F432968

General Info

Members Datasets Scaffolds Average Seq Length
394 244 389 152

Family's Representative Sequence

Representative Sequence 3300039453|Ga0436362_0743795|Ga0436362_0743795_159_677
Length 172
Sequence MLLRKALTAGRIRSRTGILVAMTRNEITEQIVAARLAKGLTWQELADAIGRPVVWTTSALLGQHPIPAELGKVLVEMLGLDESAVAVLAAPPMRGGLPTAVPTDPTVYRFYEALQVYGGAIKELIHEKFGDGIMSAINFSVDLQKKPHPSGDRVVVTFDGKFLPYEWTSAEG

Samples

Sample ID Description Type Environment
1 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
2 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
3 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
4 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
5 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
11 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
12 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
105 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
107 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
153 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
154 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
155 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
156 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
161 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
162 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
163 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
164 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
165 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
166 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
167 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
168 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
169 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
170 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
171 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
172 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
173 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
174 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
175 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
176 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
177 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
178 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
179 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
180 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
181 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
182 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
183 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
184 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
185 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
186 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
187 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
188 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
189 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
190 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
191 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
192 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
193 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
198 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
203 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
204 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
205 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
206 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
207 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
208 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
209 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
210 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
211 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
212 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
213 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
214 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
223 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
224 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
225 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
227 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
228 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
229 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
230 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
231 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
232 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
233 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
234 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
235 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
236 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
237 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
238 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
239 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
240 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
241 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
242 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
243 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
244 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.73
Metatranscriptomes 0
Isolates 1.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.18
Nodule 0
Rhizoplane 6.85
Rhizosphere 69.8
Stem 0
Stem Tuber 0
Unclassified 11.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24747J21853_1014346 3300001978 Bacteria 824
2 JGI24739J22299_10112802 3300001989 Bacteria 815
3 JGI24748J21848_1009286 3300002074 Bacteria 1159
4 JGI24738J21930_10032516 3300002075 Bacteria 1064
5 JGI24744J21845_10012538 3300002077 Bacteria 1718
6 JGI24034J26672_10045329 3300002239 Bacteria 746
7 JGI24742J22300_10002954 3300002244 Bacteria 2744
8 Ga0055540_1003502 3300003792 Bacteria 7562
9 Ga0055540_1004290 3300003792 Bacteria 6509
10 Ga0055540_1005963 3300003792 Bacteria 4953
11 Ga0070676_10019371 3300005328 Bacteria 3785
12 Ga0070683_100167483 3300005329 Bacteria 2085
13 Ga0070690_100008679 3300005330 Bacteria 5863
14 Ga0070670_100811938 3300005331 Bacteria 845
15 Ga0068869_100091484 3300005334 Bacteria 2288
16 Ga0070666_10163571 3300005335 Bacteria 1556
17 Ga0070682_100004774 3300005337 Bacteria 7534
18 Ga0070682_100019825 3300005337 Bacteria 3949
19 Ga0068868_100061940 3300005338 Bacteria 2964
20 Ga0070689_100120476 3300005340 Bacteria 2095
21 Ga0070691_10013921 3300005341 Bacteria 3691
22 Ga0070687_100041783 3300005343 Bacteria 2319
23 Ga0070668_100013463 3300005347 Bacteria 6105
24 Ga0070668_100073309 3300005347 Bacteria 2669
25 Ga0070669_100022453 3300005353 Bacteria 4511
26 Ga0070669_100071507 3300005353 Bacteria 2567
27 Ga0070669_100076387 3300005353 Bacteria 2486
28 Ga0070671_100238655 3300005355 Bacteria 1543
29 Ga0070674_100015986 3300005356 Bacteria 4697
30 Ga0070673_101307333 3300005364 Bacteria 681
31 Ga0070688_100006857 3300005365 Bacteria 6113
32 Ga0070688_100738082 3300005365 Bacteria 765
33 Ga0070667_100000077 3300005367 Bacteria 120245
34 Ga0070667_100008439 3300005367 Bacteria 8543
35 Ga0070667_100600356 3300005367 Bacteria 1014
36 Ga0070709_10088221 3300005434 Bacteria 2040
37 Ga0070709_10113446 3300005434 Bacteria 1825
38 Ga0070714_100007619 3300005435 Bacteria 8429
39 Ga0070714_100077209 3300005435 Bacteria 2893
40 Ga0070714_100290353 3300005435 Bacteria 1522
41 Ga0070714_100623438 3300005435 Bacteria 1037
42 Ga0070714_100751438 3300005435 Bacteria 943
43 Ga0070713_100034905 3300005436 Bacteria 4046
44 Ga0070713_100514092 3300005436 Bacteria 1131
45 Ga0070710_10002676 3300005437 Bacteria 8464
46 Ga0070710_10017247 3300005437 Bacteria 3691
47 Ga0070701_10000850 3300005438 Bacteria 10958
48 Ga0070711_100002858 3300005439 Bacteria 9937
49 Ga0070705_100058606 3300005440 Bacteria 2276
50 Ga0070694_100099464 3300005444 Bacteria 2055
51 Ga0070663_100010753 3300005455 Bacteria 5715
52 Ga0070678_100000412 3300005456 Bacteria 20194
53 Ga0070681_10349473 3300005458 Bacteria 1389
54 Ga0068867_100001731 3300005459 Bacteria 15202
55 Ga0070706_101406714 3300005467 Bacteria 638
56 Ga0068853_100011274 3300005539 Bacteria 7255
57 Ga0068853_100043985 3300005539 Bacteria 3821
58 Ga0070672_100131546 3300005543 Bacteria 2057
59 Ga0070695_100003142 3300005545 Bacteria 9628
60 Ga0070696_100017739 3300005546 Bacteria 4806
61 Ga0070665_100048445 3300005548 Bacteria 4266
62 Ga0070665_100153382 3300005548 Bacteria 2306
63 Ga0070665_101165632 3300005548 Bacteria 782
64 Ga0070704_100000886 3300005549 Bacteria 14990
65 Ga0068855_101319680 3300005563 Bacteria 746
66 Ga0068854_100027615 3300005578 Bacteria 3914
67 Ga0068856_100829041 3300005614 Bacteria 944
68 Ga0070702_100000595 3300005615 Bacteria 13246
69 Ga0070702_101080378 3300005615 Bacteria 640
70 Ga0068859_100004531 3300005617 Bacteria 14169
71 Ga0068859_100050887 3300005617 Bacteria 4162
72 Ga0068866_10000844 3300005718 Bacteria 13608
73 Ga0068866_11037167 3300005718 Bacteria 584
74 Ga0068861_100010806 3300005719 Bacteria 6346
75 Ga0068861_100028159 3300005719 Bacteria 4099
76 Ga0068861_100323759 3300005719 Bacteria 1343
77 Ga0068863_100082447 3300005841 Bacteria 3048
78 Ga0068863_100275285 3300005841 Bacteria 1630
79 Ga0068858_100004987 3300005842 Bacteria 13007
80 Ga0068858_100032180 3300005842 Bacteria 4872
81 Ga0068860_100000010 3300005843 Bacteria 359114
82 Ga0068860_100070968 3300005843 Bacteria 3311
83 Ga0068860_100077247 3300005843 Bacteria 3166
84 Ga0068862_100000008 3300005844 Bacteria 305510
85 Ga0068862_100002812 3300005844 Bacteria 15253
86 Ga0081455_10022620 3300005937 Bacteria 5871
87 Ga0081455_10067238 3300005937 Bacteria 2987
88 Ga0070717_10250405 3300006028 Bacteria 1565
89 Ga0075365_10001874 3300006038 Bacteria 9897
90 Ga0075365_10305382 3300006038 Bacteria 1120
91 Ga0075363_100067434 3300006048 Bacteria 1939
92 Ga0075363_100385080 3300006048 Bacteria 823
93 Ga0075364_10008520 3300006051 Bacteria 6134
94 Ga0075364_10105974 3300006051 Bacteria 1873
95 Ga0075364_10643930 3300006051 Bacteria 724
96 Ga0070715_10089538 3300006163 Bacteria 1413
97 Ga0070716_100053220 3300006173 Bacteria 2307
98 Ga0070716_100089706 3300006173 Bacteria 1858
99 Ga0070712_100023243 3300006175 Bacteria 4093
100 Ga0075362_10057549 3300006177 Bacteria 1752
101 Ga0075367_10082094 3300006178 Bacteria 1951
102 Ga0075369_10021548 3300006186 Bacteria 2649
103 Ga0075369_10117961 3300006186 Bacteria 1200
104 Ga0075369_10270302 3300006186 Bacteria 791
105 Ga0075370_10021576 3300006353 Bacteria 3529
106 Ga0075370_10046370 3300006353 Bacteria 2459
107 Ga0068871_100036382 3300006358 Bacteria 3920
108 Ga0075428_100022285 3300006844 Bacteria 7013
109 Ga0075430_100021962 3300006846 Bacteria 5424
110 Ga0075431_100090538 3300006847 Bacteria 3158
111 Ga0068865_100031079 3300006881 Bacteria 3557
112 Ga0097620_100004531 3300006931 Bacteria 14169
113 Ga0097620_100050889 3300006931 Bacteria 4162
114 Ga0099795_10006404 3300007788 Bacteria 3211
115 Ga0105240_11038483 3300009093 Bacteria 875
116 Ga0105245_10001126 3300009098 Bacteria 24176
117 Ga0105247_10000019 3300009101 Bacteria 245170
118 Ga0105247_10001096 3300009101 Bacteria 20202
119 Ga0114129_10060401 3300009147 Bacteria 5300
120 Ga0105243_10003000 3300009148 Bacteria 13943
121 Ga0105241_10042542 3300009174 Bacteria 3438
122 Ga0105242_10028064 3300009176 Bacteria 4478
123 Ga0105248_10000093 3300009177 Bacteria 98669
124 Ga0105248_10034054 3300009177 Bacteria 5694
125 Ga0105237_10017582 3300009545 Bacteria 7411
126 Ga0105237_10107129 3300009545 Bacteria 2787
127 Ga0105238_10259847 3300009551 Bacteria 1716
128 Ga0105238_11084351 3300009551 Bacteria 823
129 Ga0105249_10000019 3300009553 Bacteria 273807
130 Ga0105249_10003476 3300009553 Bacteria 13648
131 Ga0105249_10112252 3300009553 Bacteria 2578
132 Ga0105249_11187868 3300009553 Unclassified 834
133 Ga0099796_10024375 3300010159 Bacteria 1899
134 Ga0105239_10010336 3300010375 Bacteria 10451
135 Ga0105239_10059762 3300010375 Bacteria 4183
136 Ga0105239_10451311 3300010375 Bacteria 1459
137 Ga0157369_10129213 3300013105 Bacteria 2678
138 Ga0157374_10206312 3300013296 Bacteria 1926
139 Ga0157378_10003396 3300013297 Bacteria 14157
140 Ga0163162_10003935 3300013306 Bacteria 14252
141 Ga0163162_10170010 3300013306 Bacteria 2304
142 Ga0163162_10223055 3300013306 Bacteria 2015
143 Ga0163162_11382008 3300013306 Bacteria 801
144 Ga0157372_10046403 3300013307 Bacteria 4823
145 Ga0157375_10000791 3300013308 Bacteria 27674
146 Ga0157380_10002198 3300014326 Bacteria 13105
147 Ga0157377_10443787 3300014745 Bacteria 894
148 Ga0157379_10137175 3300014968 Bacteria 2204
149 Ga0157379_11063244 3300014968 Bacteria 774
150 Ga0157376_11382626 3300014969 Bacteria 735
151 Ga0163161_10001275 3300017792 Bacteria 18812
152 Ga0163161_10060292 3300017792 Bacteria 2761
153 Ga0213876_10082904 3300021384 Bacteria 1696
154 Ga0209673_1015197 3300025273 Bacteria 2939
155 Ga0209025_1147646 3300025294 Bacteria 655
156 Ga0209051_1000567 3300025303 Bacteria 44848
157 Ga0209051_1005315 3300025303 Bacteria 7578
158 Ga0209051_1011882 3300025303 Bacteria 4258
159 Ga0209051_1017671 3300025303 Bacteria 3181
160 Ga0209051_1027308 3300025303 Bacteria 2277
161 Ga0209051_1066508 3300025303 Bacteria 1107
162 Ga0207682_10223481 3300025893 Bacteria 871
163 Ga0207692_10372047 3300025898 Bacteria 885
164 Ga0207642_10027308 3300025899 Bacteria 2335
165 Ga0207642_10845484 3300025899 Bacteria 584
166 Ga0207710_10000036 3300025900 Bacteria 245176
167 Ga0207688_10002386 3300025901 Bacteria 10111
168 Ga0207680_10184090 3300025903 Bacteria 1414
169 Ga0207699_10092721 3300025906 Bacteria 1899
170 Ga0207699_10468943 3300025906 Bacteria 905
171 Ga0207645_10025691 3300025907 Bacteria 3810
172 Ga0207671_10090568 3300025914 Bacteria 2304
173 Ga0207671_10271527 3300025914 Bacteria 1336
174 Ga0207693_10014735 3300025915 Bacteria 6281
175 Ga0207663_10073785 3300025916 Bacteria 2209
176 Ga0207662_10053621 3300025918 Bacteria 2403
177 Ga0207657_10468621 3300025919 Bacteria 988
178 Ga0207681_10003529 3300025923 Bacteria 9741
179 Ga0207681_10072036 3300025923 Bacteria 2412
180 Ga0207694_10256787 3300025924 Bacteria 1431
181 Ga0207687_10041289 3300025927 Bacteria 3167
182 Ga0207700_11504258 3300025928 Bacteria 597
183 Ga0207664_10024807 3300025929 Bacteria 4509
184 Ga0207664_10568103 3300025929 Bacteria 1018
185 Ga0207664_11948040 3300025929 Bacteria 510
186 Ga0207644_10112384 3300025931 Bacteria 2062
187 Ga0207706_10012282 3300025933 Bacteria 7804
188 Ga0207709_10023635 3300025935 Bacteria 3500
189 Ga0207670_10021742 3300025936 Bacteria 3963
190 Ga0207669_10063304 3300025937 Bacteria 2282
191 Ga0207669_10152606 3300025937 Bacteria 1620
192 Ga0207704_10080498 3300025938 Bacteria 2103
193 Ga0207704_10408896 3300025938 Bacteria 1073
194 Ga0207665_10063833 3300025939 Bacteria 2502
195 Ga0207711_10000102 3300025941 Bacteria 90198
196 Ga0207711_10077966 3300025941 Bacteria 2889
197 Ga0207661_10208955 3300025944 Bacteria 1719
198 Ga0207667_10103905 3300025949 Bacteria 2930
199 Ga0207712_10000025 3300025961 Bacteria 274015
200 Ga0207712_10049716 3300025961 Bacteria 2924
201 Ga0207712_10094892 3300025961 Bacteria 2205
202 Ga0207668_10198268 3300025972 Bacteria 1596
203 Ga0207668_11743048 3300025972 Bacteria 562
204 Ga0207640_10448790 3300025981 Bacteria 1062
205 Ga0207658_10002129 3300025986 Bacteria 14711
206 Ga0207677_10298810 3300026023 Bacteria 1329
207 Ga0207703_10010287 3300026035 Bacteria 7327
208 Ga0207703_10039022 3300026035 Bacteria 3793
209 Ga0207639_10002104 3300026041 Bacteria 13403
210 Ga0207639_10095690 3300026041 Bacteria 2387
211 Ga0207678_10004434 3300026067 Bacteria 12626
212 Ga0207678_10091103 3300026067 Bacteria 2606
213 Ga0207678_10148403 3300026067 Bacteria 2002
214 Ga0207702_10514098 3300026078 Bacteria 1168
215 Ga0207641_10043104 3300026088 Bacteria 3787
216 Ga0207641_10349490 3300026088 Bacteria 1409
217 Ga0207648_10006698 3300026089 Bacteria 11426
218 Ga0207675_100008102 3300026118 Bacteria 9900
219 Ga0207675_100383556 3300026118 Bacteria 1382
220 Ga0207683_10002027 3300026121 Bacteria 17914
221 Ga0268266_10009177 3300028379 Bacteria 8728
222 Ga0268266_10169665 3300028379 Bacteria 1980
223 Ga0268266_11301315 3300028379 Bacteria 702
224 Ga0268265_10000007 3300028380 Bacteria 431817
225 Ga0268265_10286972 3300028380 Bacteria 1475
226 Ga0268264_10000007 3300028381 Bacteria 815790
227 Ga0268264_10052664 3300028381 Bacteria 3394
228 Ga0268264_10097312 3300028381 Bacteria 2551
229 Ga0307405_11077222 3300031731 Bacteria 690
230 Ga0307413_10411238 3300031824 Bacteria 1063
231 Ga0307410_10127683 3300031852 Bacteria 1864
232 Ga0307406_10642238 3300031901 Bacteria 880
233 Ga0307407_10348465 3300031903 Bacteria 1048
234 Ga0307412_10333983 3300031911 Bacteria 1211
235 Ga0307409_101697620 3300031995 Bacteria 660
236 Ga0307416_102394196 3300032002 Bacteria 628
237 Ga0307415_100560129 3300032126 Bacteria 1010
238 Ga0373941_0087690 3300035115 Bacteria 1062
239 Ga0373931_0202566 3300035691 Bacteria 1186
240 Ga0436364_0426817 3300037853 Bacteria 52455
241 Ga0436365_0011552 3300039437 Bacteria 5282
242 Ga0436365_0374763 3300039437 Bacteria 625
243 Ga0436365_0712680 3300039437 Bacteria 47182
244 Ga0436365_0983079 3300039437 Bacteria 6284
245 Ga0436363_0807283 3300039450 Bacteria 2976
246 Ga0436363_0903752 3300039450 Bacteria 1558
247 Ga0436363_1310981 3300039450 Bacteria 629
248 Ga0436362_0743795 3300039453 Bacteria 775
249 Ga0451789_0711331 3300041443 Bacteria 642
250 Ga0451795_0920400 3300041456 Bacteria 852
251 Ga0451807_1229015 3300041486 Bacteria 1531
252 Ga0451833_0130817 3300041491 Bacteria 679
253 Ga0451833_1000054 3300041491 Bacteria 1035
254 Ga0451839_1092324 3300041496 Bacteria 1288
255 Ga0466965_0020099 3300044683 Bacteria 3208
256 Ga0466965_0038928 3300044683 Bacteria 2336
257 Ga0466966_0003951 3300044684 Bacteria 9796
258 Ga0466966_0008791 3300044684 Bacteria 6687
259 Ga0466961_0130462 3300044693 Bacteria 1575
260 Ga0466963_0046933 3300044694 Bacteria 2850
261 Ga0466963_0101019 3300044694 Bacteria 1974
262 Ga0466963_0140228 3300044694 Bacteria 1674
263 Ga0466964_0765803 3300044706 Bacteria 543
264 Ga0466971_0080566 3300044719 Bacteria 1484
265 Ga0466968_0001218 3300044735 Bacteria 9111
266 Ga0466968_0084637 3300044735 Bacteria 1398
267 Ga0466970_0028417 3300044765 Bacteria 2938
268 Ga0466957_0004344 3300044842 Bacteria 7876
269 Ga0466957_0046792 3300044842 Bacteria 2628
270 Ga0466957_0061774 3300044842 Bacteria 2300
271 Ga0466960_0001582 3300044901 Bacteria 8323
272 Ga0466960_0009906 3300044901 Bacteria 3942
273 Ga0466960_0551457 3300044901 Bacteria 680
274 Ga0466959_0246613 3300045049 Bacteria 1232
275 Ga0466958_0087251 3300045836 Bacteria 1926
276 Ga0466958_0135902 3300045836 Bacteria 1546
277 Ga0466967_0040552 3300045976 Bacteria 4009
278 Ga0466967_0134266 3300045976 Bacteria 2300
279 Ga0466967_0149894 3300045976 Bacteria 2179
280 Ga0466967_0172023 3300045976 Bacteria 2038
281 Ga0495583_0094644 3300046506 Bacteria 1282
282 Ga0495606_0025317 3300046507 Bacteria 4253
283 Ga0495648_0083570 3300046524 Bacteria 1808
284 Ga0495625_0344751 3300046660 Bacteria 943
285 Ga0495672_0000770 3300047320 Bacteria 34865
286 Ga0495673_0009985 3300047469 Bacteria 5200
287 Ga0495686_0325791 3300047472 Bacteria 841
288 Ga0495686_0345117 3300047472 Bacteria 811
289 Ga0496100_0006270 3300048903 Bacteria 6476
290 Ga0496100_0014024 3300048903 Bacteria 4643
291 Ga0496100_0062617 3300048903 Bacteria 2455
292 Ga0496100_0121033 3300048903 Bacteria 1831
293 Ga0496101_0000014 3300048904 Bacteria 253487
294 Ga0496101_0006865 3300048904 Bacteria 7348
295 Ga0496101_0019055 3300048904 Bacteria 4676
296 Ga0496101_0067404 3300048904 Bacteria 2613
297 Ga0496102_0000012 3300048905 Bacteria 315470
298 Ga0496102_0000112 3300048905 Bacteria 116902
299 Ga0496102_0077924 3300048905 Bacteria 3051
300 Ga0496103_0000005 3300048906 Bacteria 505416
301 Ga0496103_0000625 3300048906 Bacteria 27110
302 Ga0496103_0006151 3300048906 Bacteria 7174
303 Ga0496103_0140884 3300048906 Bacteria 1542
304 Ga0496106_0006710 3300048909 Bacteria 8527
305 Ga0496106_0047817 3300048909 Bacteria 3220
306 Ga0496107_0045728 3300048910 Bacteria 3149
307 Ga0496108_1173421 3300048911 Bacteria 650
308 Ga0496112_0237525 3300048915 Bacteria 1776
309 Ga0496113_0003095 3300048916 Bacteria 9879
310 Ga0496114_0019494 3300048917 Bacteria 5495
311 Ga0496114_1372238 3300048917 Bacteria 594
312 Ga0496115_0083075 3300048918 Bacteria 2610
313 Ga0496116_0000050 3300048919 Bacteria 311670
314 Ga0496116_0024878 3300048919 Bacteria 4415
315 Ga0496117_0000042 3300048920 Bacteria 315470
316 Ga0496117_0000719 3300048920 Bacteria 52226
317 Ga0496117_0010961 3300048920 Bacteria 8168
318 Ga0496118_0000037 3300048921 Bacteria 315470
319 Ga0496118_0000452 3300048921 Bacteria 67982
320 Ga0496118_0003415 3300048921 Bacteria 20065
321 Ga0496118_0059218 3300048921 Bacteria 2854
322 Ga0496119_0008326 3300048922 Bacteria 9138
323 Ga0496119_0016038 3300048922 Bacteria 5725
324 Ga0496119_0016055 3300048922 Bacteria 5721
325 Ga0496120_0007573 3300048923 Bacteria 8055
326 Ga0496120_0132788 3300048923 Bacteria 1273
327 Ga0496121_0000250 3300048924 Bacteria 114145
328 Ga0496121_0025722 3300048924 Bacteria 5574
329 Ga0496122_0051427 3300048925 Bacteria 3130
330 Ga0496123_0057606 3300048926 Bacteria 2527
331 Ga0496124_0039851 3300048927 Bacteria 4067
332 Ga0496124_0562522 3300048927 Bacteria 750
333 Ga0496125_0061470 3300048928 Bacteria 3012
334 Ga0496125_0123701 3300048928 Bacteria 1838
335 Ga0496126_0005371 3300048929 Bacteria 14636
336 Ga0496126_0017687 3300048929 Bacteria 7100
337 Ga0496126_0019235 3300048929 Bacteria 6730
338 Ga0496126_0030151 3300048929 Bacteria 5143
339 Ga0496126_0121555 3300048929 Bacteria 2264
340 Ga0496126_0296543 3300048929 Bacteria 1335
341 Ga0501032_0047599 3300049569 Bacteria 2895
342 Ga0501033_0098922 3300049570 Bacteria 2130
343 Ga0501034_0054844 3300049571 Bacteria 4012
344 Ga0501034_0081252 3300049571 Bacteria 3243
345 Ga0501037_0041755 3300049573 Bacteria 3372
346 Ga0501043_0011533 3300049579 Bacteria 6920
347 Ga0501046_0000931 3300049580 Bacteria 28738
348 Ga0501046_0400799 3300049580 Bacteria 991
349 Ga0501047_0010353 3300049581 Bacteria 8822
350 Ga0501047_0018956 3300049581 Bacteria 6599
351 Ga0501047_0026162 3300049581 Bacteria 5613
352 Ga0501047_0291616 3300049581 Bacteria 1475
353 Ga0501048_0096411 3300049582 Bacteria 2086
354 Ga0501069_0013269 3300049585 Bacteria 4390
355 Ga0501070_0059723 3300049586 Bacteria 3161
356 Ga0501070_0069839 3300049586 Bacteria 2908
357 Ga0501073_0302999 3300049589 Bacteria 1102
358 Ga0501073_0428047 3300049589 Bacteria 915
359 Ga0501035_0004777 3300049822 Bacteria 12865
360 Ga0501035_0012371 3300049822 Bacteria 7889
361 Ga0501044_0002883 3300049823 Bacteria 19574
362 Ga0501044_0014776 3300049823 Bacteria 8417
363 nmdc:mga03683_225967_c1 3300050489 Bacteria 864
364 nmdc:mga03683_80165_c1 3300050489 Bacteria 1408
365 nmdc:mga03n38_224936_c1 3300050490 Bacteria 981
366 nmdc:mga03n38_325_c1 3300050490 Bacteria 11543
367 nmdc:mga00v17_43763_c1 3300050491 Bacteria 2698
368 nmdc:mga00v17_633286_c1 3300050491 Bacteria 688
369 nmdc:mga0yw44_204144_c1 3300050492 Bacteria 1306
370 nmdc:mga0yw44_331632_c1 3300050492 Bacteria 1022
371 nmdc:mga0yw44_509245_c1 3300050492 Bacteria 817
372 nmdc:mga0yw44_749_c1 3300050492 Bacteria 4761
373 nmdc:mga06z11_407812_c1 3300050494 Bacteria 818
374 nmdc:mga07m45_22450_c1 3300050496 Bacteria 3445
375 nmdc:mga07m45_44360_c1 3300050496 Bacteria 2495
376 nmdc:mga05p37_295202_c1 3300050507 Bacteria 1928
377 nmdc:mga0qj67_7274_c1 3300050509 Bacteria 8178
378 nmdc:mga06r32_17566_c1 3300050510 Bacteria 6532
379 nmdc:mga0sz30_112415_c1 3300050516 Bacteria 1194
380 nmdc:mga0sz30_380852_c1 3300050516 Bacteria 631
381 nmdc:mga0sz30_69992_c1 3300050516 Bacteria 1509
382 Ga0500635_0047605 3300053080 Bacteria 1458
383 Ga0500578_0604756 3300053086 Bacteria 602
384 Ga0500643_002774 3300053087 Bacteria 8769
385 Ga0500652_001168 3300053131 Bacteria 8385
386 Ga0500561_0203846 3300053137 Bacteria 626
387 Ga0500568_0065985 3300053139 Bacteria 1393
388 Ga0500645_000029 3300053730 Bacteria 122362
389 Ga0466962_0209716 3300061719 Bacteria 953

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048927 Ga0496124_0562522 Ga0496124_0562522_344_715 123
2 iso_pu_bacteria 2902792274 2902796200 144
3 3300005337 Ga0070682_100019825 Ga0070682_1000198252 145
4 3300005539 Ga0068853_100011274 Ga0068853_1000112745 145
5 3300005718 Ga0068866_11037167 Ga0068866_110371672 145
6 3300006051 Ga0075364_10105974 Ga0075364_101059742 145
7 3300009093 Ga0105240_11038483 Ga0105240_110384832 145
8 3300009545 Ga0105237_10017582 Ga0105237_100175823 145
9 3300009551 Ga0105238_10259847 Ga0105238_102598472 145
10 3300009551 Ga0105238_11084351 Ga0105238_110843512 145
11 3300010375 Ga0105239_10010336 Ga0105239_100103367 145
12 3300025303 Ga0209051_1017671 Ga0209051_10176715 145
13 3300025899 Ga0207642_10845484 Ga0207642_108454841 145
14 3300025914 Ga0207671_10090568 Ga0207671_100905683 145
15 3300025924 Ga0207694_10256787 Ga0207694_102567872 145
16 3300026041 Ga0207639_10002104 Ga0207639_100021044 145
17 3300031824 Ga0307413_10411238 Ga0307413_104112381 145
18 3300031901 Ga0307406_10642238 Ga0307406_106422381 145
19 3300031903 Ga0307407_10348465 Ga0307407_103484652 145
20 3300044683 Ga0466965_0020099 Ga0466965_0020099_309_758 145
21 3300044901 Ga0466960_0001582 Ga0466960_0001582_3427_3876 145
22 3300046506 Ga0495583_0094644 Ga0495583_0094644_69_515 145
23 3300046507 Ga0495606_0025317 Ga0495606_0025317_1692_2138 145
24 3300046524 Ga0495648_0083570 Ga0495648_0083570_505_951 145
25 3300046660 Ga0495625_0344751 Ga0495625_0344751_187_633 145
26 3300047320 Ga0495672_0000770 Ga0495672_0000770_8880_9326 145
27 3300047469 Ga0495673_0009985 Ga0495673_0009985_3987_4433 145
28 3300047472 Ga0495686_0345117 Ga0495686_0345117_135_587 145
29 3300048903 Ga0496100_0006270 Ga0496100_0006270_4546_4992 145
30 3300048904 Ga0496101_0000014 Ga0496101_0000014_4793_5239 145
31 3300048905 Ga0496102_0000012 Ga0496102_0000012_310203_310649 145
32 3300048906 Ga0496103_0000005 Ga0496103_0000005_4814_5260 145
33 3300048909 Ga0496106_0006710 Ga0496106_0006710_4528_4974 145
34 3300048917 Ga0496114_1372238 Ga0496114_1372238_13_459 145
35 3300048919 Ga0496116_0000050 Ga0496116_0000050_306424_306870 145
36 3300048920 Ga0496117_0000042 Ga0496117_0000042_4822_5268 145
37 3300048920 Ga0496117_0010961 Ga0496117_0010961_6843_7280 145
38 3300048921 Ga0496118_0000037 Ga0496118_0000037_4822_5268 145
39 3300048921 Ga0496118_0059218 Ga0496118_0059218_702_1139 145
40 3300048922 Ga0496119_0016038 Ga0496119_0016038_3206_3643 145
41 3300048922 Ga0496119_0016055 Ga0496119_0016055_3032_3478 145
42 3300048923 Ga0496120_0007573 Ga0496120_0007573_4818_5264 145
43 3300048924 Ga0496121_0000250 Ga0496121_0000250_108879_109325 145
44 3300048929 Ga0496126_0019235 Ga0496126_0019235_5034_5480 145
45 3300048929 Ga0496126_0121555 Ga0496126_0121555_1458_1904 145
46 3300053080 Ga0500635_0047605 Ga0500635_0047605_111_551 145
47 3300053087 Ga0500643_002774 Ga0500643_002774_5623_6069 145
48 3300053131 Ga0500652_001168 Ga0500652_001168_44_484 145
49 iso_pu_bacteria 2643221687 2644487384 145
50 iso_pu_bacteria 2939582691 2939588716 145
51 3300005719 Ga0068861_100323759 Ga0068861_1003237591 146
52 3300009553 Ga0105249_11187868 Ga0105249_111878681 146
53 3300013306 Ga0163162_10003935 Ga0163162_100039358 146
54 3300026118 Ga0207675_100383556 Ga0207675_1003835562 146
55 3300048903 Ga0496100_0121033 Ga0496100_0121033_646_1086 146
56 3300048904 Ga0496101_0006865 Ga0496101_0006865_5379_5819 146
57 3300048916 Ga0496113_0003095 Ga0496113_0003095_3597_4037 146
58 3300048923 Ga0496120_0132788 Ga0496120_0132788_410_850 146
59 3300048925 Ga0496122_0051427 Ga0496122_0051427_720_1160 146
60 3300048926 Ga0496123_0057606 Ga0496123_0057606_927_1367 146
61 3300048929 Ga0496126_0005371 Ga0496126_0005371_3914_4354 146
62 iso_pu_bacteria 2643221687 2644489235 146
63 3300041496 Ga0451839_1092324 Ga0451839_1092324_72_518 147
64 iso_pu_bacteria 2902837492 2902838227 147
65 3300003792 Ga0055540_1004290 Ga0055540_10042903 150
66 3300003792 Ga0055540_1005963 Ga0055540_10059633 150
67 3300006186 Ga0075369_10270302 Ga0075369_102703022 150
68 3300025303 Ga0209051_1005315 Ga0209051_10053158 150
69 3300025303 Ga0209051_1011882 Ga0209051_10118822 150
70 3300028379 Ga0268266_11301315 Ga0268266_113013152 150
71 3300041443 Ga0451789_0711331 Ga0451789_0711331_136_588 150
72 3300041456 Ga0451795_0920400 Ga0451795_0920400_384_836 150
73 3300041486 Ga0451807_1229015 Ga0451807_1229015_657_1109 150
74 3300041491 Ga0451833_1000054 Ga0451833_1000054_391_843 150
75 3300045976 Ga0466967_0040552 Ga0466967_0040552_1624_2088 150
76 3300049581 Ga0501047_0018956 Ga0501047_0018956_3118_3591 150
77 3300049585 Ga0501069_0013269 Ga0501069_0013269_2691_3164 150
78 3300049586 Ga0501070_0059723 Ga0501070_0059723_1676_2149 150
79 3300050492 nmdc:mga0yw44_331632_c1 nmdc:mga0yw44_331632_c1_288_740 150
80 3300050492 nmdc:mga0yw44_509245_c1 nmdc:mga0yw44_509245_c1_24_476 150
81 3300050516 nmdc:mga0sz30_112415_c1 nmdc:mga0sz30_112415_c1_398_850 150
82 3300050516 nmdc:mga0sz30_380852_c1 nmdc:mga0sz30_380852_c1_133_585 150
83 3300001978 JGI24747J21853_1014346 JGI24747J21853_10143461 151
84 3300001989 JGI24739J22299_10112802 JGI24739J22299_101128022 151
85 3300002074 JGI24748J21848_1009286 JGI24748J21848_10092862 151
86 3300002075 JGI24738J21930_10032516 JGI24738J21930_100325162 151
87 3300002077 JGI24744J21845_10012538 JGI24744J21845_100125382 151
88 3300002239 JGI24034J26672_10045329 JGI24034J26672_100453292 151
89 3300002244 JGI24742J22300_10002954 JGI24742J22300_100029542 151
90 3300003792 Ga0055540_1003502 Ga0055540_10035026 151
91 3300005328 Ga0070676_10019371 Ga0070676_100193713 151
92 3300005329 Ga0070683_100167483 Ga0070683_1001674833 151
93 3300005330 Ga0070690_100008679 Ga0070690_1000086794 151
94 3300005331 Ga0070670_100811938 Ga0070670_1008119381 151
95 3300005334 Ga0068869_100091484 Ga0068869_1000914842 151
96 3300005335 Ga0070666_10163571 Ga0070666_101635712 151
97 3300005337 Ga0070682_100004774 Ga0070682_1000047742 151
98 3300005338 Ga0068868_100061940 Ga0068868_1000619402 151
99 3300005340 Ga0070689_100120476 Ga0070689_1001204762 151
100 3300005341 Ga0070691_10013921 Ga0070691_100139215 151
101 3300005343 Ga0070687_100041783 Ga0070687_1000417834 151
102 3300005347 Ga0070668_100013463 Ga0070668_1000134636 151
103 3300005347 Ga0070668_100073309 Ga0070668_1000733092 151
104 3300005353 Ga0070669_100022453 Ga0070669_1000224534 151
105 3300005353 Ga0070669_100071507 Ga0070669_1000715074 151
106 3300005353 Ga0070669_100076387 Ga0070669_1000763872 151
107 3300005355 Ga0070671_100238655 Ga0070671_1002386552 151
108 3300005356 Ga0070674_100015986 Ga0070674_1000159864 151
109 3300005364 Ga0070673_101307333 Ga0070673_1013073331 151
110 3300005365 Ga0070688_100006857 Ga0070688_1000068576 151
111 3300005365 Ga0070688_100738082 Ga0070688_1007380821 151
112 3300005367 Ga0070667_100000077 Ga0070667_10000007782 151
113 3300005367 Ga0070667_100008439 Ga0070667_1000084393 151
114 3300005367 Ga0070667_100600356 Ga0070667_1006003561 151
115 3300005434 Ga0070709_10088221 Ga0070709_100882212 151
116 3300005434 Ga0070709_10113446 Ga0070709_101134463 151
117 3300005435 Ga0070714_100007619 Ga0070714_1000076196 151
118 3300005435 Ga0070714_100077209 Ga0070714_1000772093 151
119 3300005435 Ga0070714_100290353 Ga0070714_1002903532 151
120 3300005435 Ga0070714_100623438 Ga0070714_1006234382 151
121 3300005435 Ga0070714_100751438 Ga0070714_1007514382 151
122 3300005436 Ga0070713_100034905 Ga0070713_1000349054 151
123 3300005436 Ga0070713_100514092 Ga0070713_1005140921 151
124 3300005437 Ga0070710_10002676 Ga0070710_100026766 151
125 3300005437 Ga0070710_10017247 Ga0070710_100172473 151
126 3300005438 Ga0070701_10000850 Ga0070701_100008503 151
127 3300005439 Ga0070711_100002858 Ga0070711_1000028583 151
128 3300005440 Ga0070705_100058606 Ga0070705_1000586063 151
129 3300005444 Ga0070694_100099464 Ga0070694_1000994642 151
130 3300005455 Ga0070663_100010753 Ga0070663_1000107532 151
131 3300005456 Ga0070678_100000412 Ga0070678_1000004125 151
132 3300005458 Ga0070681_10349473 Ga0070681_103494732 151
133 3300005459 Ga0068867_100001731 Ga0068867_1000017318 151
134 3300005467 Ga0070706_101406714 Ga0070706_1014067141 151
135 3300005539 Ga0068853_100043985 Ga0068853_1000439852 151
136 3300005543 Ga0070672_100131546 Ga0070672_1001315461 151
137 3300005545 Ga0070695_100003142 Ga0070695_10000314210 151
138 3300005546 Ga0070696_100017739 Ga0070696_1000177394 151
139 3300005548 Ga0070665_100048445 Ga0070665_1000484454 151
140 3300005548 Ga0070665_100153382 Ga0070665_1001533823 151
141 3300005548 Ga0070665_101165632 Ga0070665_1011656322 151
142 3300005549 Ga0070704_100000886 Ga0070704_1000008868 151
143 3300005563 Ga0068855_101319680 Ga0068855_1013196802 151
144 3300005578 Ga0068854_100027615 Ga0068854_1000276152 151
145 3300005614 Ga0068856_100829041 Ga0068856_1008290412 151
146 3300005615 Ga0070702_100000595 Ga0070702_10000059510 151
147 3300005615 Ga0070702_101080378 Ga0070702_1010803781 151
148 3300005617 Ga0068859_100004531 Ga0068859_10000453111 151
149 3300005617 Ga0068859_100050887 Ga0068859_1000508872 151
150 3300005718 Ga0068866_10000844 Ga0068866_1000084416 151
151 3300005719 Ga0068861_100010806 Ga0068861_1000108066 151
152 3300005719 Ga0068861_100028159 Ga0068861_1000281591 151
153 3300005841 Ga0068863_100082447 Ga0068863_1000824473 151
154 3300005841 Ga0068863_100275285 Ga0068863_1002752852 151
155 3300005842 Ga0068858_100004987 Ga0068858_1000049872 151
156 3300005842 Ga0068858_100032180 Ga0068858_1000321805 151
157 3300005843 Ga0068860_100000010 Ga0068860_100000010266 151
158 3300005843 Ga0068860_100070968 Ga0068860_1000709682 151
159 3300005843 Ga0068860_100077247 Ga0068860_1000772473 151
160 3300005844 Ga0068862_100000008 Ga0068862_10000000857 151
161 3300005844 Ga0068862_100002812 Ga0068862_10000281211 151
162 3300005937 Ga0081455_10022620 Ga0081455_100226206 151
163 3300005937 Ga0081455_10067238 Ga0081455_100672381 151
164 3300006028 Ga0070717_10250405 Ga0070717_102504052 151
165 3300006038 Ga0075365_10001874 Ga0075365_100018743 151
166 3300006038 Ga0075365_10305382 Ga0075365_103053822 151
167 3300006048 Ga0075363_100067434 Ga0075363_1000674342 151
168 3300006048 Ga0075363_100385080 Ga0075363_1003850802 151
169 3300006051 Ga0075364_10008520 Ga0075364_100085203 151
170 3300006051 Ga0075364_10643930 Ga0075364_106439301 151
171 3300006163 Ga0070715_10089538 Ga0070715_100895382 151
172 3300006173 Ga0070716_100053220 Ga0070716_1000532202 151
173 3300006173 Ga0070716_100089706 Ga0070716_1000897062 151
174 3300006175 Ga0070712_100023243 Ga0070712_1000232433 151
175 3300006177 Ga0075362_10057549 Ga0075362_100575491 151
176 3300006178 Ga0075367_10082094 Ga0075367_100820942 151
177 3300006186 Ga0075369_10021548 Ga0075369_100215482 151
178 3300006186 Ga0075369_10117961 Ga0075369_101179612 151
179 3300006353 Ga0075370_10021576 Ga0075370_100215763 151
180 3300006353 Ga0075370_10046370 Ga0075370_100463704 151
181 3300006358 Ga0068871_100036382 Ga0068871_1000363822 151
182 3300006844 Ga0075428_100022285 Ga0075428_1000222857 151
183 3300006846 Ga0075430_100021962 Ga0075430_1000219622 151
184 3300006847 Ga0075431_100090538 Ga0075431_1000905384 151
185 3300006881 Ga0068865_100031079 Ga0068865_1000310794 151
186 3300006931 Ga0097620_100004531 Ga0097620_1000045313 151
187 3300006931 Ga0097620_100050889 Ga0097620_1000508892 151
188 3300007788 Ga0099795_10006404 Ga0099795_100064046 151
189 3300009098 Ga0105245_10001126 Ga0105245_1000112611 151
190 3300009101 Ga0105247_10000019 Ga0105247_10000019198 151
191 3300009101 Ga0105247_10001096 Ga0105247_100010965 151
192 3300009147 Ga0114129_10060401 Ga0114129_100604015 151
193 3300009148 Ga0105243_10003000 Ga0105243_100030007 151
194 3300009174 Ga0105241_10042542 Ga0105241_100425423 151
195 3300009176 Ga0105242_10028064 Ga0105242_100280643 151
196 3300009177 Ga0105248_10000093 Ga0105248_1000009374 151
197 3300009177 Ga0105248_10034054 Ga0105248_100340542 151
198 3300009545 Ga0105237_10107129 Ga0105237_101071292 151
199 3300009553 Ga0105249_10000019 Ga0105249_1000001955 151
200 3300009553 Ga0105249_10003476 Ga0105249_100034763 151
201 3300009553 Ga0105249_10112252 Ga0105249_101122522 151
202 3300010159 Ga0099796_10024375 Ga0099796_100243752 151
203 3300010375 Ga0105239_10059762 Ga0105239_100597623 151
204 3300010375 Ga0105239_10451311 Ga0105239_104513111 151
205 3300013105 Ga0157369_10129213 Ga0157369_101292132 151
206 3300013296 Ga0157374_10206312 Ga0157374_102063122 151
207 3300013297 Ga0157378_10003396 Ga0157378_100033964 151
208 3300013306 Ga0163162_10170010 Ga0163162_101700103 151
209 3300013306 Ga0163162_10223055 Ga0163162_102230552 151
210 3300013306 Ga0163162_11382008 Ga0163162_113820082 151
211 3300013307 Ga0157372_10046403 Ga0157372_100464032 151
212 3300013308 Ga0157375_10000791 Ga0157375_100007917 151
213 3300014326 Ga0157380_10002198 Ga0157380_1000219811 151
214 3300014745 Ga0157377_10443787 Ga0157377_104437872 151
215 3300014968 Ga0157379_10137175 Ga0157379_101371752 151
216 3300014968 Ga0157379_11063244 Ga0157379_110632441 151
217 3300014969 Ga0157376_11382626 Ga0157376_113826261 151
218 3300017792 Ga0163161_10001275 Ga0163161_100012753 151
219 3300017792 Ga0163161_10060292 Ga0163161_100602922 151
220 3300021384 Ga0213876_10082904 Ga0213876_100829042 151
221 3300025273 Ga0209673_1015197 Ga0209673_10151972 151
222 3300025294 Ga0209025_1147646 Ga0209025_11476461 151
223 3300025303 Ga0209051_1000567 Ga0209051_100056739 151
224 3300025303 Ga0209051_1027308 Ga0209051_10273082 151
225 3300025303 Ga0209051_1066508 Ga0209051_10665082 151
226 3300025893 Ga0207682_10223481 Ga0207682_102234811 151
227 3300025898 Ga0207692_10372047 Ga0207692_103720472 151
228 3300025899 Ga0207642_10027308 Ga0207642_100273082 151
229 3300025900 Ga0207710_10000036 Ga0207710_1000003640 151
230 3300025901 Ga0207688_10002386 Ga0207688_100023863 151
231 3300025903 Ga0207680_10184090 Ga0207680_101840902 151
232 3300025906 Ga0207699_10092721 Ga0207699_100927211 151
233 3300025906 Ga0207699_10468943 Ga0207699_104689432 151
234 3300025907 Ga0207645_10025691 Ga0207645_100256913 151
235 3300025914 Ga0207671_10271527 Ga0207671_102715272 151
236 3300025915 Ga0207693_10014735 Ga0207693_100147356 151
237 3300025916 Ga0207663_10073785 Ga0207663_100737853 151
238 3300025918 Ga0207662_10053621 Ga0207662_100536212 151
239 3300025919 Ga0207657_10468621 Ga0207657_104686211 151
240 3300025923 Ga0207681_10003529 Ga0207681_1000352914 151
241 3300025923 Ga0207681_10072036 Ga0207681_100720362 151
242 3300025927 Ga0207687_10041289 Ga0207687_100412893 151
243 3300025928 Ga0207700_11504258 Ga0207700_115042581 151
244 3300025929 Ga0207664_10024807 Ga0207664_100248072 151
245 3300025929 Ga0207664_10568103 Ga0207664_105681032 151
246 3300025929 Ga0207664_11948040 Ga0207664_119480401 151
247 3300025931 Ga0207644_10112384 Ga0207644_101123843 151
248 3300025933 Ga0207706_10012282 Ga0207706_100122825 151
249 3300025935 Ga0207709_10023635 Ga0207709_100236353 151
250 3300025936 Ga0207670_10021742 Ga0207670_100217422 151
251 3300025937 Ga0207669_10063304 Ga0207669_100633042 151
252 3300025937 Ga0207669_10152606 Ga0207669_101526062 151
253 3300025938 Ga0207704_10080498 Ga0207704_100804982 151
254 3300025938 Ga0207704_10408896 Ga0207704_104088961 151
255 3300025939 Ga0207665_10063833 Ga0207665_100638333 151
256 3300025941 Ga0207711_10000102 Ga0207711_100001029 151
257 3300025941 Ga0207711_10077966 Ga0207711_100779664 151
258 3300025944 Ga0207661_10208955 Ga0207661_102089552 151
259 3300025949 Ga0207667_10103905 Ga0207667_101039051 151
260 3300025961 Ga0207712_10000025 Ga0207712_10000025196 151
261 3300025961 Ga0207712_10049716 Ga0207712_100497162 151
262 3300025961 Ga0207712_10094892 Ga0207712_100948923 151
263 3300025972 Ga0207668_10198268 Ga0207668_101982682 151
264 3300025972 Ga0207668_11743048 Ga0207668_117430481 151
265 3300025981 Ga0207640_10448790 Ga0207640_104487901 151
266 3300025986 Ga0207658_10002129 Ga0207658_100021292 151
267 3300026023 Ga0207677_10298810 Ga0207677_102988102 151
268 3300026035 Ga0207703_10010287 Ga0207703_100102872 151
269 3300026035 Ga0207703_10039022 Ga0207703_100390222 151
270 3300026041 Ga0207639_10095690 Ga0207639_100956903 151
271 3300026067 Ga0207678_10004434 Ga0207678_100044344 151
272 3300026067 Ga0207678_10091103 Ga0207678_100911032 151
273 3300026067 Ga0207678_10148403 Ga0207678_101484032 151
274 3300026078 Ga0207702_10514098 Ga0207702_105140981 151
275 3300026088 Ga0207641_10043104 Ga0207641_100431045 151
276 3300026088 Ga0207641_10349490 Ga0207641_103494902 151
277 3300026089 Ga0207648_10006698 Ga0207648_1000669815 151
278 3300026118 Ga0207675_100008102 Ga0207675_10000810210 151
279 3300026121 Ga0207683_10002027 Ga0207683_1000202713 151
280 3300028379 Ga0268266_10009177 Ga0268266_100091777 151
281 3300028379 Ga0268266_10169665 Ga0268266_101696653 151
282 3300028380 Ga0268265_10000007 Ga0268265_1000000755 151
283 3300028380 Ga0268265_10286972 Ga0268265_102869723 151
284 3300028381 Ga0268264_10000007 Ga0268264_10000007191 151
285 3300028381 Ga0268264_10052664 Ga0268264_100526642 151
286 3300028381 Ga0268264_10097312 Ga0268264_100973122 151
287 3300031731 Ga0307405_11077222 Ga0307405_110772221 151
288 3300031852 Ga0307410_10127683 Ga0307410_101276832 151
289 3300031911 Ga0307412_10333983 Ga0307412_103339832 151
290 3300031995 Ga0307409_101697620 Ga0307409_1016976201 151
291 3300032002 Ga0307416_102394196 Ga0307416_1023941961 151
292 3300032126 Ga0307415_100560129 Ga0307415_1005601292 151
293 3300035115 Ga0373941_0087690 Ga0373941_0087690_558_1013 151
294 3300035691 Ga0373931_0202566 Ga0373931_0202566_630_1085 151
295 3300037853 Ga0436364_0426817 Ga0436364_0426817_36791_37294 151
296 3300039437 Ga0436365_0011552 Ga0436365_0011552_2324_2827 151
297 3300039437 Ga0436365_0374763 Ga0436365_0374763_61_528 151
298 3300039437 Ga0436365_0712680 Ga0436365_0712680_44594_45049 151
299 3300039437 Ga0436365_0983079 Ga0436365_0983079_178_645 151
300 3300039450 Ga0436363_0807283 Ga0436363_0807283_742_1197 151
301 3300039450 Ga0436363_0903752 Ga0436363_0903752_63_551 151
302 3300039450 Ga0436363_1310981 Ga0436363_1310981_82_585 151
303 3300039453 Ga0436362_0743795 Ga0436362_0743795_159_677 151
304 3300041491 Ga0451833_0130817 Ga0451833_0130817_79_534 151
305 3300044683 Ga0466965_0038928 Ga0466965_0038928_613_1068 151
306 3300044684 Ga0466966_0003951 Ga0466966_0003951_7815_8270 151
307 3300044684 Ga0466966_0008791 Ga0466966_0008791_5344_5811 151
308 3300044693 Ga0466961_0130462 Ga0466961_0130462_330_785 151
309 3300044694 Ga0466963_0046933 Ga0466963_0046933_825_1280 151
310 3300044694 Ga0466963_0101019 Ga0466963_0101019_1024_1479 151
311 3300044694 Ga0466963_0140228 Ga0466963_0140228_1139_1594 151
312 3300044706 Ga0466964_0765803 Ga0466964_0765803_59_514 151
313 3300044719 Ga0466971_0080566 Ga0466971_0080566_538_993 151
314 3300044735 Ga0466968_0001218 Ga0466968_0001218_1644_2111 151
315 3300044735 Ga0466968_0084637 Ga0466968_0084637_165_620 151
316 3300044765 Ga0466970_0028417 Ga0466970_0028417_2201_2668 151
317 3300044842 Ga0466957_0004344 Ga0466957_0004344_5899_6354 151
318 3300044842 Ga0466957_0046792 Ga0466957_0046792_1475_1930 151
319 3300044842 Ga0466957_0061774 Ga0466957_0061774_1213_1668 151
320 3300044901 Ga0466960_0009906 Ga0466960_0009906_911_1366 151
321 3300044901 Ga0466960_0551457 Ga0466960_0551457_95_550 151
322 3300045049 Ga0466959_0246613 Ga0466959_0246613_752_1207 151
323 3300045836 Ga0466958_0087251 Ga0466958_0087251_192_647 151
324 3300045836 Ga0466958_0135902 Ga0466958_0135902_218_673 151
325 3300045976 Ga0466967_0134266 Ga0466967_0134266_78_533 151
326 3300045976 Ga0466967_0149894 Ga0466967_0149894_983_1459 151
327 3300045976 Ga0466967_0172023 Ga0466967_0172023_454_909 151
328 3300047472 Ga0495686_0325791 Ga0495686_0325791_32_487 151
329 3300048903 Ga0496100_0014024 Ga0496100_0014024_155_616 151
330 3300048903 Ga0496100_0062617 Ga0496100_0062617_452_907 151
331 3300048904 Ga0496101_0019055 Ga0496101_0019055_2468_2929 151
332 3300048904 Ga0496101_0067404 Ga0496101_0067404_199_654 151
333 3300048905 Ga0496102_0000112 Ga0496102_0000112_36709_37170 151
334 3300048905 Ga0496102_0077924 Ga0496102_0077924_985_1440 151
335 3300048906 Ga0496103_0000625 Ga0496103_0000625_3070_3531 151
336 3300048906 Ga0496103_0006151 Ga0496103_0006151_3694_4149 151
337 3300048906 Ga0496103_0140884 Ga0496103_0140884_417_884 151
338 3300048909 Ga0496106_0047817 Ga0496106_0047817_885_1340 151
339 3300048910 Ga0496107_0045728 Ga0496107_0045728_1744_2199 151
340 3300048911 Ga0496108_1173421 Ga0496108_1173421_94_555 151
341 3300048915 Ga0496112_0237525 Ga0496112_0237525_688_1143 151
342 3300048917 Ga0496114_0019494 Ga0496114_0019494_4071_4526 151
343 3300048918 Ga0496115_0083075 Ga0496115_0083075_1037_1492 151
344 3300048919 Ga0496116_0024878 Ga0496116_0024878_1837_2298 151
345 3300048920 Ga0496117_0000719 Ga0496117_0000719_1812_2273 151
346 3300048921 Ga0496118_0000452 Ga0496118_0000452_51759_52226 151
347 3300048921 Ga0496118_0003415 Ga0496118_0003415_11738_12199 151
348 3300048922 Ga0496119_0008326 Ga0496119_0008326_4000_4461 151
349 3300048924 Ga0496121_0025722 Ga0496121_0025722_4188_4649 151
350 3300048927 Ga0496124_0039851 Ga0496124_0039851_2997_3458 151
351 3300048928 Ga0496125_0061470 Ga0496125_0061470_1591_2046 151
352 3300048928 Ga0496125_0123701 Ga0496125_0123701_1115_1576 151
353 3300048929 Ga0496126_0017687 Ga0496126_0017687_4670_5131 151
354 3300048929 Ga0496126_0030151 Ga0496126_0030151_2781_3236 151
355 3300048929 Ga0496126_0296543 Ga0496126_0296543_355_822 151
356 3300049569 Ga0501032_0047599 Ga0501032_0047599_1675_2130 151
357 3300049570 Ga0501033_0098922 Ga0501033_0098922_1594_2049 151
358 3300049571 Ga0501034_0054844 Ga0501034_0054844_332_787 151
359 3300049571 Ga0501034_0081252 Ga0501034_0081252_2595_3086 151
360 3300049573 Ga0501037_0041755 Ga0501037_0041755_2546_3037 151
361 3300049579 Ga0501043_0011533 Ga0501043_0011533_1738_2229 151
362 3300049580 Ga0501046_0000931 Ga0501046_0000931_26928_27419 151
363 3300049580 Ga0501046_0400799 Ga0501046_0400799_438_893 151
364 3300049581 Ga0501047_0010353 Ga0501047_0010353_3106_3597 151
365 3300049581 Ga0501047_0026162 Ga0501047_0026162_94_549 151
366 3300049581 Ga0501047_0291616 Ga0501047_0291616_44_511 151
367 3300049582 Ga0501048_0096411 Ga0501048_0096411_840_1331 151
368 3300049586 Ga0501070_0069839 Ga0501070_0069839_86_577 151
369 3300049589 Ga0501073_0302999 Ga0501073_0302999_579_1070 151
370 3300049589 Ga0501073_0428047 Ga0501073_0428047_419_874 151
371 3300049822 Ga0501035_0004777 Ga0501035_0004777_11655_12110 151
372 3300049822 Ga0501035_0012371 Ga0501035_0012371_995_1486 151
373 3300049823 Ga0501044_0002883 Ga0501044_0002883_1307_1798 151
374 3300049823 Ga0501044_0014776 Ga0501044_0014776_7865_8320 151
375 3300050489 nmdc:mga03683_225967_c1 nmdc:mga03683_225967_c1_33_500 151
376 3300050489 nmdc:mga03683_80165_c1 nmdc:mga03683_80165_c1_562_1017 151
377 3300050490 nmdc:mga03n38_224936_c1 nmdc:mga03n38_224936_c1_498_962 151
378 3300050490 nmdc:mga03n38_325_c1 nmdc:mga03n38_325_c1_273_737 151
379 3300050491 nmdc:mga00v17_43763_c1 nmdc:mga00v17_43763_c1_2008_2472 151
380 3300050491 nmdc:mga00v17_633286_c1 nmdc:mga00v17_633286_c1_222_677 151
381 3300050492 nmdc:mga0yw44_204144_c1 nmdc:mga0yw44_204144_c1_63_572 151
382 3300050492 nmdc:mga0yw44_749_c1 nmdc:mga0yw44_749_c1_2592_3059 151
383 3300050494 nmdc:mga06z11_407812_c1 nmdc:mga06z11_407812_c1_158_616 151
384 3300050496 nmdc:mga07m45_22450_c1 nmdc:mga07m45_22450_c1_2199_2657 151
385 3300050496 nmdc:mga07m45_44360_c1 nmdc:mga07m45_44360_c1_1055_1519 151
386 3300050507 nmdc:mga05p37_295202_c1 nmdc:mga05p37_295202_c1_1054_1515 151
387 3300050509 nmdc:mga0qj67_7274_c1 nmdc:mga0qj67_7274_c1_6381_6842 151
388 3300050510 nmdc:mga06r32_17566_c1 nmdc:mga06r32_17566_c1_2203_2664 151
389 3300050516 nmdc:mga0sz30_69992_c1 nmdc:mga0sz30_69992_c1_321_776 151
390 3300053086 Ga0500578_0604756 Ga0500578_0604756_87_557 151
391 3300053137 Ga0500561_0203846 Ga0500561_0203846_143_598 151
392 3300053139 Ga0500568_0065985 Ga0500568_0065985_825_1280 151
393 3300053730 Ga0500645_000029 Ga0500645_000029_17219_17674 151
394 3300061719 Ga0466962_0209716 Ga0466962_0209716_241_696 151

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02560

Cyanate_lyase

Cyanate lyase C-terminal domain

99

167

0.98

PF21291

CYNS_N

Cyanate hydratase, N-terminal

24

92

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jxc-assembly1.cif.gz_L crystal structure of the p22 c2 repressor protein in complex with synthetic operator 9t in the presence of tl+ 0.8203 6 64
2lyk-assembly1.cif.gz_B noe-based 3d structure of the cylr2 homodimer at 270k (-3 celsius degrees) 0.8139 10 64
2xi8-assembly1.cif.gz_A high resolution structure of native cylr2 0.8134 12 62
7o81-assembly1.cif.gz_AU rabbit 80s ribosome colliding in another ribosome stalled by the sars-cov-2 pseudoknot 0.8122 1 61
2xj3-assembly1.cif.gz_A high resolution structure of the t55c mutant of cylr2. 0.8083 12 62
ID Description Score Start End Superfamily
2ivbG02 Alpha Beta;2-Layer Sandwich;Cyanate Lyase; Chain: A, domain 2;Cyanate lyase, C-terminal domain 0.9613 81 144 3.30.1160.10
4y42I01 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9 3 77 1.10.260.40
2ivbG02 Alpha Beta;2-Layer Sandwich;Cyanate Lyase; Chain: A, domain 2;Cyanate lyase, C-terminal domain 0.8937 81 144 3.30.1160.10
2iu7A01 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8784 3 80 1.10.260.40
2r1jL00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8227 6 64 1.10.260.40
ID Description Score Start End GO Terms
AF-W5WE99-F1-model_v4 Cyanate lyase C-terminal domain-containing protein 0.99 87 146 GO:0008824
GO:0009439
AF-A0A521R818-F1-model_v4 Cyanase 0.9834 87 144 GO:0008824
GO:0009439
AF-W2E682-F1-model_v4 deleted 0.982 79 144
AF-B7DPZ3-F1-model_v4 deleted 0.9817 79 144
AF-A0A6J4R198-F1-model_v4 Cyanate hydratase (EC 4.2.1.104) 0.976 81 146 GO:0008824
GO:0009439

Feature Viewer

pLDDT pTM Quality
91.39 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map