842 Bacteria 2470
55 Ga0068860_100000092 3300005843 Bacteria 150190
56 Ga0068862_100000035 3300005844 Bacteria 174953
57 Ga0068862_100000066 3300005844 Bacteria 124095
58 Ga0068862_100067765 3300005844 Bacteria 3078
59 Ga0081455_10030752 3300005937 Bacteria 4872
60 Ga0081455_10091718 3300005937 Bacteria 2460
61 Ga0081540_1000261 3300005983 Bacteria 55660
62 Ga0081539_10000257 3300005985 Bacteria 122507
63 Ga0081539_10000911 3300005985 Bacteria 55934
64 Ga0070717_10004218 3300006028 Bacteria 10373
65 Ga0070716_100011211 3300006173 Bacteria 4513
66 Ga0075367_10040958 3300006178 Bacteria 2706
67 Ga0075369_10019482 3300006186 Bacteria 2771
68 Ga0075428_100043807 3300006844 Bacteria 4920
69 Ga0097620_100001827 3300006931 Bacteria 21681
70 Ga0105251_10041396 3300009011 Bacteria 2242
71 Ga0105240_10005968 3300009093 Bacteria 18019
72 Ga0105245_10009722 3300009098 Bacteria 8386
73 Ga0105247_10000302 3300009101 Bacteria 44452
74 Ga0105247_10119937 3300009101 Bacteria 1703
75 Ga0105247_10188448 3300009101 Bacteria 1380
76 Ga0105241_10002030 3300009174 Bacteria 15312
77 Ga0105248_10000036 3300009177 Bacteria 187421
78 Ga0105248_10001270 3300009177 Bacteria 28207
79 Ga0105248_10048964 3300009177 Bacteria 4740
80 Ga0105248_10448616 3300009177 Bacteria 1453
81 Ga0105238_10004351 3300009551 Bacteria 14054
82 Ga0105238_10010233 3300009551 Bacteria 9406
83 Ga0105238_10014214 3300009551 Bacteria 8049
84 Ga0105249_10000046 3300009553 Bacteria 176363
85 Ga0105249_10005903 3300009553 Bacteria 10600
86 Ga0105239_10165879 3300010375 Bacteria 2469
87 Ga0105239_10442844 3300010375 Bacteria 1473
88 Ga0105246_10050945 3300011119 Bacteria 2841
89 Ga0157370_10066253 3300013104 Bacteria 3416
90 Ga0157374_10013632 3300013296 Bacteria 7100
91 Ga0163162_10091426 3300013306 Bacteria 3126
92 Ga0157379_10025285 3300014968 Bacteria 5274
93 Ga0157379_10044196 3300014968 Bacteria 3976
94 Ga0157379_10075665 3300014968 Bacteria 3015
95 Ga0157379_10210528 3300014968 Bacteria 1760
96 Ga0182007_10000435 3300015262 Bacteria 25447
97 Ga0206351_11010482 3300020077 Bacteria 1269
98 Ga0224712_10065992 3300022467 Bacteria 1456
99 Ga0224572_1020742 3300024225 Bacteria 1261
100 Ga0209051_1007941 3300025303 Bacteria 5713
101 Ga0207692_10063291 3300025898 Bacteria 1922
102 Ga0207710_10000153 3300025900 Bacteria 76530
103 Ga0207710_10003929 3300025900 Bacteria 6561
104 Ga0207647_10003853 3300025904 Bacteria 11217
105 Ga0207647_10146284 3300025904 Bacteria 1383
106 Ga0207699_10008298 3300025906 Bacteria 5118
107 Ga0207707_10004577 3300025912 Bacteria 12148
108 Ga0207695_10004944 3300025913 Bacteria 17956
109 Ga0207671_10002858 3300025914 Bacteria 17916
110 Ga0207693_10008744 3300025915 Bacteria 8279
111 Ga0207663_10014062 3300025916 Bacteria 4371
112 Ga0207681_10002582 3300025923 Bacteria 11474
113 Ga0207694_10001720 3300025924 Bacteria 18336
114 Ga0207687_10022427 3300025927 Bacteria 4202
115 Ga0207700_10000434 3300025928 Bacteria 24649
116 Ga0207700_10017127 3300025928 Bacteria 4832
117 Ga0207700_10143345 3300025928 Bacteria 1966
118 Ga0207664_10001995 3300025929 Bacteria 13440
119 Ga0207664_10107094 3300025929 Bacteria 2319
120 Ga0207664_10309901 3300025929 Bacteria 1390
121 Ga0207644_10008872 3300025931 Bacteria 6586
122 Ga0207665_10001025 3300025939 Bacteria 18852
123 Ga0207711_10000073 3300025941 Bacteria 107878
124 Ga0207711_10000365 3300025941 Bacteria 47940
125 Ga0207711_10007397 3300025941 Bacteria 9189
126 Ga0207661_10070027 3300025944 Bacteria 2862
127 Ga0207667_10268915 3300025949 Bacteria 1743
128 Ga0207712_10000042 3300025961 Bacteria 176338
129 Ga0207712_10003025 3300025961 Bacteria 10735
130 Ga0207668_10003831 3300025972 Bacteria 8865
131 Ga0207658_10000377 3300025986 Bacteria 43514
132 Ga0207658_10042109 3300025986 Bacteria 3310
133 Ga0207703_10000071 3300026035 Bacteria 121299
134 Ga0207703_10064908 3300026035 Bacteria 2998
135 Ga0207703_10155921 3300026035 Bacteria 1995
136 Ga0207639_10101221 3300026041 Bacteria 2329
137 Ga0207678_10056157 3300026067 Bacteria 3390
138 Ga0207641_10000278 3300026088 Bacteria 64322
139 Ga0207641_10003567 3300026088 Bacteria 13753
140 Ga0207641_10020698 3300026088 Bacteria 5405
141 Ga0207676_10122088 3300026095 Bacteria 2199
142 Ga0207674_10354294 3300026116 Bacteria 1419
143 Ga0268266_10011123 3300028379 Bacteria 7836
144 Ga0268266_10028814 3300028379 Bacteria 4720
145 Ga0268266_10132137 3300028379 Bacteria 2233
146 Ga0268266_10369385 3300028379 Bacteria 1351
147 Ga0268265_10000051 3300028380 Bacteria 174968
148 Ga0268265_10000062 3300028380 Bacteria 148317
149 Ga0268265_10017359 3300028380 Bacteria 4965
150 Ga0268265_10112030 3300028380 Bacteria 2230
151 Ga0268264_10000108 3300028381 Bacteria 208791
152 Ga0265336_10008852 3300028666 Bacteria 3508
153 Ga0265338_10003914 3300028800 Bacteria 20555
154 Ga0265338_10006810 3300028800 Bacteria 14396
155 Ga0307511_10000187 3300030521 Bacteria 61443
156 Ga0316179_1010393 3300030734 Bacteria 2239
157 Ga0265330_10001571 3300031235 Bacteria 13098
158 Ga0265329_10003979 3300031242 Bacteria 6303
159 Ga0265339_10098762 3300031249 Bacteria 1522
160 Ga0265316_10001705 3300031344 Bacteria 23311
161 Ga0307509_10010065 3300031507 Bacteria 11666
162 Ga0307508_10102132 3300031616 Bacteria 2464
163 Ga0265342_10005342 3300031712 Bacteria 9824
164 Ga0307413_10069449 3300031824 Bacteria 2211
165 Ga0307413_10091095 3300031824 Bacteria 1986
166 Ga0373926_0027826 3300035083 Bacteria 1982
167 Ga0373944_0000351 3300035089 Bacteria 10416
168 Ga0373923_0034733 3300035111 Bacteria 2048
169 Ga0373936_0000130 3300035113 Bacteria 26133
170 Ga0373945_0005396 3300035116 Bacteria 4092
171 Ga0373943_0000783 3300035170 Bacteria 13913
172 Ga0373946_0000093 3300035171 Bacteria 24751
173 Ga0373935_0009564 3300035692 Bacteria 5802
174 Ga0373927_0001407 3300035695 Bacteria 18138
175 Ga0373947_0000281 3300035725 Bacteria 28827
176 Ga0373937_0032642 3300036401 Bacteria 4723
177 Ga0373937_0050400 3300036401 Bacteria 3813
178 Ga0373925_0000938 3300037068 Bacteria 26552
179 Ga0373925_0031257 3300037068 Bacteria 3912
180 Ga0373925_0053527 3300037068 Bacteria 3017
181 Ga0395898_0004266 3300037466 Bacteria 15681
182 Ga0436365_1594394 3300039437 Bacteria 1348
183 Ga0451789_0117443 3300041443 Bacteria 1578
184 Ga0451791_1274193 3300041451 Bacteria 2403
185 Ga0451793_0292334 3300041452 Bacteria 1414
186 Ga0466966_0011622 3300044684 Bacteria 5836
187 Ga0466963_0021545 3300044694 Bacteria 4068
188 Ga0453684_0078912 3300044712 Bacteria 4117
189 Ga0466970_0007394 3300044765 Bacteria 5503
190 Ga0466957_0013274 3300044842 Bacteria 4779
191 Ga0466959_0044121 3300045049 Bacteria 3286
192 Ga0451576_0279752 3300045051 Bacteria 1745
193 Ga0466958_0023075 3300045836 Bacteria 3649
194 Ga0466967_0001864 3300045976 Bacteria 12703
195 Ga0495592_0033925 3300046454 Bacteria 3849
196 Ga0495629_0028571 3300046459 Bacteria 3958
197 Ga0495629_0128692 3300046459 Bacteria 1764
198 Ga0495651_0000926 3300046462 Bacteria 22717
199 Ga0495651_0013688 3300046462 Bacteria 6269
200 Ga0495651_0036969 3300046462 Bacteria 3802
201 Ga0495653_0000632 3300046463 Bacteria 26856
202 Ga0495582_0180734 3300046473 Bacteria 1202
203 Ga0495605_0070261 3300046474 Bacteria 1656
204 Ga0495662_0037306 3300046476 Bacteria 2347
205 Ga0495664_0000201 3300046477 Bacteria 28936
206 Ga0495606_0004594 3300046507 Bacteria 13685
207 Ga0495618_0015593 3300046514 Bacteria 4638
208 Ga0495618_0018843 3300046514 Bacteria 4240
209 Ga0495628_0027892 3300046516 Bacteria 4590
210 Ga0495630_0001863 3300046517 Bacteria 14720
211 Ga0495652_0001294 3300046529 Bacteria 27955
212 Ga0495652_0002682 3300046529 Bacteria 18106
213 Ga0495652_0008966 3300046529 Bacteria 9101
214 Ga0495665_0005788 3300046531 Bacteria 6671
215 Ga0495640_0112653 3300046533 Bacteria 1776
216 Ga0495587_0140025 3300046536 Bacteria 1381
217 Ga0495645_0011518 3300046543 Bacteria 6226
218 Ga0495645_0113920 3300046543 Bacteria 1911
219 Ga0495645_0131150 3300046543 Bacteria 1756
220 Ga0495667_0001291 3300046559 Bacteria 16416
221 Ga0495668_0000255 3300046616 Bacteria 75815
222 Ga0495634_0015187 3300046642 Bacteria 5536
223 Ga0495625_0001410 3300046660 Bacteria 29381
224 Ga0495635_0000377 3300046663 Bacteria 28228
225 Ga0495635_0010804 3300046663 Bacteria 6397
226 Ga0495657_0022314 3300046675 Bacteria 4537
227 Ga0495623_0127918 3300046679 Bacteria 1524
228 Ga0495646_0003675 3300046680 Bacteria 9574
229 Ga0495647_0026296 3300046681 Bacteria 2131
230 Ga0495647_0129602 3300046681 Bacteria 1068
231 Ga0495613_0002889 3300046689 Bacteria 12856
232 Ga0495624_0004080 3300046690 Bacteria 10739
233 Ga0495624_0220641 3300046690 Bacteria 1150
234 Ga0495589_0031599 3300046794 Bacteria 2664
235 Ga0495600_0010705 3300046809 Bacteria 5701
236 Ga0495600_0010849 3300046809 Bacteria 5666
237 Ga0495581_0042849 3300047315 Bacteria 2619
238 Ga0495604_0159311 3300047317 Bacteria 1596
239 Ga0495674_0001255 3300047319 Bacteria 24635
240 Ga0495676_0013416 3300047321 Bacteria 7361
241 Ga0495680_0008566 3300047322 Bacteria 9285
242 Ga0495684_0008535 3300047471 Bacteria 7933
243 Ga0495684_0218646 3300047471 Bacteria 1398
244 Ga0495593_0066982 3300047673 Bacteria 1870
245 Ga0495626_0000787 3300048091 Bacteria 28817
246 Ga0496100_0119537 3300048903 Bacteria 1841
247 Ga0496101_0166453 3300048904 Bacteria 1693
248 Ga0496101_0322958 3300048904 Bacteria 1211
249 Ga0496102_0000131 3300048905 Bacteria 104032
250 Ga0496102_0045679 3300048905 Bacteria 3977
251 Ga0496102_0071752 3300048905 Bacteria 3180
252 Ga0496102_0169845 3300048905 Bacteria 2053
253 Ga0496102_0350731 3300048905 Bacteria 1389
254 Ga0496103_0000442 3300048906 Bacteria 35651
255 Ga0496103_0019845 3300048906 Bacteria 4036
256 Ga0496104_0015543 3300048907 Bacteria 6895
257 Ga0496104_0140513 3300048907 Bacteria 2320
258 Ga0496104_0203005 3300048907 Bacteria 1894
259 Ga0496104_0213472 3300048907 Bacteria 1841
260 Ga0496104_0343198 3300048907 Bacteria 1406
261 Ga0496105_0047335 3300048908 Bacteria 3549
262 Ga0496105_0342856 3300048908 Bacteria 1194
263 Ga0496106_0020698 3300048909 Bacteria 4883
264 Ga0496107_0088161 3300048910 Bacteria 2265
265 Ga0496108_0051997 3300048911 Bacteria 3432
266 Ga0496108_0151812 3300048911 Bacteria 1999
267 Ga0496108_0253601 3300048911 Bacteria 1531
268 Ga0496109_0011983 3300048912 Bacteria 7467
269 Ga0496109_0070100 3300048912 Bacteria 3216
270 Ga0496109_0100708 3300048912 Bacteria 2681
271 Ga0496110_0000398 3300048913 Bacteria 29416
272 Ga0496110_0025615 3300048913 Bacteria 5043
273 Ga0496110_0050485 3300048913 Bacteria 3652
274 Ga0496111_0030703 3300048914 Bacteria 3822
275 Ga0496111_0080193 3300048914 Bacteria 2381
276 Ga0496112_0187653 3300048915 Bacteria 2030
277 Ga0496112_0227153 3300048915 Bacteria 1822
278 Ga0496113_0014095 3300048916 Bacteria 5442
279 Ga0496113_0265052 3300048916 Bacteria 1373
280 Ga0496114_0000772 3300048917 Bacteria 23939
281 Ga0496114_0182202 3300048917 Bacteria 1835
282 Ga0496114_0331919 3300048917 Bacteria 1344
283 Ga0496115_0134054 3300048918 Bacteria 2042
284 Ga0496115_0246091 3300048918 Bacteria 1473
285 Ga0496116_0000479 3300048919 Bacteria 55101
286 Ga0496117_0005492 3300048920 Bacteria 13288
287 Ga0496117_0014020 3300048920 Bacteria 6935
288 Ga0496117_0095364 3300048920 Bacteria 1901
289 Ga0496118_0005454 3300048921 Bacteria 14458
290 Ga0496118_0009325 3300048921 Bacteria 9944
291 Ga0496118_0066602 3300048921 Bacteria 2628
292 Ga0496119_0001729 3300048922 Bacteria 25469
293 Ga0496119_0002316 3300048922 Bacteria 21003
294 Ga0496119_0039539 3300048922 Bacteria 3029
295 Ga0496120_0000394 3300048923 Bacteria 70310
296 Ga0496120_0034861 3300048923 Bacteria 3011
297 Ga0496121_0013850 3300048924 Bacteria 8627
298 Ga0496121_0015966 3300048924 Bacteria 7790
299 Ga0496121_0019392 3300048924 Bacteria 6801
300 Ga0496121_0068143 3300048924 Bacteria 2880
301 Ga0496122_0000200 3300048925 Bacteria 133548
302 Ga0496123_0000076 3300048926 Bacteria 194050
303 Ga0496124_0011090 3300048927 Bacteria 9041
304 Ga0496124_0132802 3300048927 Bacteria 1975
305 Ga0496125_0086199 3300048928 Bacteria 2376
306 Ga0496126_0004281 3300048929 Bacteria 17159
307 Ga0496126_0072335 3300048929 Bacteria 3067
308 Ga0496126_0089522 3300048929 Bacteria 2709
309 Ga0496126_0103156 3300048929 Bacteria 2492
310 Ga0501031_0020362 3300049568 Bacteria 4324
311 Ga0501031_0094065 3300049568 Bacteria 1956
312 Ga0501032_0007199 3300049569 Bacteria 8137
313 Ga0501032_0029754 3300049569 Bacteria 3746
314 Ga0501033_0018556 3300049570 Bacteria 5257
315 Ga0501034_0013628 3300049571 Bacteria 8363
316 Ga0501034_0038202 3300049571 Bacteria 4862
317 Ga0501034_0147964 3300049571 Bacteria 2325
318 Ga0501036_0024539 3300049572 Bacteria 5084
319 Ga0501037_0006197 3300049573 Bacteria 8746
320 Ga0501038_0003184 3300049574 Bacteria 15304
321 Ga0501038_0061707 3300049574 Bacteria 3205
322 Ga0501042_0136789 3300049578 Bacteria 1766
323 Ga0501043_0025621 3300049579 Bacteria 4627
324 Ga0501047_0014631 3300049581 Bacteria 7465
325 Ga0501047_0025777 3300049581 Bacteria 5653
326 Ga0501070_0032413 3300049586 Bacteria 4373
327 Ga0501035_0034351 3300049822 Bacteria 4607
328 Ga0501044_0098229 3300049823 Bacteria 2948
329 Ga0501044_0163003 3300049823 Bacteria 2204
330 Ga0501045_0147630 3300049824 Bacteria 1750
331 nmdc:mga0yw44_37309_c1 3300050492 Bacteria 2869
332 nmdc:mga06z11_26771_c1 3300050494 Bacteria 2749
333 nmdc:mga07m45_36628_c1 3300050496 Bacteria 2734
334 nmdc:mga09592_176198_c1 3300050508 Bacteria 1849
335 nmdc:mga06r32_119359_c2 3300050510 Bacteria 2071
336 nmdc:mga0rr50_81806_c1 3300050513 Bacteria 2493
337 Ga0495601_0002620 3300053077 Bacteria 10204
338 Ga0495601_0179233 3300053077 Bacteria 1385
339 Ga0495612_0003021 3300053078 Bacteria 6977
340 Ga0495612_0067704 3300053078 Bacteria 1485
341 Ga0500566_0003245 3300053094 Bacteria 9726
342 Ga0500566_0015769 3300053094 Bacteria 4434
343 Ga0500560_029477 3300053107 Bacteria 1646
344 Ga0500559_0001119 3300053136 Bacteria 16143
345 Ga0500568_0003569 3300053139 Bacteria 8596
346 Ga0500573_0047362 3300053140 Bacteria 2477
347 Ga0500616_0000107 3300053153 Bacteria 153426
348 Ga0500616_0004448 3300053153 Bacteria 9985
349 Ga0500616_0004888 3300053153 Bacteria 9325
350 Ga0500616_0006039 3300053153 Bacteria 8047
351 Ga0501084_0128864 3300054114 Bacteria 2130
352 2508674061 2508501039 Bacteria 9978592
353 2515850570 2515154155 Bacteria 7985436
354 2554259867 2554235005 Bacteria 6457341
355 2559430310 2558860280 Bacteria 11429938
356 2579857357 2579778521 Bacteria 7624758
357 2619857391 2619618881 Bacteria 7521104
358 2620353195 2619619003 Bacteria 7619552
359 2626639016 2626541554 Bacteria 7741902
360 2643898434 2643221578 Bacteria 9213798
361 2644406350 2643221673 Bacteria 9196637
362 2689960134 2687453737 Bacteria 11203906
363 2739362560 2738543034 Bacteria 6084756
364 2760304911 2758568522 Bacteria 5953541
365 2760624981 2758568621 Bacteria 5967089
366 2784585702 2784132148 Bacteria 8627943
367 2795782310 2795385470 Bacteria 8317180
368 2795783868 2795385470 Bacteria 8317180
369 2808903158 2808606372 Bacteria 4649509
370 2809229203 2808606448 Bacteria 8656184
371 2842135720 2842134933 Bacteria 5847019
372 2867314586 2867312974 Bacteria 7058875
373 2867323412 2867319477 Bacteria 7069771
374 2873320562 2873314349 Bacteria 8512634
375 2884996986 2884994152 Bacteria 4492978
376 2887479454 2887478801 Bacteria 8972725
377 2891400901 2891395885 Bacteria 9251614
378 2891555750 2891554331 Bacteria 8812224
379 2891556191 2891554331 Bacteria 8812224
380 2935393838 2935390628 Bacteria 7043367
381 3006395309 3006393351 Bacteria 6615579
382 3006488451 3006486233 Bacteria 8157040
383 8003830503 8003830390 Bacteria 6541657
384 8003859071 8003856774 Bacteria 7675274
385 8003873322 8003870546 Bacteria 7396674
386 8025536591 8025530807 Bacteria 8495698
387 8033688631 8033684223 Bacteria 6906479
388 8033689583 8033684223 Bacteria 6906479
389 8054164523 8054160619 Bacteria 7783213
390 8054915073 8054913762 Bacteria 7713009
391 8054917463 8054913762 Bacteria 7713009
392 8054926815 8054920844 Bacteria 7068637
393 8055072188 8055066027 Bacteria 9479577
394 8055416516 8055412473 Bacteria 6257500
395 Ga0466969_0017731
396 JGI24740J21852_10021924
397 JGI24739J22299_10020034
398 JGI25406J46586_10004562
399 JGI25406J46586_10007573
400 rootH2_10139728
401 Ga0055540_1008703
402 Ga0055540_1011528
403 Ga0070658_10040410
404 Ga0070676_10107145
405 Ga0070683_100036040
406 Ga0070683_100251014
407 Ga0068868_100307807
408 Ga0070668_100002213
409 Ga0070669_100004217
410 Ga0070669_100207795
411 Ga0070671_100002883
412 Ga0070667_100000056
413 Ga0070667_100007990
414 Ga0070667_100028302
415 Ga0070703_10045191
416 Ga0070709_10000253
417 Ga0070714_100001552
418 Ga0070714_100066990
419 Ga0070714_100170648
420 Ga0070714_100323878
421 Ga0070714_100337490
422 Ga0070713_100003431
423 Ga0070713_100031894
424 Ga0070710_10000803
425 Ga0070710_10036836
426 Ga0070710_10138923
427 Ga0070711_100001328
428 Ga0070663_100060129
429 Ga0070679_100061894
430 Ga0070684_100255287
431 Ga0068853_100005735
432 Ga0068853_100023186
433 Ga0070665_100003218
434 Ga0070665_100068074
435 Ga0070665_100080279
436 Ga0070665_100087565
437 Ga0070665_100432426
438 Ga0068857_100107774
439 Ga0068854_100006263
440 Ga0068854_100173234
441 Ga0068852_100134268
442 Ga0068859_100001827
443 Ga0068863_100000200
444 Ga0068863_100004041
445 Ga0068863_100023145
446 Ga0068858_100000644
447 Ga0068858_100060307
448 Ga0068858_100118960
449 Ga0068860_100000092
450 Ga0068862_100000035
451 Ga0068862_100000066
452 Ga0068862_100067765
453 Ga0081455_10030752
454 Ga0081455_10091718
455 Ga0081540_1000261
456 Ga0081539_10000257
457 Ga0081539_10000911
458 Ga0070717_10004218
459 Ga0070716_100011211
460 Ga0075367_10040958
461 Ga0075369_10019482
462 Ga0075428_100043807
463 Ga0097620_100001827
464 Ga0105251_10041396
465 Ga0105240_10005968
466 Ga0105245_10009722
467 Ga0105247_10000302
468 Ga0105247_10119937
469 Ga0105247_10188448
470 Ga0105241_10002030
471 Ga0105248_10000036
472 Ga0105248_10001270
473 Ga0105248_10048964
474 Ga0105248_10448616
475 Ga0105238_10004351
476 Ga0105238_10010233
477 Ga0105238_10014214
478 Ga0105249_10000046
479 Ga0105249_10005903
480 Ga0105239_10165879
481 Ga0105239_10442844
482 Ga0105246_10050945
483 Ga0157370_10066253
484 Ga0157374_10013632
485 Ga0163162_10091426
486 Ga0157379_10025285
487 Ga0157379_10044196
488 Ga0157379_10075665
489 Ga0157379_10210528
490 Ga0182007_10000435
491 Ga0206351_11010482
492 Ga0224712_10065992
493 Ga0224572_1020742
494 Ga0209051_1007941
495 Ga0207692_10063291
496 Ga0207710_10000153
497 Ga0207710_10003929
498 Ga0207647_10003853
499 Ga0207647_10146284
500 Ga0207699_10008298
501 Ga0207707_10004577
502 Ga0207695_10004944
503 Ga0207671_10002858
504 Ga0207693_10008744
505 Ga0207663_10014062
506 Ga0207681_10002582
507 Ga0207694_10001720
508 Ga0207687_10022427
509 Ga0207700_10000434
510 Ga0207700_10017127
511 Ga0207700_10143345
512 Ga0207664_10001995
513 Ga0207664_10107094
514 Ga0207664_10309901
515 Ga0207644_10008872
516 Ga0207665_10001025
517 Ga0207711_10000073
518 Ga0207711_10000365
519 Ga0207711_10007397
520 Ga0207661_10070027
521 Ga0207667_10268915
522 Ga0207712_10000042
523 Ga0207712_10003025
524 Ga0207668_10003831
525 Ga0207658_10000377
526 Ga0207658_10042109
527 Ga0207703_10000071
528 Ga0207703_10064908
529 Ga0207703_10155921
530 Ga0207639_10101221
531 Ga0207678_10056157
532 Ga0207641_10000278
533 Ga0207641_10003567
534 Ga0207641_10020698
535 Ga0207676_10122088
536 Ga0207674_10354294
537 Ga0268266_10011123
538 Ga0268266_10028814
539 Ga0268266_10132137
540 Ga0268266_10369385
541 Ga0268265_10000051
542 Ga0268265_10000062
543 Ga0268265_10017359
544 Ga0268265_10112030
545 Ga0268264_10000108
546 Ga0265336_10008852
547 Ga0265338_10003914
548 Ga0265338_10006810
549 Ga0307511_10000187
550 Ga0316179_1010393
551 Ga0265330_10001571
552 Ga0265329_10003979
553 Ga0265339_10098762
554 Ga0265316_10001705
555 Ga0307509_10010065
556 Ga0307508_10102132
557 Ga0265342_10005342
558 Ga0307413_10069449
559 Ga0307413_10091095
560 Ga0373926_0027826
561 Ga0373944_0000351
562 Ga0373923_0034733
563 Ga0373936_0000130
564 Ga0373945_0005396
565 Ga0373943_0000783
566 Ga0373946_0000093
567 Ga0373935_0009564
568 Ga0373927_0001407
569 Ga0373947_0000281
570 Ga0373937_0032642
571 Ga0373937_0050400
572 Ga0373925_0000938
573 Ga0373925_0031257
574 Ga0373925_0053527
575 Ga0395898_0004266
576 Ga0436365_1594394
577 Ga0451789_0117443
578 Ga0451791_1274193
579 Ga0451793_0292334
580 Ga0466966_0011622
581 Ga0466963_0021545
582 Ga0453684_0078912
583 Ga0466970_0007394
584 Ga0466957_0013274
585 Ga0466959_0044121
586 Ga0451576_0279752
587 Ga0466958_0023075
588 Ga0466967_0001864
589 Ga0495592_0033925
590 Ga0495629_0028571
591 Ga0495629_0128692
592 Ga0495651_0000926
593 Ga0495651_0013688
594 Ga0495651_0036969
595 Ga0495653_0000632
596 Ga0495582_0180734
597 Ga0495605_0070261
598 Ga0495662_0037306
599 Ga0495664_0000201
600 Ga0495606_0004594
601 Ga0495618_0015593
602 Ga0495618_0018843
603 Ga0495628_0027892
604 Ga0495630_0001863
605 Ga0495652_0001294
606 Ga0495652_0002682
607 Ga0495652_0008966
608 Ga0495665_0005788
609 Ga0495640_0112653
610 Ga0495587_0140025
611 Ga0495645_0011518
612 Ga0495645_0113920
613 Ga0495645_0131150
614 Ga0495667_0001291
615 Ga0495668_0000255
616 Ga0495634_0015187
617 Ga0495625_0001410
618 Ga0495635_0000377
619 Ga0495635_0010804
620 Ga0495657_0022314
621 Ga0495623_0127918
622 Ga0495646_0003675
623 Ga0495647_0026296
624 Ga0495647_0129602
625 Ga0495613_0002889
626 Ga0495624_0004080
627 Ga0495624_0220641
628 Ga0495589_0031599
629 Ga0495600_0010705
630 Ga0495600_0010849
631 Ga0495581_0042849
632 Ga0495604_0159311
633 Ga0495674_0001255
634 Ga0495676_0013416
635 Ga0495680_0008566
636 Ga0495684_0008535
637 Ga0495684_0218646
638 Ga0495593_0066982
639 Ga0495626_0000787
640 Ga0496100_0119537
641 Ga0496101_0166453
642 Ga0496101_0322958
643 Ga0496102_0000131
644 Ga0496102_0045679
645 Ga0496102_0071752
646 Ga0496102_0169845
647 Ga0496102_0350731
648 Ga0496103_0000442
649 Ga0496103_0019845
650 Ga0496104_0015543
651 Ga0496104_0140513
652 Ga0496104_0203005
653 Ga0496104_0213472
654 Ga0496104_0343198
655 Ga0496105_0047335
656 Ga0496105_0342856
657 Ga0496106_0020698
658 Ga0496107_0088161
659 Ga0496108_0051997
660 Ga0496108_0151812
661 Ga0496108_0253601
662 Ga0496109_0011983
663 Ga0496109_0070100
664 Ga0496109_0100708
665 Ga0496110_0000398
666 Ga0496110_0025615
667 Ga0496110_0050485
668 Ga0496111_0030703
669 Ga0496111_0080193
670 Ga0496112_0187653
671 Ga0496112_0227153
672 Ga0496113_0014095
673 Ga0496113_0265052
674 Ga0496114_0000772
675 Ga0496114_0182202
676 Ga0496114_0331919
677 Ga0496115_0134054
678 Ga0496115_0246091
679 Ga0496116_0000479
680 Ga0496117_0005492
681 Ga0496117_0014020
682 Ga0496117_0095364
683 Ga0496118_0005454
684 Ga0496118_0009325
685 Ga0496118_0066602
686 Ga0496119_0001729
687 Ga0496119_0002316
688 Ga0496119_0039539
689 Ga0496120_0000394
690 Ga0496120_0034861
691 Ga0496121_0013850
692 Ga0496121_0015966
693 Ga0496121_0019392
694 Ga0496121_0068143
695 Ga0496122_0000200
696 Ga0496123_0000076
697 Ga0496124_0011090
698 Ga0496124_0132802
699 Ga0496125_0086199
700 Ga0496126_0004281
701 Ga0496126_0072335
702 Ga0496126_0089522
703 Ga0496126_0103156
704 Ga0501031_0020362
705 Ga0501031_0094065
706 Ga0501032_0007199
707 Ga0501032_0029754
708 Ga0501033_0018556
709 Ga0501034_0013628
710 Ga0501034_0038202
711 Ga0501034_0147964
712 Ga0501036_0024539
713 Ga0501037_0006197
714 Ga0501038_0003184
715 Ga0501038_0061707
716 Ga0501042_0136789
717 Ga0501043_0025621
718 Ga0501047_0014631
719 Ga0501047_0025777
720 Ga0501070_0032413
721 Ga0501035_0034351
722 Ga0501044_0098229
723 Ga0501044_0163003
724 Ga0501045_0147630
725 nmdc:mga0yw44_37309_c1
726 nmdc:mga06z11_26771_c1
727 nmdc:mga07m45_36628_c1
728 nmdc:mga09592_176198_c1
729 nmdc:mga06r32_119359_c2
730 nmdc:mga0rr50_81806_c1
731 Ga0495601_0002620
732 Ga0495601_0179233
733 Ga0495612_0003021
734 Ga0495612_0067704
735 Ga0500566_0003245
736 Ga0500566_0015769
737 Ga0500560_029477
738 Ga0500559_0001119
739 Ga0500568_0003569
740 Ga0500573_0047362
741 Ga0500616_0000107
742 Ga0500616_0004448
743 Ga0500616_0004888
744 Ga0500616_0006039
745 Ga0501084_0128864
746 2508674061
747 2515850570
748 2554259867
749 2559430310
750 2579857357
751 2619857391
752 2620353195
753 2626639016
754 2643898434
755 2644406350
756 2689960134
757 2739362560
758 2760304911
759 2760624981
760 2784585702
761 2795782310
762 2795783868
763 2808903158
764 2809229203
765 2842135720
766 2867314586
767 2867323412
768 2873320562
769 2884996986
770 2887479454
771 2891400901
772 2891555750
773 2891556191
774 2935393838
775 3006395309
776 3006488451
777 8003830503
778 8003859071
779 8003873322
780 8025536591
781 8033688631
782 8033689583
783 8054164523
784 8054915073
785 8054917463
786 8054926815
787 8055072188
788 8055416516

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

18

318

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4xk2-assembly2.cif.gz_B crystal structure of aldo-keto reductase from polaromonas sp. js666 0.9477 1 313
4xk2-assembly1.cif.gz_C crystal structure of aldo-keto reductase from polaromonas sp. js666 0.9358 1 313
3eb4-assembly1.cif.gz_A voltage-dependent k+ channel beta subunit (i211r) in complex with cortisone 0.9345 1 313
4xk2-assembly1.cif.gz_A crystal structure of aldo-keto reductase from polaromonas sp. js666 0.9324 1 313
3eb3-assembly1.cif.gz_A voltage-dependent k+ channel beta subunit (w121a) in complex with cortisone 0.9318 1 313
ID Description Score Start End Superfamily
af_O59826_13_339_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.952 1 313 3.20.20.100
4xk2A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9324 1 313 3.20.20.100
af_E9QGU5_66_406_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9313 1 313 3.20.20.100
4xapA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9303 1 316 3.20.20.100
af_C4J2K0_1_323_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9302 1 318 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A6B3IEK8-F1-model_v4 Aldo/keto reductase 1 1 197 GO:0005829
GO:0016491
AF-A0A6L8JNB1-F1-model_v4 deleted 0.9982 1 172
AF-A0A529VB17-F1-model_v4 deleted 0.997 1 211
AF-A0A536VSA5-F1-model_v4 Aldo/keto reductase 0.9966 1 173 GO:0005829
GO:0016491
AF-A0A2W6CGH3-F1-model_v4 Aldo/keto reductase 0.9949 2 157 GO:0005829
GO:0016491

Map