F432968
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 394 | 244 | 389 | 152 |
Family's Representative Sequence
| Representative Sequence | 3300039453|Ga0436362_0743795|Ga0436362_0743795_159_677 |
| Length | 172 |
| Sequence | MLLRKALTAGRIRSRTGILVAMTRNEITEQIVAARLAKGLTWQELADAIGRPVVWTTSALLGQHPIPAELGKVLVEMLGLDESAVAVLAAPPMRGGLPTAVPTDPTVYRFYEALQVYGGAIKELIHEKFGDGIMSAINFSVDLQKKPHPSGDRVVVTFDGKFLPYEWTSAEG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 2 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 3 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 4 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 5 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 6 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 7 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 8 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 9 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 10 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 11 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 12 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 62 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 64 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 65 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 66 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 70 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 71 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 72 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 73 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 74 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 75 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 76 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 77 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 78 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 80 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 92 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 105 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 106 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 153 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 154 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 155 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 156 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 157 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 158 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 159 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 160 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 161 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 162 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 163 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 164 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 165 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 166 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 167 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 168 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 169 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 170 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 171 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 172 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 173 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 174 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 175 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 176 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 177 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 178 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 179 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 180 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 181 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 182 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 183 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 184 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 185 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 193 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 194 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 195 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 196 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 197 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 198 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 199 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 200 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 201 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 202 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 203 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 204 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 205 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 206 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 207 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 208 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 209 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 210 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 211 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 212 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 213 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 214 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 216 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 228 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 229 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 230 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 231 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 232 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 233 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 237 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 238 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 239 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 240 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 241 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 242 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 243 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 244 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.73 |
| Metatranscriptomes | 0 |
| Isolates | 1.27 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.18 |
| Nodule | 0 |
| Rhizoplane | 6.85 |
| Rhizosphere | 69.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24747J21853_1014346 | 3300001978 | Bacteria | 824 |
| 2 | JGI24739J22299_10112802 | 3300001989 | Bacteria | 815 |
| 3 | JGI24748J21848_1009286 | 3300002074 | Bacteria | 1159 |
| 4 | JGI24738J21930_10032516 | 3300002075 | Bacteria | 1064 |
| 5 | JGI24744J21845_10012538 | 3300002077 | Bacteria | 1718 |
| 6 | JGI24034J26672_10045329 | 3300002239 | Bacteria | 746 |
| 7 | JGI24742J22300_10002954 | 3300002244 | Bacteria | 2744 |
| 8 | Ga0055540_1003502 | 3300003792 | Bacteria | 7562 |
| 9 | Ga0055540_1004290 | 3300003792 | Bacteria | 6509 |
| 10 | Ga0055540_1005963 | 3300003792 | Bacteria | 4953 |
| 11 | Ga0070676_10019371 | 3300005328 | Bacteria | 3785 |
| 12 | Ga0070683_100167483 | 3300005329 | Bacteria | 2085 |
| 13 | Ga0070690_100008679 | 3300005330 | Bacteria | 5863 |
| 14 | Ga0070670_100811938 | 3300005331 | Bacteria | 845 |
| 15 | Ga0068869_100091484 | 3300005334 | Bacteria | 2288 |
| 16 | Ga0070666_10163571 | 3300005335 | Bacteria | 1556 |
| 17 | Ga0070682_100004774 | 3300005337 | Bacteria | 7534 |
| 18 | Ga0070682_100019825 | 3300005337 | Bacteria | 3949 |
| 19 | Ga0068868_100061940 | 3300005338 | Bacteria | 2964 |
| 20 | Ga0070689_100120476 | 3300005340 | Bacteria | 2095 |
| 21 | Ga0070691_10013921 | 3300005341 | Bacteria | 3691 |
| 22 | Ga0070687_100041783 | 3300005343 | Bacteria | 2319 |
| 23 | Ga0070668_100013463 | 3300005347 | Bacteria | 6105 |
| 24 | Ga0070668_100073309 | 3300005347 | Bacteria | 2669 |
| 25 | Ga0070669_100022453 | 3300005353 | Bacteria | 4511 |
| 26 | Ga0070669_100071507 | 3300005353 | Bacteria | 2567 |
| 27 | Ga0070669_100076387 | 3300005353 | Bacteria | 2486 |
| 28 | Ga0070671_100238655 | 3300005355 | Bacteria | 1543 |
| 29 | Ga0070674_100015986 | 3300005356 | Bacteria | 4697 |
| 30 | Ga0070673_101307333 | 3300005364 | Bacteria | 681 |
| 31 | Ga0070688_100006857 | 3300005365 | Bacteria | 6113 |
| 32 | Ga0070688_100738082 | 3300005365 | Bacteria | 765 |
| 33 | Ga0070667_100000077 | 3300005367 | Bacteria | 120245 |
| 34 | Ga0070667_100008439 | 3300005367 | Bacteria | 8543 |
| 35 | Ga0070667_100600356 | 3300005367 | Bacteria | 1014 |
| 36 | Ga0070709_10088221 | 3300005434 | Bacteria | 2040 |
| 37 | Ga0070709_10113446 | 3300005434 | Bacteria | 1825 |
| 38 | Ga0070714_100007619 | 3300005435 | Bacteria | 8429 |
| 39 | Ga0070714_100077209 | 3300005435 | Bacteria | 2893 |
| 40 | Ga0070714_100290353 | 3300005435 | Bacteria | 1522 |
| 41 | Ga0070714_100623438 | 3300005435 | Bacteria | 1037 |
| 42 | Ga0070714_100751438 | 3300005435 | Bacteria | 943 |
| 43 | Ga0070713_100034905 | 3300005436 | Bacteria | 4046 |
| 44 | Ga0070713_100514092 | 3300005436 | Bacteria | 1131 |
| 45 | Ga0070710_10002676 | 3300005437 | Bacteria | 8464 |
| 46 | Ga0070710_10017247 | 3300005437 | Bacteria | 3691 |
| 47 | Ga0070701_10000850 | 3300005438 | Bacteria | 10958 |
| 48 | Ga0070711_100002858 | 3300005439 | Bacteria | 9937 |
| 49 | Ga0070705_100058606 | 3300005440 | Bacteria | 2276 |
| 50 | Ga0070694_100099464 | 3300005444 | Bacteria | 2055 |
| 51 | Ga0070663_100010753 | 3300005455 | Bacteria | 5715 |
| 52 | Ga0070678_100000412 | 3300005456 | Bacteria | 20194 |
| 53 | Ga0070681_10349473 | 3300005458 | Bacteria | 1389 |
| 54 | Ga0068867_100001731 | 3300005459 | Bacteria | 15202 |
| 55 | Ga0070706_101406714 | 3300005467 | Bacteria | 638 |
| 56 | Ga0068853_100011274 | 3300005539 | Bacteria | 7255 |
| 57 | Ga0068853_100043985 | 3300005539 | Bacteria | 3821 |
| 58 | Ga0070672_100131546 | 3300005543 | Bacteria | 2057 |
| 59 | Ga0070695_100003142 | 3300005545 | Bacteria | 9628 |
| 60 | Ga0070696_100017739 | 3300005546 | Bacteria | 4806 |
| 61 | Ga0070665_100048445 | 3300005548 | Bacteria | 4266 |
| 62 | Ga0070665_100153382 | 3300005548 | Bacteria | 2306 |
| 63 | Ga0070665_101165632 | 3300005548 | Bacteria | 782 |
| 64 | Ga0070704_100000886 | 3300005549 | Bacteria | 14990 |
| 65 | Ga0068855_101319680 | 3300005563 | Bacteria | 746 |
| 66 | Ga0068854_100027615 | 3300005578 | Bacteria | 3914 |
| 67 | Ga0068856_100829041 | 3300005614 | Bacteria | 944 |
| 68 | Ga0070702_100000595 | 3300005615 | Bacteria | 13246 |
| 69 | Ga0070702_101080378 | 3300005615 | Bacteria | 640 |
| 70 | Ga0068859_100004531 | 3300005617 | Bacteria | 14169 |
| 71 | Ga0068859_100050887 | 3300005617 | Bacteria | 4162 |
| 72 | Ga0068866_10000844 | 3300005718 | Bacteria | 13608 |
| 73 | Ga0068866_11037167 | 3300005718 | Bacteria | 584 |
| 74 | Ga0068861_100010806 | 3300005719 | Bacteria | 6346 |
| 75 | Ga0068861_100028159 | 3300005719 | Bacteria | 4099 |
| 76 | Ga0068861_100323759 | 3300005719 | Bacteria | 1343 |
| 77 | Ga0068863_100082447 | 3300005841 | Bacteria | 3048 |
| 78 | Ga0068863_100275285 | 3300005841 | Bacteria | 1630 |
| 79 | Ga0068858_100004987 | 3300005842 | Bacteria | 13007 |
| 80 | Ga0068858_100032180 | 3300005842 | Bacteria | 4872 |
| 81 | Ga0068860_100000010 | 3300005843 | Bacteria | 359114 |
| 82 | Ga0068860_100070968 | 3300005843 | Bacteria | 3311 |
| 83 | Ga0068860_100077247 | 3300005843 | Bacteria | 3166 |
| 84 | Ga0068862_100000008 | 3300005844 | Bacteria | 305510 |
| 85 | Ga0068862_100002812 | 3300005844 | Bacteria | 15253 |
| 86 | Ga0081455_10022620 | 3300005937 | Bacteria | 5871 |
| 87 | Ga0081455_10067238 | 3300005937 | Bacteria | 2987 |
| 88 | Ga0070717_10250405 | 3300006028 | Bacteria | 1565 |
| 89 | Ga0075365_10001874 | 3300006038 | Bacteria | 9897 |
| 90 | Ga0075365_10305382 | 3300006038 | Bacteria | 1120 |
| 91 | Ga0075363_100067434 | 3300006048 | Bacteria | 1939 |
| 92 | Ga0075363_100385080 | 3300006048 | Bacteria | 823 |
| 93 | Ga0075364_10008520 | 3300006051 | Bacteria | 6134 |
| 94 | Ga0075364_10105974 | 3300006051 | Bacteria | 1873 |
| 95 | Ga0075364_10643930 | 3300006051 | Bacteria | 724 |
| 96 | Ga0070715_10089538 | 3300006163 | Bacteria | 1413 |
| 97 | Ga0070716_100053220 | 3300006173 | Bacteria | 2307 |
| 98 | Ga0070716_100089706 | 3300006173 | Bacteria | 1858 |
| 99 | Ga0070712_100023243 | 3300006175 | Bacteria | 4093 |
| 100 | Ga0075362_10057549 | 3300006177 | Bacteria | 1752 |
| 101 | Ga0075367_10082094 | 3300006178 | Bacteria | 1951 |
| 102 | Ga0075369_10021548 | 3300006186 | Bacteria | 2649 |
| 103 | Ga0075369_10117961 | 3300006186 | Bacteria | 1200 |
| 104 | Ga0075369_10270302 | 3300006186 | Bacteria | 791 |
| 105 | Ga0075370_10021576 | 3300006353 | Bacteria | 3529 |
| 106 | Ga0075370_10046370 | 3300006353 | Bacteria | 2459 |
| 107 | Ga0068871_100036382 | 3300006358 | Bacteria | 3920 |
| 108 | Ga0075428_100022285 | 3300006844 | Bacteria | 7013 |
| 109 | Ga0075430_100021962 | 3300006846 | Bacteria | 5424 |
| 110 | Ga0075431_100090538 | 3300006847 | Bacteria | 3158 |
| 111 | Ga0068865_100031079 | 3300006881 | Bacteria | 3557 |
| 112 | Ga0097620_100004531 | 3300006931 | Bacteria | 14169 |
| 113 | Ga0097620_100050889 | 3300006931 | Bacteria | 4162 |
| 114 | Ga0099795_10006404 | 3300007788 | Bacteria | 3211 |
| 115 | Ga0105240_11038483 | 3300009093 | Bacteria | 875 |
| 116 | Ga0105245_10001126 | 3300009098 | Bacteria | 24176 |
| 117 | Ga0105247_10000019 | 3300009101 | Bacteria | 245170 |
| 118 | Ga0105247_10001096 | 3300009101 | Bacteria | 20202 |
| 119 | Ga0114129_10060401 | 3300009147 | Bacteria | 5300 |
| 120 | Ga0105243_10003000 | 3300009148 | Bacteria | 13943 |
| 121 | Ga0105241_10042542 | 3300009174 | Bacteria | 3438 |
| 122 | Ga0105242_10028064 | 3300009176 | Bacteria | 4478 |
| 123 | Ga0105248_10000093 | 3300009177 | Bacteria | 98669 |
| 124 | Ga0105248_10034054 | 3300009177 | Bacteria | 5694 |
| 125 | Ga0105237_10017582 | 3300009545 | Bacteria | 7411 |
| 126 | Ga0105237_10107129 | 3300009545 | Bacteria | 2787 |
| 127 | Ga0105238_10259847 | 3300009551 | Bacteria | 1716 |
| 128 | Ga0105238_11084351 | 3300009551 | Bacteria | 823 |
| 129 | Ga0105249_10000019 | 3300009553 | Bacteria | 273807 |
| 130 | Ga0105249_10003476 | 3300009553 | Bacteria | 13648 |
| 131 | Ga0105249_10112252 | 3300009553 | Bacteria | 2578 |
| 132 | Ga0105249_11187868 | 3300009553 | Unclassified | 834 |
| 133 | Ga0099796_10024375 | 3300010159 | Bacteria | 1899 |
| 134 | Ga0105239_10010336 | 3300010375 | Bacteria | 10451 |
| 135 | Ga0105239_10059762 | 3300010375 | Bacteria | 4183 |
| 136 | Ga0105239_10451311 | 3300010375 | Bacteria | 1459 |
| 137 | Ga0157369_10129213 | 3300013105 | Bacteria | 2678 |
| 138 | Ga0157374_10206312 | 3300013296 | Bacteria | 1926 |
| 139 | Ga0157378_10003396 | 3300013297 | Bacteria | 14157 |
| 140 | Ga0163162_10003935 | 3300013306 | Bacteria | 14252 |
| 141 | Ga0163162_10170010 | 3300013306 | Bacteria | 2304 |
| 142 | Ga0163162_10223055 | 3300013306 | Bacteria | 2015 |
| 143 | Ga0163162_11382008 | 3300013306 | Bacteria | 801 |
| 144 | Ga0157372_10046403 | 3300013307 | Bacteria | 4823 |
| 145 | Ga0157375_10000791 | 3300013308 | Bacteria | 27674 |
| 146 | Ga0157380_10002198 | 3300014326 | Bacteria | 13105 |
| 147 | Ga0157377_10443787 | 3300014745 | Bacteria | 894 |
| 148 | Ga0157379_10137175 | 3300014968 | Bacteria | 2204 |
| 149 | Ga0157379_11063244 | 3300014968 | Bacteria | 774 |
| 150 | Ga0157376_11382626 | 3300014969 | Bacteria | 735 |
| 151 | Ga0163161_10001275 | 3300017792 | Bacteria | 18812 |
| 152 | Ga0163161_10060292 | 3300017792 | Bacteria | 2761 |
| 153 | Ga0213876_10082904 | 3300021384 | Bacteria | 1696 |
| 154 | Ga0209673_1015197 | 3300025273 | Bacteria | 2939 |
| 155 | Ga0209025_1147646 | 3300025294 | Bacteria | 655 |
| 156 | Ga0209051_1000567 | 3300025303 | Bacteria | 44848 |
| 157 | Ga0209051_1005315 | 3300025303 | Bacteria | 7578 |
| 158 | Ga0209051_1011882 | 3300025303 | Bacteria | 4258 |
| 159 | Ga0209051_1017671 | 3300025303 | Bacteria | 3181 |
| 160 | Ga0209051_1027308 | 3300025303 | Bacteria | 2277 |
| 161 | Ga0209051_1066508 | 3300025303 | Bacteria | 1107 |
| 162 | Ga0207682_10223481 | 3300025893 | Bacteria | 871 |
| 163 | Ga0207692_10372047 | 3300025898 | Bacteria | 885 |
| 164 | Ga0207642_10027308 | 3300025899 | Bacteria | 2335 |
| 165 | Ga0207642_10845484 | 3300025899 | Bacteria | 584 |
| 166 | Ga0207710_10000036 | 3300025900 | Bacteria | 245176 |
| 167 | Ga0207688_10002386 | 3300025901 | Bacteria | 10111 |
| 168 | Ga0207680_10184090 | 3300025903 | Bacteria | 1414 |
| 169 | Ga0207699_10092721 | 3300025906 | Bacteria | 1899 |
| 170 | Ga0207699_10468943 | 3300025906 | Bacteria | 905 |
| 171 | Ga0207645_10025691 | 3300025907 | Bacteria | 3810 |
| 172 | Ga0207671_10090568 | 3300025914 | Bacteria | 2304 |
| 173 | Ga0207671_10271527 | 3300025914 | Bacteria | 1336 |
| 174 | Ga0207693_10014735 | 3300025915 | Bacteria | 6281 |
| 175 | Ga0207663_10073785 | 3300025916 | Bacteria | 2209 |
| 176 | Ga0207662_10053621 | 3300025918 | Bacteria | 2403 |
| 177 | Ga0207657_10468621 | 3300025919 | Bacteria | 988 |
| 178 | Ga0207681_10003529 | 3300025923 | Bacteria | 9741 |
| 179 | Ga0207681_10072036 | 3300025923 | Bacteria | 2412 |
| 180 | Ga0207694_10256787 | 3300025924 | Bacteria | 1431 |
| 181 | Ga0207687_10041289 | 3300025927 | Bacteria | 3167 |
| 182 | Ga0207700_11504258 | 3300025928 | Bacteria | 597 |
| 183 | Ga0207664_10024807 | 3300025929 | Bacteria | 4509 |
| 184 | Ga0207664_10568103 | 3300025929 | Bacteria | 1018 |
| 185 | Ga0207664_11948040 | 3300025929 | Bacteria | 510 |
| 186 | Ga0207644_10112384 | 3300025931 | Bacteria | 2062 |
| 187 | Ga0207706_10012282 | 3300025933 | Bacteria | 7804 |
| 188 | Ga0207709_10023635 | 3300025935 | Bacteria | 3500 |
| 189 | Ga0207670_10021742 | 3300025936 | Bacteria | 3963 |
| 190 | Ga0207669_10063304 | 3300025937 | Bacteria | 2282 |
| 191 | Ga0207669_10152606 | 3300025937 | Bacteria | 1620 |
| 192 | Ga0207704_10080498 | 3300025938 | Bacteria | 2103 |
| 193 | Ga0207704_10408896 | 3300025938 | Bacteria | 1073 |
| 194 | Ga0207665_10063833 | 3300025939 | Bacteria | 2502 |
| 195 | Ga0207711_10000102 | 3300025941 | Bacteria | 90198 |
| 196 | Ga0207711_10077966 | 3300025941 | Bacteria | 2889 |
| 197 | Ga0207661_10208955 | 3300025944 | Bacteria | 1719 |
| 198 | Ga0207667_10103905 | 3300025949 | Bacteria | 2930 |
| 199 | Ga0207712_10000025 | 3300025961 | Bacteria | 274015 |
| 200 | Ga0207712_10049716 | 3300025961 | Bacteria | 2924 |
| 201 | Ga0207712_10094892 | 3300025961 | Bacteria | 2205 |
| 202 | Ga0207668_10198268 | 3300025972 | Bacteria | 1596 |
| 203 | Ga0207668_11743048 | 3300025972 | Bacteria | 562 |
| 204 | Ga0207640_10448790 | 3300025981 | Bacteria | 1062 |
| 205 | Ga0207658_10002129 | 3300025986 | Bacteria | 14711 |
| 206 | Ga0207677_10298810 | 3300026023 | Bacteria | 1329 |
| 207 | Ga0207703_10010287 | 3300026035 | Bacteria | 7327 |
| 208 | Ga0207703_10039022 | 3300026035 | Bacteria | 3793 |
| 209 | Ga0207639_10002104 | 3300026041 | Bacteria | 13403 |
| 210 | Ga0207639_10095690 | 3300026041 | Bacteria | 2387 |
| 211 | Ga0207678_10004434 | 3300026067 | Bacteria | 12626 |
| 212 | Ga0207678_10091103 | 3300026067 | Bacteria | 2606 |
| 213 | Ga0207678_10148403 | 3300026067 | Bacteria | 2002 |
| 214 | Ga0207702_10514098 | 3300026078 | Bacteria | 1168 |
| 215 | Ga0207641_10043104 | 3300026088 | Bacteria | 3787 |
| 216 | Ga0207641_10349490 | 3300026088 | Bacteria | 1409 |
| 217 | Ga0207648_10006698 | 3300026089 | Bacteria | 11426 |
| 218 | Ga0207675_100008102 | 3300026118 | Bacteria | 9900 |
| 219 | Ga0207675_100383556 | 3300026118 | Bacteria | 1382 |
| 220 | Ga0207683_10002027 | 3300026121 | Bacteria | 17914 |
| 221 | Ga0268266_10009177 | 3300028379 | Bacteria | 8728 |
| 222 | Ga0268266_10169665 | 3300028379 | Bacteria | 1980 |
| 223 | Ga0268266_11301315 | 3300028379 | Bacteria | 702 |
| 224 | Ga0268265_10000007 | 3300028380 | Bacteria | 431817 |
| 225 | Ga0268265_10286972 | 3300028380 | Bacteria | 1475 |
| 226 | Ga0268264_10000007 | 3300028381 | Bacteria | 815790 |
| 227 | Ga0268264_10052664 | 3300028381 | Bacteria | 3394 |
| 228 | Ga0268264_10097312 | 3300028381 | Bacteria | 2551 |
| 229 | Ga0307405_11077222 | 3300031731 | Bacteria | 690 |
| 230 | Ga0307413_10411238 | 3300031824 | Bacteria | 1063 |
| 231 | Ga0307410_10127683 | 3300031852 | Bacteria | 1864 |
| 232 | Ga0307406_10642238 | 3300031901 | Bacteria | 880 |
| 233 | Ga0307407_10348465 | 3300031903 | Bacteria | 1048 |
| 234 | Ga0307412_10333983 | 3300031911 | Bacteria | 1211 |
| 235 | Ga0307409_101697620 | 3300031995 | Bacteria | 660 |
| 236 | Ga0307416_102394196 | 3300032002 | Bacteria | 628 |
| 237 | Ga0307415_100560129 | 3300032126 | Bacteria | 1010 |
| 238 | Ga0373941_0087690 | 3300035115 | Bacteria | 1062 |
| 239 | Ga0373931_0202566 | 3300035691 | Bacteria | 1186 |
| 240 | Ga0436364_0426817 | 3300037853 | Bacteria | 52455 |
| 241 | Ga0436365_0011552 | 3300039437 | Bacteria | 5282 |
| 242 | Ga0436365_0374763 | 3300039437 | Bacteria | 625 |
| 243 | Ga0436365_0712680 | 3300039437 | Bacteria | 47182 |
| 244 | Ga0436365_0983079 | 3300039437 | Bacteria | 6284 |
| 245 | Ga0436363_0807283 | 3300039450 | Bacteria | 2976 |
| 246 | Ga0436363_0903752 | 3300039450 | Bacteria | 1558 |
| 247 | Ga0436363_1310981 | 3300039450 | Bacteria | 629 |
| 248 | Ga0436362_0743795 | 3300039453 | Bacteria | 775 |
| 249 | Ga0451789_0711331 | 3300041443 | Bacteria | 642 |
| 250 | Ga0451795_0920400 | 3300041456 | Bacteria | 852 |
| 251 | Ga0451807_1229015 | 3300041486 | Bacteria | 1531 |
| 252 | Ga0451833_0130817 | 3300041491 | Bacteria | 679 |
| 253 | Ga0451833_1000054 | 3300041491 | Bacteria | 1035 |
| 254 | Ga0451839_1092324 | 3300041496 | Bacteria | 1288 |
| 255 | Ga0466965_0020099 | 3300044683 | Bacteria | 3208 |
| 256 | Ga0466965_0038928 | 3300044683 | Bacteria | 2336 |
| 257 | Ga0466966_0003951 | 3300044684 | Bacteria | 9796 |
| 258 | Ga0466966_0008791 | 3300044684 | Bacteria | 6687 |
| 259 | Ga0466961_0130462 | 3300044693 | Bacteria | 1575 |
| 260 | Ga0466963_0046933 | 3300044694 | Bacteria | 2850 |
| 261 | Ga0466963_0101019 | 3300044694 | Bacteria | 1974 |
| 262 | Ga0466963_0140228 | 3300044694 | Bacteria | 1674 |
| 263 | Ga0466964_0765803 | 3300044706 | Bacteria | 543 |
| 264 | Ga0466971_0080566 | 3300044719 | Bacteria | 1484 |
| 265 | Ga0466968_0001218 | 3300044735 | Bacteria | 9111 |
| 266 | Ga0466968_0084637 | 3300044735 | Bacteria | 1398 |
| 267 | Ga0466970_0028417 | 3300044765 | Bacteria | 2938 |
| 268 | Ga0466957_0004344 | 3300044842 | Bacteria | 7876 |
| 269 | Ga0466957_0046792 | 3300044842 | Bacteria | 2628 |
| 270 | Ga0466957_0061774 | 3300044842 | Bacteria | 2300 |
| 271 | Ga0466960_0001582 | 3300044901 | Bacteria | 8323 |
| 272 | Ga0466960_0009906 | 3300044901 | Bacteria | 3942 |
| 273 | Ga0466960_0551457 | 3300044901 | Bacteria | 680 |
| 274 | Ga0466959_0246613 | 3300045049 | Bacteria | 1232 |
| 275 | Ga0466958_0087251 | 3300045836 | Bacteria | 1926 |
| 276 | Ga0466958_0135902 | 3300045836 | Bacteria | 1546 |
| 277 | Ga0466967_0040552 | 3300045976 | Bacteria | 4009 |
| 278 | Ga0466967_0134266 | 3300045976 | Bacteria | 2300 |
| 279 | Ga0466967_0149894 | 3300045976 | Bacteria | 2179 |
| 280 | Ga0466967_0172023 | 3300045976 | Bacteria | 2038 |
| 281 | Ga0495583_0094644 | 3300046506 | Bacteria | 1282 |
| 282 | Ga0495606_0025317 | 3300046507 | Bacteria | 4253 |
| 283 | Ga0495648_0083570 | 3300046524 | Bacteria | 1808 |
| 284 | Ga0495625_0344751 | 3300046660 | Bacteria | 943 |
| 285 | Ga0495672_0000770 | 3300047320 | Bacteria | 34865 |
| 286 | Ga0495673_0009985 | 3300047469 | Bacteria | 5200 |
| 287 | Ga0495686_0325791 | 3300047472 | Bacteria | 841 |
| 288 | Ga0495686_0345117 | 3300047472 | Bacteria | 811 |
| 289 | Ga0496100_0006270 | 3300048903 | Bacteria | 6476 |
| 290 | Ga0496100_0014024 | 3300048903 | Bacteria | 4643 |
| 291 | Ga0496100_0062617 | 3300048903 | Bacteria | 2455 |
| 292 | Ga0496100_0121033 | 3300048903 | Bacteria | 1831 |
| 293 | Ga0496101_0000014 | 3300048904 | Bacteria | 253487 |
| 294 | Ga0496101_0006865 | 3300048904 | Bacteria | 7348 |
| 295 | Ga0496101_0019055 | 3300048904 | Bacteria | 4676 |
| 296 | Ga0496101_0067404 | 3300048904 | Bacteria | 2613 |
| 297 | Ga0496102_0000012 | 3300048905 | Bacteria | 315470 |
| 298 | Ga0496102_0000112 | 3300048905 | Bacteria | 116902 |
| 299 | Ga0496102_0077924 | 3300048905 | Bacteria | 3051 |
| 300 | Ga0496103_0000005 | 3300048906 | Bacteria | 505416 |
| 301 | Ga0496103_0000625 | 3300048906 | Bacteria | 27110 |
| 302 | Ga0496103_0006151 | 3300048906 | Bacteria | 7174 |
| 303 | Ga0496103_0140884 | 3300048906 | Bacteria | 1542 |
| 304 | Ga0496106_0006710 | 3300048909 | Bacteria | 8527 |
| 305 | Ga0496106_0047817 | 3300048909 | Bacteria | 3220 |
| 306 | Ga0496107_0045728 | 3300048910 | Bacteria | 3149 |
| 307 | Ga0496108_1173421 | 3300048911 | Bacteria | 650 |
| 308 | Ga0496112_0237525 | 3300048915 | Bacteria | 1776 |
| 309 | Ga0496113_0003095 | 3300048916 | Bacteria | 9879 |
| 310 | Ga0496114_0019494 | 3300048917 | Bacteria | 5495 |
| 311 | Ga0496114_1372238 | 3300048917 | Bacteria | 594 |
| 312 | Ga0496115_0083075 | 3300048918 | Bacteria | 2610 |
| 313 | Ga0496116_0000050 | 3300048919 | Bacteria | 311670 |
| 314 | Ga0496116_0024878 | 3300048919 | Bacteria | 4415 |
| 315 | Ga0496117_0000042 | 3300048920 | Bacteria | 315470 |
| 316 | Ga0496117_0000719 | 3300048920 | Bacteria | 52226 |
| 317 | Ga0496117_0010961 | 3300048920 | Bacteria | 8168 |
| 318 | Ga0496118_0000037 | 3300048921 | Bacteria | 315470 |
| 319 | Ga0496118_0000452 | 3300048921 | Bacteria | 67982 |
| 320 | Ga0496118_0003415 | 3300048921 | Bacteria | 20065 |
| 321 | Ga0496118_0059218 | 3300048921 | Bacteria | 2854 |
| 322 | Ga0496119_0008326 | 3300048922 | Bacteria | 9138 |
| 323 | Ga0496119_0016038 | 3300048922 | Bacteria | 5725 |
| 324 | Ga0496119_0016055 | 3300048922 | Bacteria | 5721 |
| 325 | Ga0496120_0007573 | 3300048923 | Bacteria | 8055 |
| 326 | Ga0496120_0132788 | 3300048923 | Bacteria | 1273 |
| 327 | Ga0496121_0000250 | 3300048924 | Bacteria | 114145 |
| 328 | Ga0496121_0025722 | 3300048924 | Bacteria | 5574 |
| 329 | Ga0496122_0051427 | 3300048925 | Bacteria | 3130 |
| 330 | Ga0496123_0057606 | 3300048926 | Bacteria | 2527 |
| 331 | Ga0496124_0039851 | 3300048927 | Bacteria | 4067 |
| 332 | Ga0496124_0562522 | 3300048927 | Bacteria | 750 |
| 333 | Ga0496125_0061470 | 3300048928 | Bacteria | 3012 |
| 334 | Ga0496125_0123701 | 3300048928 | Bacteria | 1838 |
| 335 | Ga0496126_0005371 | 3300048929 | Bacteria | 14636 |
| 336 | Ga0496126_0017687 | 3300048929 | Bacteria | 7100 |
| 337 | Ga0496126_0019235 | 3300048929 | Bacteria | 6730 |
| 338 | Ga0496126_0030151 | 3300048929 | Bacteria | 5143 |
| 339 | Ga0496126_0121555 | 3300048929 | Bacteria | 2264 |
| 340 | Ga0496126_0296543 | 3300048929 | Bacteria | 1335 |
| 341 | Ga0501032_0047599 | 3300049569 | Bacteria | 2895 |
| 342 | Ga0501033_0098922 | 3300049570 | Bacteria | 2130 |
| 343 | Ga0501034_0054844 | 3300049571 | Bacteria | 4012 |
| 344 | Ga0501034_0081252 | 3300049571 | Bacteria | 3243 |
| 345 | Ga0501037_0041755 | 3300049573 | Bacteria | 3372 |
| 346 | Ga0501043_0011533 | 3300049579 | Bacteria | 6920 |
| 347 | Ga0501046_0000931 | 3300049580 | Bacteria | 28738 |
| 348 | Ga0501046_0400799 | 3300049580 | Bacteria | 991 |
| 349 | Ga0501047_0010353 | 3300049581 | Bacteria | 8822 |
| 350 | Ga0501047_0018956 | 3300049581 | Bacteria | 6599 |
| 351 | Ga0501047_0026162 | 3300049581 | Bacteria | 5613 |
| 352 | Ga0501047_0291616 | 3300049581 | Bacteria | 1475 |
| 353 | Ga0501048_0096411 | 3300049582 | Bacteria | 2086 |
| 354 | Ga0501069_0013269 | 3300049585 | Bacteria | 4390 |
| 355 | Ga0501070_0059723 | 3300049586 | Bacteria | 3161 |
| 356 | Ga0501070_0069839 | 3300049586 | Bacteria | 2908 |
| 357 | Ga0501073_0302999 | 3300049589 | Bacteria | 1102 |
| 358 | Ga0501073_0428047 | 3300049589 | Bacteria | 915 |
| 359 | Ga0501035_0004777 | 3300049822 | Bacteria | 12865 |
| 360 | Ga0501035_0012371 | 3300049822 | Bacteria | 7889 |
| 361 | Ga0501044_0002883 | 3300049823 | Bacteria | 19574 |
| 362 | Ga0501044_0014776 | 3300049823 | Bacteria | 8417 |
| 363 | nmdc:mga03683_225967_c1 | 3300050489 | Bacteria | 864 |
| 364 | nmdc:mga03683_80165_c1 | 3300050489 | Bacteria | 1408 |
| 365 | nmdc:mga03n38_224936_c1 | 3300050490 | Bacteria | 981 |
| 366 | nmdc:mga03n38_325_c1 | 3300050490 | Bacteria | 11543 |
| 367 | nmdc:mga00v17_43763_c1 | 3300050491 | Bacteria | 2698 |
| 368 | nmdc:mga00v17_633286_c1 | 3300050491 | Bacteria | 688 |
| 369 | nmdc:mga0yw44_204144_c1 | 3300050492 | Bacteria | 1306 |
| 370 | nmdc:mga0yw44_331632_c1 | 3300050492 | Bacteria | 1022 |
| 371 | nmdc:mga0yw44_509245_c1 | 3300050492 | Bacteria | 817 |
| 372 | nmdc:mga0yw44_749_c1 | 3300050492 | Bacteria | 4761 |
| 373 | nmdc:mga06z11_407812_c1 | 3300050494 | Bacteria | 818 |
| 374 | nmdc:mga07m45_22450_c1 | 3300050496 | Bacteria | 3445 |
| 375 | nmdc:mga07m45_44360_c1 | 3300050496 | Bacteria | 2495 |
| 376 | nmdc:mga05p37_295202_c1 | 3300050507 | Bacteria | 1928 |
| 377 | nmdc:mga0qj67_7274_c1 | 3300050509 | Bacteria | 8178 |
| 378 | nmdc:mga06r32_17566_c1 | 3300050510 | Bacteria | 6532 |
| 379 | nmdc:mga0sz30_112415_c1 | 3300050516 | Bacteria | 1194 |
| 380 | nmdc:mga0sz30_380852_c1 | 3300050516 | Bacteria | 631 |
| 381 | nmdc:mga0sz30_69992_c1 | 3300050516 | Bacteria | 1509 |
| 382 | Ga0500635_0047605 | 3300053080 | Bacteria | 1458 |
| 383 | Ga0500578_0604756 | 3300053086 | Bacteria | 602 |
| 384 | Ga0500643_002774 | 3300053087 | Bacteria | 8769 |
| 385 | Ga0500652_001168 | 3300053131 | Bacteria | 8385 |
| 386 | Ga0500561_0203846 | 3300053137 | Bacteria | 626 |
| 387 | Ga0500568_0065985 | 3300053139 | Bacteria | 1393 |
| 388 | Ga0500645_000029 | 3300053730 | Bacteria | 122362 |
| 389 | Ga0466962_0209716 | 3300061719 | Bacteria | 953 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048927 | Ga0496124_0562522 | Ga0496124_0562522_344_715 | 123 |
| 2 | iso_pu_bacteria | 2902792274 | 2902796200 | 144 |
| 3 | 3300005337 | Ga0070682_100019825 | Ga0070682_1000198252 | 145 |
| 4 | 3300005539 | Ga0068853_100011274 | Ga0068853_1000112745 | 145 |
| 5 | 3300005718 | Ga0068866_11037167 | Ga0068866_110371672 | 145 |
| 6 | 3300006051 | Ga0075364_10105974 | Ga0075364_101059742 | 145 |
| 7 | 3300009093 | Ga0105240_11038483 | Ga0105240_110384832 | 145 |
| 8 | 3300009545 | Ga0105237_10017582 | Ga0105237_100175823 | 145 |
| 9 | 3300009551 | Ga0105238_10259847 | Ga0105238_102598472 | 145 |
| 10 | 3300009551 | Ga0105238_11084351 | Ga0105238_110843512 | 145 |
| 11 | 3300010375 | Ga0105239_10010336 | Ga0105239_100103367 | 145 |
| 12 | 3300025303 | Ga0209051_1017671 | Ga0209051_10176715 | 145 |
| 13 | 3300025899 | Ga0207642_10845484 | Ga0207642_108454841 | 145 |
| 14 | 3300025914 | Ga0207671_10090568 | Ga0207671_100905683 | 145 |
| 15 | 3300025924 | Ga0207694_10256787 | Ga0207694_102567872 | 145 |
| 16 | 3300026041 | Ga0207639_10002104 | Ga0207639_100021044 | 145 |
| 17 | 3300031824 | Ga0307413_10411238 | Ga0307413_104112381 | 145 |
| 18 | 3300031901 | Ga0307406_10642238 | Ga0307406_106422381 | 145 |
| 19 | 3300031903 | Ga0307407_10348465 | Ga0307407_103484652 | 145 |
| 20 | 3300044683 | Ga0466965_0020099 | Ga0466965_0020099_309_758 | 145 |
| 21 | 3300044901 | Ga0466960_0001582 | Ga0466960_0001582_3427_3876 | 145 |
| 22 | 3300046506 | Ga0495583_0094644 | Ga0495583_0094644_69_515 | 145 |
| 23 | 3300046507 | Ga0495606_0025317 | Ga0495606_0025317_1692_2138 | 145 |
| 24 | 3300046524 | Ga0495648_0083570 | Ga0495648_0083570_505_951 | 145 |
| 25 | 3300046660 | Ga0495625_0344751 | Ga0495625_0344751_187_633 | 145 |
| 26 | 3300047320 | Ga0495672_0000770 | Ga0495672_0000770_8880_9326 | 145 |
| 27 | 3300047469 | Ga0495673_0009985 | Ga0495673_0009985_3987_4433 | 145 |
| 28 | 3300047472 | Ga0495686_0345117 | Ga0495686_0345117_135_587 | 145 |
| 29 | 3300048903 | Ga0496100_0006270 | Ga0496100_0006270_4546_4992 | 145 |
| 30 | 3300048904 | Ga0496101_0000014 | Ga0496101_0000014_4793_5239 | 145 |
| 31 | 3300048905 | Ga0496102_0000012 | Ga0496102_0000012_310203_310649 | 145 |
| 32 | 3300048906 | Ga0496103_0000005 | Ga0496103_0000005_4814_5260 | 145 |
| 33 | 3300048909 | Ga0496106_0006710 | Ga0496106_0006710_4528_4974 | 145 |
| 34 | 3300048917 | Ga0496114_1372238 | Ga0496114_1372238_13_459 | 145 |
| 35 | 3300048919 | Ga0496116_0000050 | Ga0496116_0000050_306424_306870 | 145 |
| 36 | 3300048920 | Ga0496117_0000042 | Ga0496117_0000042_4822_5268 | 145 |
| 37 | 3300048920 | Ga0496117_0010961 | Ga0496117_0010961_6843_7280 | 145 |
| 38 | 3300048921 | Ga0496118_0000037 | Ga0496118_0000037_4822_5268 | 145 |
| 39 | 3300048921 | Ga0496118_0059218 | Ga0496118_0059218_702_1139 | 145 |
| 40 | 3300048922 | Ga0496119_0016038 | Ga0496119_0016038_3206_3643 | 145 |
| 41 | 3300048922 | Ga0496119_0016055 | Ga0496119_0016055_3032_3478 | 145 |
| 42 | 3300048923 | Ga0496120_0007573 | Ga0496120_0007573_4818_5264 | 145 |
| 43 | 3300048924 | Ga0496121_0000250 | Ga0496121_0000250_108879_109325 | 145 |
| 44 | 3300048929 | Ga0496126_0019235 | Ga0496126_0019235_5034_5480 | 145 |
| 45 | 3300048929 | Ga0496126_0121555 | Ga0496126_0121555_1458_1904 | 145 |
| 46 | 3300053080 | Ga0500635_0047605 | Ga0500635_0047605_111_551 | 145 |
| 47 | 3300053087 | Ga0500643_002774 | Ga0500643_002774_5623_6069 | 145 |
| 48 | 3300053131 | Ga0500652_001168 | Ga0500652_001168_44_484 | 145 |
| 49 | iso_pu_bacteria | 2643221687 | 2644487384 | 145 |
| 50 | iso_pu_bacteria | 2939582691 | 2939588716 | 145 |
| 51 | 3300005719 | Ga0068861_100323759 | Ga0068861_1003237591 | 146 |
| 52 | 3300009553 | Ga0105249_11187868 | Ga0105249_111878681 | 146 |
| 53 | 3300013306 | Ga0163162_10003935 | Ga0163162_100039358 | 146 |
| 54 | 3300026118 | Ga0207675_100383556 | Ga0207675_1003835562 | 146 |
| 55 | 3300048903 | Ga0496100_0121033 | Ga0496100_0121033_646_1086 | 146 |
| 56 | 3300048904 | Ga0496101_0006865 | Ga0496101_0006865_5379_5819 | 146 |
| 57 | 3300048916 | Ga0496113_0003095 | Ga0496113_0003095_3597_4037 | 146 |
| 58 | 3300048923 | Ga0496120_0132788 | Ga0496120_0132788_410_850 | 146 |
| 59 | 3300048925 | Ga0496122_0051427 | Ga0496122_0051427_720_1160 | 146 |
| 60 | 3300048926 | Ga0496123_0057606 | Ga0496123_0057606_927_1367 | 146 |
| 61 | 3300048929 | Ga0496126_0005371 | Ga0496126_0005371_3914_4354 | 146 |
| 62 | iso_pu_bacteria | 2643221687 | 2644489235 | 146 |
| 63 | 3300041496 | Ga0451839_1092324 | Ga0451839_1092324_72_518 | 147 |
| 64 | iso_pu_bacteria | 2902837492 | 2902838227 | 147 |
| 65 | 3300003792 | Ga0055540_1004290 | Ga0055540_10042903 | 150 |
| 66 | 3300003792 | Ga0055540_1005963 | Ga0055540_10059633 | 150 |
| 67 | 3300006186 | Ga0075369_10270302 | Ga0075369_102703022 | 150 |
| 68 | 3300025303 | Ga0209051_1005315 | Ga0209051_10053158 | 150 |
| 69 | 3300025303 | Ga0209051_1011882 | Ga0209051_10118822 | 150 |
| 70 | 3300028379 | Ga0268266_11301315 | Ga0268266_113013152 | 150 |
| 71 | 3300041443 | Ga0451789_0711331 | Ga0451789_0711331_136_588 | 150 |
| 72 | 3300041456 | Ga0451795_0920400 | Ga0451795_0920400_384_836 | 150 |
| 73 | 3300041486 | Ga0451807_1229015 | Ga0451807_1229015_657_1109 | 150 |
| 74 | 3300041491 | Ga0451833_1000054 | Ga0451833_1000054_391_843 | 150 |
| 75 | 3300045976 | Ga0466967_0040552 | Ga0466967_0040552_1624_2088 | 150 |
| 76 | 3300049581 | Ga0501047_0018956 | Ga0501047_0018956_3118_3591 | 150 |
| 77 | 3300049585 | Ga0501069_0013269 | Ga0501069_0013269_2691_3164 | 150 |
| 78 | 3300049586 | Ga0501070_0059723 | Ga0501070_0059723_1676_2149 | 150 |
| 79 | 3300050492 | nmdc:mga0yw44_331632_c1 | nmdc:mga0yw44_331632_c1_288_740 | 150 |
| 80 | 3300050492 | nmdc:mga0yw44_509245_c1 | nmdc:mga0yw44_509245_c1_24_476 | 150 |
| 81 | 3300050516 | nmdc:mga0sz30_112415_c1 | nmdc:mga0sz30_112415_c1_398_850 | 150 |
| 82 | 3300050516 | nmdc:mga0sz30_380852_c1 | nmdc:mga0sz30_380852_c1_133_585 | 150 |
| 83 | 3300001978 | JGI24747J21853_1014346 | JGI24747J21853_10143461 | 151 |
| 84 | 3300001989 | JGI24739J22299_10112802 | JGI24739J22299_101128022 | 151 |
| 85 | 3300002074 | JGI24748J21848_1009286 | JGI24748J21848_10092862 | 151 |
| 86 | 3300002075 | JGI24738J21930_10032516 | JGI24738J21930_100325162 | 151 |
| 87 | 3300002077 | JGI24744J21845_10012538 | JGI24744J21845_100125382 | 151 |
| 88 | 3300002239 | JGI24034J26672_10045329 | JGI24034J26672_100453292 | 151 |
| 89 | 3300002244 | JGI24742J22300_10002954 | JGI24742J22300_100029542 | 151 |
| 90 | 3300003792 | Ga0055540_1003502 | Ga0055540_10035026 | 151 |
| 91 | 3300005328 | Ga0070676_10019371 | Ga0070676_100193713 | 151 |
| 92 | 3300005329 | Ga0070683_100167483 | Ga0070683_1001674833 | 151 |
| 93 | 3300005330 | Ga0070690_100008679 | Ga0070690_1000086794 | 151 |
| 94 | 3300005331 | Ga0070670_100811938 | Ga0070670_1008119381 | 151 |
| 95 | 3300005334 | Ga0068869_100091484 | Ga0068869_1000914842 | 151 |
| 96 | 3300005335 | Ga0070666_10163571 | Ga0070666_101635712 | 151 |
| 97 | 3300005337 | Ga0070682_100004774 | Ga0070682_1000047742 | 151 |
| 98 | 3300005338 | Ga0068868_100061940 | Ga0068868_1000619402 | 151 |
| 99 | 3300005340 | Ga0070689_100120476 | Ga0070689_1001204762 | 151 |
| 100 | 3300005341 | Ga0070691_10013921 | Ga0070691_100139215 | 151 |
| 101 | 3300005343 | Ga0070687_100041783 | Ga0070687_1000417834 | 151 |
| 102 | 3300005347 | Ga0070668_100013463 | Ga0070668_1000134636 | 151 |
| 103 | 3300005347 | Ga0070668_100073309 | Ga0070668_1000733092 | 151 |
| 104 | 3300005353 | Ga0070669_100022453 | Ga0070669_1000224534 | 151 |
| 105 | 3300005353 | Ga0070669_100071507 | Ga0070669_1000715074 | 151 |
| 106 | 3300005353 | Ga0070669_100076387 | Ga0070669_1000763872 | 151 |
| 107 | 3300005355 | Ga0070671_100238655 | Ga0070671_1002386552 | 151 |
| 108 | 3300005356 | Ga0070674_100015986 | Ga0070674_1000159864 | 151 |
| 109 | 3300005364 | Ga0070673_101307333 | Ga0070673_1013073331 | 151 |
| 110 | 3300005365 | Ga0070688_100006857 | Ga0070688_1000068576 | 151 |
| 111 | 3300005365 | Ga0070688_100738082 | Ga0070688_1007380821 | 151 |
| 112 | 3300005367 | Ga0070667_100000077 | Ga0070667_10000007782 | 151 |
| 113 | 3300005367 | Ga0070667_100008439 | Ga0070667_1000084393 | 151 |
| 114 | 3300005367 | Ga0070667_100600356 | Ga0070667_1006003561 | 151 |
| 115 | 3300005434 | Ga0070709_10088221 | Ga0070709_100882212 | 151 |
| 116 | 3300005434 | Ga0070709_10113446 | Ga0070709_101134463 | 151 |
| 117 | 3300005435 | Ga0070714_100007619 | Ga0070714_1000076196 | 151 |
| 118 | 3300005435 | Ga0070714_100077209 | Ga0070714_1000772093 | 151 |
| 119 | 3300005435 | Ga0070714_100290353 | Ga0070714_1002903532 | 151 |
| 120 | 3300005435 | Ga0070714_100623438 | Ga0070714_1006234382 | 151 |
| 121 | 3300005435 | Ga0070714_100751438 | Ga0070714_1007514382 | 151 |
| 122 | 3300005436 | Ga0070713_100034905 | Ga0070713_1000349054 | 151 |
| 123 | 3300005436 | Ga0070713_100514092 | Ga0070713_1005140921 | 151 |
| 124 | 3300005437 | Ga0070710_10002676 | Ga0070710_100026766 | 151 |
| 125 | 3300005437 | Ga0070710_10017247 | Ga0070710_100172473 | 151 |
| 126 | 3300005438 | Ga0070701_10000850 | Ga0070701_100008503 | 151 |
| 127 | 3300005439 | Ga0070711_100002858 | Ga0070711_1000028583 | 151 |
| 128 | 3300005440 | Ga0070705_100058606 | Ga0070705_1000586063 | 151 |
| 129 | 3300005444 | Ga0070694_100099464 | Ga0070694_1000994642 | 151 |
| 130 | 3300005455 | Ga0070663_100010753 | Ga0070663_1000107532 | 151 |
| 131 | 3300005456 | Ga0070678_100000412 | Ga0070678_1000004125 | 151 |
| 132 | 3300005458 | Ga0070681_10349473 | Ga0070681_103494732 | 151 |
| 133 | 3300005459 | Ga0068867_100001731 | Ga0068867_1000017318 | 151 |
| 134 | 3300005467 | Ga0070706_101406714 | Ga0070706_1014067141 | 151 |
| 135 | 3300005539 | Ga0068853_100043985 | Ga0068853_1000439852 | 151 |
| 136 | 3300005543 | Ga0070672_100131546 | Ga0070672_1001315461 | 151 |
| 137 | 3300005545 | Ga0070695_100003142 | Ga0070695_10000314210 | 151 |
| 138 | 3300005546 | Ga0070696_100017739 | Ga0070696_1000177394 | 151 |
| 139 | 3300005548 | Ga0070665_100048445 | Ga0070665_1000484454 | 151 |
| 140 | 3300005548 | Ga0070665_100153382 | Ga0070665_1001533823 | 151 |
| 141 | 3300005548 | Ga0070665_101165632 | Ga0070665_1011656322 | 151 |
| 142 | 3300005549 | Ga0070704_100000886 | Ga0070704_1000008868 | 151 |
| 143 | 3300005563 | Ga0068855_101319680 | Ga0068855_1013196802 | 151 |
| 144 | 3300005578 | Ga0068854_100027615 | Ga0068854_1000276152 | 151 |
| 145 | 3300005614 | Ga0068856_100829041 | Ga0068856_1008290412 | 151 |
| 146 | 3300005615 | Ga0070702_100000595 | Ga0070702_10000059510 | 151 |
| 147 | 3300005615 | Ga0070702_101080378 | Ga0070702_1010803781 | 151 |
| 148 | 3300005617 | Ga0068859_100004531 | Ga0068859_10000453111 | 151 |
| 149 | 3300005617 | Ga0068859_100050887 | Ga0068859_1000508872 | 151 |
| 150 | 3300005718 | Ga0068866_10000844 | Ga0068866_1000084416 | 151 |
| 151 | 3300005719 | Ga0068861_100010806 | Ga0068861_1000108066 | 151 |
| 152 | 3300005719 | Ga0068861_100028159 | Ga0068861_1000281591 | 151 |
| 153 | 3300005841 | Ga0068863_100082447 | Ga0068863_1000824473 | 151 |
| 154 | 3300005841 | Ga0068863_100275285 | Ga0068863_1002752852 | 151 |
| 155 | 3300005842 | Ga0068858_100004987 | Ga0068858_1000049872 | 151 |
| 156 | 3300005842 | Ga0068858_100032180 | Ga0068858_1000321805 | 151 |
| 157 | 3300005843 | Ga0068860_100000010 | Ga0068860_100000010266 | 151 |
| 158 | 3300005843 | Ga0068860_100070968 | Ga0068860_1000709682 | 151 |
| 159 | 3300005843 | Ga0068860_100077247 | Ga0068860_1000772473 | 151 |
| 160 | 3300005844 | Ga0068862_100000008 | Ga0068862_10000000857 | 151 |
| 161 | 3300005844 | Ga0068862_100002812 | Ga0068862_10000281211 | 151 |
| 162 | 3300005937 | Ga0081455_10022620 | Ga0081455_100226206 | 151 |
| 163 | 3300005937 | Ga0081455_10067238 | Ga0081455_100672381 | 151 |
| 164 | 3300006028 | Ga0070717_10250405 | Ga0070717_102504052 | 151 |
| 165 | 3300006038 | Ga0075365_10001874 | Ga0075365_100018743 | 151 |
| 166 | 3300006038 | Ga0075365_10305382 | Ga0075365_103053822 | 151 |
| 167 | 3300006048 | Ga0075363_100067434 | Ga0075363_1000674342 | 151 |
| 168 | 3300006048 | Ga0075363_100385080 | Ga0075363_1003850802 | 151 |
| 169 | 3300006051 | Ga0075364_10008520 | Ga0075364_100085203 | 151 |
| 170 | 3300006051 | Ga0075364_10643930 | Ga0075364_106439301 | 151 |
| 171 | 3300006163 | Ga0070715_10089538 | Ga0070715_100895382 | 151 |
| 172 | 3300006173 | Ga0070716_100053220 | Ga0070716_1000532202 | 151 |
| 173 | 3300006173 | Ga0070716_100089706 | Ga0070716_1000897062 | 151 |
| 174 | 3300006175 | Ga0070712_100023243 | Ga0070712_1000232433 | 151 |
| 175 | 3300006177 | Ga0075362_10057549 | Ga0075362_100575491 | 151 |
| 176 | 3300006178 | Ga0075367_10082094 | Ga0075367_100820942 | 151 |
| 177 | 3300006186 | Ga0075369_10021548 | Ga0075369_100215482 | 151 |
| 178 | 3300006186 | Ga0075369_10117961 | Ga0075369_101179612 | 151 |
| 179 | 3300006353 | Ga0075370_10021576 | Ga0075370_100215763 | 151 |
| 180 | 3300006353 | Ga0075370_10046370 | Ga0075370_100463704 | 151 |
| 181 | 3300006358 | Ga0068871_100036382 | Ga0068871_1000363822 | 151 |
| 182 | 3300006844 | Ga0075428_100022285 | Ga0075428_1000222857 | 151 |
| 183 | 3300006846 | Ga0075430_100021962 | Ga0075430_1000219622 | 151 |
| 184 | 3300006847 | Ga0075431_100090538 | Ga0075431_1000905384 | 151 |
| 185 | 3300006881 | Ga0068865_100031079 | Ga0068865_1000310794 | 151 |
| 186 | 3300006931 | Ga0097620_100004531 | Ga0097620_1000045313 | 151 |
| 187 | 3300006931 | Ga0097620_100050889 | Ga0097620_1000508892 | 151 |
| 188 | 3300007788 | Ga0099795_10006404 | Ga0099795_100064046 | 151 |
| 189 | 3300009098 | Ga0105245_10001126 | Ga0105245_1000112611 | 151 |
| 190 | 3300009101 | Ga0105247_10000019 | Ga0105247_10000019198 | 151 |
| 191 | 3300009101 | Ga0105247_10001096 | Ga0105247_100010965 | 151 |
| 192 | 3300009147 | Ga0114129_10060401 | Ga0114129_100604015 | 151 |
| 193 | 3300009148 | Ga0105243_10003000 | Ga0105243_100030007 | 151 |
| 194 | 3300009174 | Ga0105241_10042542 | Ga0105241_100425423 | 151 |
| 195 | 3300009176 | Ga0105242_10028064 | Ga0105242_100280643 | 151 |
| 196 | 3300009177 | Ga0105248_10000093 | Ga0105248_1000009374 | 151 |
| 197 | 3300009177 | Ga0105248_10034054 | Ga0105248_100340542 | 151 |
| 198 | 3300009545 | Ga0105237_10107129 | Ga0105237_101071292 | 151 |
| 199 | 3300009553 | Ga0105249_10000019 | Ga0105249_1000001955 | 151 |
| 200 | 3300009553 | Ga0105249_10003476 | Ga0105249_100034763 | 151 |
| 201 | 3300009553 | Ga0105249_10112252 | Ga0105249_101122522 | 151 |
| 202 | 3300010159 | Ga0099796_10024375 | Ga0099796_100243752 | 151 |
| 203 | 3300010375 | Ga0105239_10059762 | Ga0105239_100597623 | 151 |
| 204 | 3300010375 | Ga0105239_10451311 | Ga0105239_104513111 | 151 |
| 205 | 3300013105 | Ga0157369_10129213 | Ga0157369_101292132 | 151 |
| 206 | 3300013296 | Ga0157374_10206312 | Ga0157374_102063122 | 151 |
| 207 | 3300013297 | Ga0157378_10003396 | Ga0157378_100033964 | 151 |
| 208 | 3300013306 | Ga0163162_10170010 | Ga0163162_101700103 | 151 |
| 209 | 3300013306 | Ga0163162_10223055 | Ga0163162_102230552 | 151 |
| 210 | 3300013306 | Ga0163162_11382008 | Ga0163162_113820082 | 151 |
| 211 | 3300013307 | Ga0157372_10046403 | Ga0157372_100464032 | 151 |
| 212 | 3300013308 | Ga0157375_10000791 | Ga0157375_100007917 | 151 |
| 213 | 3300014326 | Ga0157380_10002198 | Ga0157380_1000219811 | 151 |
| 214 | 3300014745 | Ga0157377_10443787 | Ga0157377_104437872 | 151 |
| 215 | 3300014968 | Ga0157379_10137175 | Ga0157379_101371752 | 151 |
| 216 | 3300014968 | Ga0157379_11063244 | Ga0157379_110632441 | 151 |
| 217 | 3300014969 | Ga0157376_11382626 | Ga0157376_113826261 | 151 |
| 218 | 3300017792 | Ga0163161_10001275 | Ga0163161_100012753 | 151 |
| 219 | 3300017792 | Ga0163161_10060292 | Ga0163161_100602922 | 151 |
| 220 | 3300021384 | Ga0213876_10082904 | Ga0213876_100829042 | 151 |
| 221 | 3300025273 | Ga0209673_1015197 | Ga0209673_10151972 | 151 |
| 222 | 3300025294 | Ga0209025_1147646 | Ga0209025_11476461 | 151 |
| 223 | 3300025303 | Ga0209051_1000567 | Ga0209051_100056739 | 151 |
| 224 | 3300025303 | Ga0209051_1027308 | Ga0209051_10273082 | 151 |
| 225 | 3300025303 | Ga0209051_1066508 | Ga0209051_10665082 | 151 |
| 226 | 3300025893 | Ga0207682_10223481 | Ga0207682_102234811 | 151 |
| 227 | 3300025898 | Ga0207692_10372047 | Ga0207692_103720472 | 151 |
| 228 | 3300025899 | Ga0207642_10027308 | Ga0207642_100273082 | 151 |
| 229 | 3300025900 | Ga0207710_10000036 | Ga0207710_1000003640 | 151 |
| 230 | 3300025901 | Ga0207688_10002386 | Ga0207688_100023863 | 151 |
| 231 | 3300025903 | Ga0207680_10184090 | Ga0207680_101840902 | 151 |
| 232 | 3300025906 | Ga0207699_10092721 | Ga0207699_100927211 | 151 |
| 233 | 3300025906 | Ga0207699_10468943 | Ga0207699_104689432 | 151 |
| 234 | 3300025907 | Ga0207645_10025691 | Ga0207645_100256913 | 151 |
| 235 | 3300025914 | Ga0207671_10271527 | Ga0207671_102715272 | 151 |
| 236 | 3300025915 | Ga0207693_10014735 | Ga0207693_100147356 | 151 |
| 237 | 3300025916 | Ga0207663_10073785 | Ga0207663_100737853 | 151 |
| 238 | 3300025918 | Ga0207662_10053621 | Ga0207662_100536212 | 151 |
| 239 | 3300025919 | Ga0207657_10468621 | Ga0207657_104686211 | 151 |
| 240 | 3300025923 | Ga0207681_10003529 | Ga0207681_1000352914 | 151 |
| 241 | 3300025923 | Ga0207681_10072036 | Ga0207681_100720362 | 151 |
| 242 | 3300025927 | Ga0207687_10041289 | Ga0207687_100412893 | 151 |
| 243 | 3300025928 | Ga0207700_11504258 | Ga0207700_115042581 | 151 |
| 244 | 3300025929 | Ga0207664_10024807 | Ga0207664_100248072 | 151 |
| 245 | 3300025929 | Ga0207664_10568103 | Ga0207664_105681032 | 151 |
| 246 | 3300025929 | Ga0207664_11948040 | Ga0207664_119480401 | 151 |
| 247 | 3300025931 | Ga0207644_10112384 | Ga0207644_101123843 | 151 |
| 248 | 3300025933 | Ga0207706_10012282 | Ga0207706_100122825 | 151 |
| 249 | 3300025935 | Ga0207709_10023635 | Ga0207709_100236353 | 151 |
| 250 | 3300025936 | Ga0207670_10021742 | Ga0207670_100217422 | 151 |
| 251 | 3300025937 | Ga0207669_10063304 | Ga0207669_100633042 | 151 |
| 252 | 3300025937 | Ga0207669_10152606 | Ga0207669_101526062 | 151 |
| 253 | 3300025938 | Ga0207704_10080498 | Ga0207704_100804982 | 151 |
| 254 | 3300025938 | Ga0207704_10408896 | Ga0207704_104088961 | 151 |
| 255 | 3300025939 | Ga0207665_10063833 | Ga0207665_100638333 | 151 |
| 256 | 3300025941 | Ga0207711_10000102 | Ga0207711_100001029 | 151 |
| 257 | 3300025941 | Ga0207711_10077966 | Ga0207711_100779664 | 151 |
| 258 | 3300025944 | Ga0207661_10208955 | Ga0207661_102089552 | 151 |
| 259 | 3300025949 | Ga0207667_10103905 | Ga0207667_101039051 | 151 |
| 260 | 3300025961 | Ga0207712_10000025 | Ga0207712_10000025196 | 151 |
| 261 | 3300025961 | Ga0207712_10049716 | Ga0207712_100497162 | 151 |
| 262 | 3300025961 | Ga0207712_10094892 | Ga0207712_100948923 | 151 |
| 263 | 3300025972 | Ga0207668_10198268 | Ga0207668_101982682 | 151 |
| 264 | 3300025972 | Ga0207668_11743048 | Ga0207668_117430481 | 151 |
| 265 | 3300025981 | Ga0207640_10448790 | Ga0207640_104487901 | 151 |
| 266 | 3300025986 | Ga0207658_10002129 | Ga0207658_100021292 | 151 |
| 267 | 3300026023 | Ga0207677_10298810 | Ga0207677_102988102 | 151 |
| 268 | 3300026035 | Ga0207703_10010287 | Ga0207703_100102872 | 151 |
| 269 | 3300026035 | Ga0207703_10039022 | Ga0207703_100390222 | 151 |
| 270 | 3300026041 | Ga0207639_10095690 | Ga0207639_100956903 | 151 |
| 271 | 3300026067 | Ga0207678_10004434 | Ga0207678_100044344 | 151 |
| 272 | 3300026067 | Ga0207678_10091103 | Ga0207678_100911032 | 151 |
| 273 | 3300026067 | Ga0207678_10148403 | Ga0207678_101484032 | 151 |
| 274 | 3300026078 | Ga0207702_10514098 | Ga0207702_105140981 | 151 |
| 275 | 3300026088 | Ga0207641_10043104 | Ga0207641_100431045 | 151 |
| 276 | 3300026088 | Ga0207641_10349490 | Ga0207641_103494902 | 151 |
| 277 | 3300026089 | Ga0207648_10006698 | Ga0207648_1000669815 | 151 |
| 278 | 3300026118 | Ga0207675_100008102 | Ga0207675_10000810210 | 151 |
| 279 | 3300026121 | Ga0207683_10002027 | Ga0207683_1000202713 | 151 |
| 280 | 3300028379 | Ga0268266_10009177 | Ga0268266_100091777 | 151 |
| 281 | 3300028379 | Ga0268266_10169665 | Ga0268266_101696653 | 151 |
| 282 | 3300028380 | Ga0268265_10000007 | Ga0268265_1000000755 | 151 |
| 283 | 3300028380 | Ga0268265_10286972 | Ga0268265_102869723 | 151 |
| 284 | 3300028381 | Ga0268264_10000007 | Ga0268264_10000007191 | 151 |
| 285 | 3300028381 | Ga0268264_10052664 | Ga0268264_100526642 | 151 |
| 286 | 3300028381 | Ga0268264_10097312 | Ga0268264_100973122 | 151 |
| 287 | 3300031731 | Ga0307405_11077222 | Ga0307405_110772221 | 151 |
| 288 | 3300031852 | Ga0307410_10127683 | Ga0307410_101276832 | 151 |
| 289 | 3300031911 | Ga0307412_10333983 | Ga0307412_103339832 | 151 |
| 290 | 3300031995 | Ga0307409_101697620 | Ga0307409_1016976201 | 151 |
| 291 | 3300032002 | Ga0307416_102394196 | Ga0307416_1023941961 | 151 |
| 292 | 3300032126 | Ga0307415_100560129 | Ga0307415_1005601292 | 151 |
| 293 | 3300035115 | Ga0373941_0087690 | Ga0373941_0087690_558_1013 | 151 |
| 294 | 3300035691 | Ga0373931_0202566 | Ga0373931_0202566_630_1085 | 151 |
| 295 | 3300037853 | Ga0436364_0426817 | Ga0436364_0426817_36791_37294 | 151 |
| 296 | 3300039437 | Ga0436365_0011552 | Ga0436365_0011552_2324_2827 | 151 |
| 297 | 3300039437 | Ga0436365_0374763 | Ga0436365_0374763_61_528 | 151 |
| 298 | 3300039437 | Ga0436365_0712680 | Ga0436365_0712680_44594_45049 | 151 |
| 299 | 3300039437 | Ga0436365_0983079 | Ga0436365_0983079_178_645 | 151 |
| 300 | 3300039450 | Ga0436363_0807283 | Ga0436363_0807283_742_1197 | 151 |
| 301 | 3300039450 | Ga0436363_0903752 | Ga0436363_0903752_63_551 | 151 |
| 302 | 3300039450 | Ga0436363_1310981 | Ga0436363_1310981_82_585 | 151 |
| 303 | 3300039453 | Ga0436362_0743795 | Ga0436362_0743795_159_677 | 151 |
| 304 | 3300041491 | Ga0451833_0130817 | Ga0451833_0130817_79_534 | 151 |
| 305 | 3300044683 | Ga0466965_0038928 | Ga0466965_0038928_613_1068 | 151 |
| 306 | 3300044684 | Ga0466966_0003951 | Ga0466966_0003951_7815_8270 | 151 |
| 307 | 3300044684 | Ga0466966_0008791 | Ga0466966_0008791_5344_5811 | 151 |
| 308 | 3300044693 | Ga0466961_0130462 | Ga0466961_0130462_330_785 | 151 |
| 309 | 3300044694 | Ga0466963_0046933 | Ga0466963_0046933_825_1280 | 151 |
| 310 | 3300044694 | Ga0466963_0101019 | Ga0466963_0101019_1024_1479 | 151 |
| 311 | 3300044694 | Ga0466963_0140228 | Ga0466963_0140228_1139_1594 | 151 |
| 312 | 3300044706 | Ga0466964_0765803 | Ga0466964_0765803_59_514 | 151 |
| 313 | 3300044719 | Ga0466971_0080566 | Ga0466971_0080566_538_993 | 151 |
| 314 | 3300044735 | Ga0466968_0001218 | Ga0466968_0001218_1644_2111 | 151 |
| 315 | 3300044735 | Ga0466968_0084637 | Ga0466968_0084637_165_620 | 151 |
| 316 | 3300044765 | Ga0466970_0028417 | Ga0466970_0028417_2201_2668 | 151 |
| 317 | 3300044842 | Ga0466957_0004344 | Ga0466957_0004344_5899_6354 | 151 |
| 318 | 3300044842 | Ga0466957_0046792 | Ga0466957_0046792_1475_1930 | 151 |
| 319 | 3300044842 | Ga0466957_0061774 | Ga0466957_0061774_1213_1668 | 151 |
| 320 | 3300044901 | Ga0466960_0009906 | Ga0466960_0009906_911_1366 | 151 |
| 321 | 3300044901 | Ga0466960_0551457 | Ga0466960_0551457_95_550 | 151 |
| 322 | 3300045049 | Ga0466959_0246613 | Ga0466959_0246613_752_1207 | 151 |
| 323 | 3300045836 | Ga0466958_0087251 | Ga0466958_0087251_192_647 | 151 |
| 324 | 3300045836 | Ga0466958_0135902 | Ga0466958_0135902_218_673 | 151 |
| 325 | 3300045976 | Ga0466967_0134266 | Ga0466967_0134266_78_533 | 151 |
| 326 | 3300045976 | Ga0466967_0149894 | Ga0466967_0149894_983_1459 | 151 |
| 327 | 3300045976 | Ga0466967_0172023 | Ga0466967_0172023_454_909 | 151 |
| 328 | 3300047472 | Ga0495686_0325791 | Ga0495686_0325791_32_487 | 151 |
| 329 | 3300048903 | Ga0496100_0014024 | Ga0496100_0014024_155_616 | 151 |
| 330 | 3300048903 | Ga0496100_0062617 | Ga0496100_0062617_452_907 | 151 |
| 331 | 3300048904 | Ga0496101_0019055 | Ga0496101_0019055_2468_2929 | 151 |
| 332 | 3300048904 | Ga0496101_0067404 | Ga0496101_0067404_199_654 | 151 |
| 333 | 3300048905 | Ga0496102_0000112 | Ga0496102_0000112_36709_37170 | 151 |
| 334 | 3300048905 | Ga0496102_0077924 | Ga0496102_0077924_985_1440 | 151 |
| 335 | 3300048906 | Ga0496103_0000625 | Ga0496103_0000625_3070_3531 | 151 |
| 336 | 3300048906 | Ga0496103_0006151 | Ga0496103_0006151_3694_4149 | 151 |
| 337 | 3300048906 | Ga0496103_0140884 | Ga0496103_0140884_417_884 | 151 |
| 338 | 3300048909 | Ga0496106_0047817 | Ga0496106_0047817_885_1340 | 151 |
| 339 | 3300048910 | Ga0496107_0045728 | Ga0496107_0045728_1744_2199 | 151 |
| 340 | 3300048911 | Ga0496108_1173421 | Ga0496108_1173421_94_555 | 151 |
| 341 | 3300048915 | Ga0496112_0237525 | Ga0496112_0237525_688_1143 | 151 |
| 342 | 3300048917 | Ga0496114_0019494 | Ga0496114_0019494_4071_4526 | 151 |
| 343 | 3300048918 | Ga0496115_0083075 | Ga0496115_0083075_1037_1492 | 151 |
| 344 | 3300048919 | Ga0496116_0024878 | Ga0496116_0024878_1837_2298 | 151 |
| 345 | 3300048920 | Ga0496117_0000719 | Ga0496117_0000719_1812_2273 | 151 |
| 346 | 3300048921 | Ga0496118_0000452 | Ga0496118_0000452_51759_52226 | 151 |
| 347 | 3300048921 | Ga0496118_0003415 | Ga0496118_0003415_11738_12199 | 151 |
| 348 | 3300048922 | Ga0496119_0008326 | Ga0496119_0008326_4000_4461 | 151 |
| 349 | 3300048924 | Ga0496121_0025722 | Ga0496121_0025722_4188_4649 | 151 |
| 350 | 3300048927 | Ga0496124_0039851 | Ga0496124_0039851_2997_3458 | 151 |
| 351 | 3300048928 | Ga0496125_0061470 | Ga0496125_0061470_1591_2046 | 151 |
| 352 | 3300048928 | Ga0496125_0123701 | Ga0496125_0123701_1115_1576 | 151 |
| 353 | 3300048929 | Ga0496126_0017687 | Ga0496126_0017687_4670_5131 | 151 |
| 354 | 3300048929 | Ga0496126_0030151 | Ga0496126_0030151_2781_3236 | 151 |
| 355 | 3300048929 | Ga0496126_0296543 | Ga0496126_0296543_355_822 | 151 |
| 356 | 3300049569 | Ga0501032_0047599 | Ga0501032_0047599_1675_2130 | 151 |
| 357 | 3300049570 | Ga0501033_0098922 | Ga0501033_0098922_1594_2049 | 151 |
| 358 | 3300049571 | Ga0501034_0054844 | Ga0501034_0054844_332_787 | 151 |
| 359 | 3300049571 | Ga0501034_0081252 | Ga0501034_0081252_2595_3086 | 151 |
| 360 | 3300049573 | Ga0501037_0041755 | Ga0501037_0041755_2546_3037 | 151 |
| 361 | 3300049579 | Ga0501043_0011533 | Ga0501043_0011533_1738_2229 | 151 |
| 362 | 3300049580 | Ga0501046_0000931 | Ga0501046_0000931_26928_27419 | 151 |
| 363 | 3300049580 | Ga0501046_0400799 | Ga0501046_0400799_438_893 | 151 |
| 364 | 3300049581 | Ga0501047_0010353 | Ga0501047_0010353_3106_3597 | 151 |
| 365 | 3300049581 | Ga0501047_0026162 | Ga0501047_0026162_94_549 | 151 |
| 366 | 3300049581 | Ga0501047_0291616 | Ga0501047_0291616_44_511 | 151 |
| 367 | 3300049582 | Ga0501048_0096411 | Ga0501048_0096411_840_1331 | 151 |
| 368 | 3300049586 | Ga0501070_0069839 | Ga0501070_0069839_86_577 | 151 |
| 369 | 3300049589 | Ga0501073_0302999 | Ga0501073_0302999_579_1070 | 151 |
| 370 | 3300049589 | Ga0501073_0428047 | Ga0501073_0428047_419_874 | 151 |
| 371 | 3300049822 | Ga0501035_0004777 | Ga0501035_0004777_11655_12110 | 151 |
| 372 | 3300049822 | Ga0501035_0012371 | Ga0501035_0012371_995_1486 | 151 |
| 373 | 3300049823 | Ga0501044_0002883 | Ga0501044_0002883_1307_1798 | 151 |
| 374 | 3300049823 | Ga0501044_0014776 | Ga0501044_0014776_7865_8320 | 151 |
| 375 | 3300050489 | nmdc:mga03683_225967_c1 | nmdc:mga03683_225967_c1_33_500 | 151 |
| 376 | 3300050489 | nmdc:mga03683_80165_c1 | nmdc:mga03683_80165_c1_562_1017 | 151 |
| 377 | 3300050490 | nmdc:mga03n38_224936_c1 | nmdc:mga03n38_224936_c1_498_962 | 151 |
| 378 | 3300050490 | nmdc:mga03n38_325_c1 | nmdc:mga03n38_325_c1_273_737 | 151 |
| 379 | 3300050491 | nmdc:mga00v17_43763_c1 | nmdc:mga00v17_43763_c1_2008_2472 | 151 |
| 380 | 3300050491 | nmdc:mga00v17_633286_c1 | nmdc:mga00v17_633286_c1_222_677 | 151 |
| 381 | 3300050492 | nmdc:mga0yw44_204144_c1 | nmdc:mga0yw44_204144_c1_63_572 | 151 |
| 382 | 3300050492 | nmdc:mga0yw44_749_c1 | nmdc:mga0yw44_749_c1_2592_3059 | 151 |
| 383 | 3300050494 | nmdc:mga06z11_407812_c1 | nmdc:mga06z11_407812_c1_158_616 | 151 |
| 384 | 3300050496 | nmdc:mga07m45_22450_c1 | nmdc:mga07m45_22450_c1_2199_2657 | 151 |
| 385 | 3300050496 | nmdc:mga07m45_44360_c1 | nmdc:mga07m45_44360_c1_1055_1519 | 151 |
| 386 | 3300050507 | nmdc:mga05p37_295202_c1 | nmdc:mga05p37_295202_c1_1054_1515 | 151 |
| 387 | 3300050509 | nmdc:mga0qj67_7274_c1 | nmdc:mga0qj67_7274_c1_6381_6842 | 151 |
| 388 | 3300050510 | nmdc:mga06r32_17566_c1 | nmdc:mga06r32_17566_c1_2203_2664 | 151 |
| 389 | 3300050516 | nmdc:mga0sz30_69992_c1 | nmdc:mga0sz30_69992_c1_321_776 | 151 |
| 390 | 3300053086 | Ga0500578_0604756 | Ga0500578_0604756_87_557 | 151 |
| 391 | 3300053137 | Ga0500561_0203846 | Ga0500561_0203846_143_598 | 151 |
| 392 | 3300053139 | Ga0500568_0065985 | Ga0500568_0065985_825_1280 | 151 |
| 393 | 3300053730 | Ga0500645_000029 | Ga0500645_000029_17219_17674 | 151 |
| 394 | 3300061719 | Ga0466962_0209716 | Ga0466962_0209716_241_696 | 151 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3jxc-assembly1.cif.gz_L | crystal structure of the p22 c2 repressor protein in complex with synthetic operator 9t in the presence of tl+ | 0.8203 | 6 | 64 |
| 2lyk-assembly1.cif.gz_B | noe-based 3d structure of the cylr2 homodimer at 270k (-3 celsius degrees) | 0.8139 | 10 | 64 |
| 2xi8-assembly1.cif.gz_A | high resolution structure of native cylr2 | 0.8134 | 12 | 62 |
| 7o81-assembly1.cif.gz_AU | rabbit 80s ribosome colliding in another ribosome stalled by the sars-cov-2 pseudoknot | 0.8122 | 1 | 61 |
| 2xj3-assembly1.cif.gz_A | high resolution structure of the t55c mutant of cylr2. | 0.8083 | 12 | 62 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2ivbG02 | Alpha Beta;2-Layer Sandwich;Cyanate Lyase; Chain: A, domain 2;Cyanate lyase, C-terminal domain | 0.9613 | 81 | 144 | 3.30.1160.10 |
| 4y42I01 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.9 | 3 | 77 | 1.10.260.40 |
| 2ivbG02 | Alpha Beta;2-Layer Sandwich;Cyanate Lyase; Chain: A, domain 2;Cyanate lyase, C-terminal domain | 0.8937 | 81 | 144 | 3.30.1160.10 |
| 2iu7A01 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.8784 | 3 | 80 | 1.10.260.40 |
| 2r1jL00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.8227 | 6 | 64 | 1.10.260.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-W5WE99-F1-model_v4 | Cyanate lyase C-terminal domain-containing protein | 0.99 | 87 | 146 |
GO:0008824
GO:0009439 |
| AF-A0A521R818-F1-model_v4 | Cyanase | 0.9834 | 87 | 144 |
GO:0008824
GO:0009439 |
| AF-W2E682-F1-model_v4 | deleted | 0.982 | 79 | 144 |
|
| AF-B7DPZ3-F1-model_v4 | deleted | 0.9817 | 79 | 144 |
|
| AF-A0A6J4R198-F1-model_v4 | Cyanate hydratase (EC 4.2.1.104) | 0.976 | 81 | 146 |
GO:0008824
GO:0009439 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar