F432956

General Info

Members Datasets Scaffolds Average Seq Length
394 206 788 89

Family's Representative Sequence

Representative Sequence 3300036647|Ga0316582_0379397|Ga0316582_0379397_34_354
Length 106
Sequence MGKIPLLFRTFNYLELLMSLNNEATQQIIKDYQRGAGDTGSPEVQVALLSARINQLAEHFKGHAKDHHSRQGLLRMVSARRNLLDYLKRHDTERYRTLVSRLGLRR

Samples

Sample ID Description Type Environment
1 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
55 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
61 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
106 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
107 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
108 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
109 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
110 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
111 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
112 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
113 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
114 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
115 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
116 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
117 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
118 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
119 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
125 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
126 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
127 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
128 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
129 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
130 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
133 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
139 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
140 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
141 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
142 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
143 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
144 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
145 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
146 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
147 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
148 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
149 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
150 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
151 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
152 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
153 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
154 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
170 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
171 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
172 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
173 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
174 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
175 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
176 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
177 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
178 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
179 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
180 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
181 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
182 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
185 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
186 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
187 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
188 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
189 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
190 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
191 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
192 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
193 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
194 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
195 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
196 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
197 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
198 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
206 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.06
Metatranscriptomes 12.69
Isolates 0.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.54
Nodule 0
Rhizoplane 0.51
Rhizosphere 94.67
Stem 0
Stem Tuber 0
Unclassified 3.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316582_0379397 3300036647 Bacteria 973
2 JGI24740J21852_10015904 3300001979 Bacteria 2733
3 JGI24739J22299_10053974 3300001989 Bacteria 1289
4 JGI24737J22298_10037836 3300001990 Bacteria 1486
5 JGI24735J21928_10020070 3300002067 Bacteria 2049
6 Ga0070658_11919384 3300005327 Bacteria 511
7 Ga0070683_100064576 3300005329 Bacteria 3408
8 Ga0070683_100111804 3300005329 Bacteria 2577
9 Ga0070683_100414968 3300005329 Bacteria 1284
10 Ga0068869_100408701 3300005334 Bacteria 1118
11 Ga0070680_100166531 3300005336 Bacteria 1853
12 Ga0070682_101462679 3300005337 Bacteria 586
13 Ga0070660_100467933 3300005339 Bacteria 1047
14 Ga0070661_100433751 3300005344 Bacteria 1043
15 Ga0070661_100568515 3300005344 Bacteria 914
16 Ga0070661_101162253 3300005344 Bacteria 644
17 Ga0070668_100003149 3300005347 Bacteria 12167
18 Ga0070669_100058367 3300005353 Bacteria 2832
19 Ga0070667_100040046 3300005367 Bacteria 3929
20 Ga0070713_101122552 3300005436 Bacteria 760
21 Ga0070711_100000849 3300005439 Bacteria 16068
22 Ga0070663_100523521 3300005455 Bacteria 987
23 Ga0070662_100125704 3300005457 Bacteria 1971
24 Ga0070662_100163470 3300005457 Bacteria 1743
25 Ga0070681_10061754 3300005458 Bacteria 3721
26 Ga0070679_100603659 3300005530 Bacteria 1041
27 Ga0070679_101455968 3300005530 Bacteria 631
28 Ga0070684_100789105 3300005535 Bacteria 888
29 Ga0070693_100544973 3300005547 Bacteria 829
30 Ga0068855_100002453 3300005563 Bacteria 22922
31 Ga0068855_100757609 3300005563 Unclassified 1035
32 Ga0070664_100069259 3300005564 Bacteria 3018
33 Ga0070664_100176318 3300005564 Bacteria 1898
34 Ga0070664_100386382 3300005564 Bacteria 1278
35 Ga0068857_100712905 3300005577 Bacteria 954
36 Ga0068857_101039271 3300005577 Bacteria 789
37 Ga0068854_100179208 3300005578 Bacteria 1654
38 Ga0068854_100380100 3300005578 Bacteria 1163
39 Ga0068854_100625684 3300005578 Bacteria 922
40 Ga0068856_100387096 3300005614 Bacteria 1418
41 Ga0068856_101760938 3300005614 Bacteria 631
42 Ga0068852_100208257 3300005616 Bacteria 1854
43 Ga0068852_102565404 3300005616 Bacteria 529
44 Ga0068852_102565661 3300005616 Bacteria 529
45 Ga0068859_101215924 3300005617 Bacteria 830
46 Ga0068851_10067497 3300005834 Bacteria 1844
47 Ga0068860_100447586 3300005843 Bacteria 1284
48 Ga0068862_100029176 3300005844 Bacteria 4647
49 Ga0081539_10145152 3300005985 Bacteria 1148
50 Ga0075364_10456894 3300006051 Bacteria 873
51 Ga0070712_100086748 3300006175 Bacteria 2282
52 Ga0068871_100150144 3300006358 Bacteria 1987
53 Ga0075431_100073040 3300006847 Bacteria 3539
54 Ga0075431_100363579 3300006847 Bacteria 1453
55 Ga0075429_100050775 3300006880 Bacteria 3608
56 Ga0075429_100272588 3300006880 Bacteria 1482
57 Ga0075429_101895443 3300006880 Bacteria 516
58 Ga0097620_101215907 3300006931 Bacteria 830
59 Ga0105240_10022660 3300009093 Bacteria 8321
60 Ga0105245_10749604 3300009098 Bacteria 1012
61 Ga0114129_10367483 3300009147 Bacteria 1902
62 Ga0105242_12673553 3300009176 Bacteria 549
63 Ga0105238_10053133 3300009551 Bacteria 4072
64 Ga0105238_10968927 3300009551 Bacteria 871
65 Ga0105249_10508792 3300009553 Bacteria 1250
66 Ga0105239_10160109 3300010375 Bacteria 2514
67 Ga0105239_11124704 3300010375 Bacteria 904
68 Ga0105246_12339706 3300011119 Bacteria 523
69 Ga0157371_11442842 3300013102 Bacteria 535
70 Ga0157370_10191789 3300013104 Bacteria 1897
71 Ga0157370_10216568 3300013104 Bacteria 1774
72 Ga0157369_11337904 3300013105 Bacteria 730
73 Ga0182008_10176566 3300014497 Bacteria 1080
74 Ga0157376_10414243 3300014969 Bacteria 1306
75 Ga0182005_1003539 3300015265 Bacteria 5271
76 Ga0206356_10180588 3300020070 Bacteria 2971
77 Ga0206352_11136308 3300020078 Bacteria 700
78 Ga0206354_10279941 3300020081 Bacteria 652
79 Ga0206354_11400852 3300020081 Bacteria 692
80 Ga0206353_10631927 3300020082 Bacteria 1339
81 Ga0224712_10138363 3300022467 Bacteria 1069
82 Ga0209025_1086987 3300025294 Bacteria 1037
83 Ga0207656_10430824 3300025321 Bacteria 665
84 Ga0207682_10062659 3300025893 Bacteria 1560
85 Ga0207692_10288117 3300025898 Bacteria 996
86 Ga0207692_10329852 3300025898 Bacteria 936
87 Ga0207647_10085458 3300025904 Bacteria 1887
88 Ga0207685_10360726 3300025905 Bacteria 735
89 Ga0207705_10019962 3300025909 Bacteria 4793
90 Ga0207705_10199325 3300025909 Bacteria 1516
91 Ga0207654_10263764 3300025911 Bacteria 1159
92 Ga0207707_10175420 3300025912 Bacteria 1872
93 Ga0207707_10851788 3300025912 Bacteria 756
94 Ga0207707_11196273 3300025912 Bacteria 615
95 Ga0207695_10005515 3300025913 Bacteria 16748
96 Ga0207695_10191472 3300025913 Bacteria 1963
97 Ga0207671_10690658 3300025914 Bacteria 812
98 Ga0207693_10095647 3300025915 Bacteria 2328
99 Ga0207663_10007398 3300025916 Bacteria 5693
100 Ga0207663_10137476 3300025916 Bacteria 1698
101 Ga0207660_10075973 3300025917 Bacteria 2456
102 Ga0207660_10255760 3300025917 Bacteria 1383
103 Ga0207657_10032432 3300025919 Bacteria 4720
104 Ga0207657_10134247 3300025919 Bacteria 2026
105 Ga0207657_10138940 3300025919 Bacteria 1986
106 Ga0207649_10038292 3300025920 Bacteria 2902
107 Ga0207649_10748201 3300025920 Bacteria 760
108 Ga0207649_11207020 3300025920 Bacteria 598
109 Ga0207652_10263986 3300025921 Bacteria 1553
110 Ga0207652_11097072 3300025921 Bacteria 696
111 Ga0207681_10042919 3300025923 Bacteria 3024
112 Ga0207681_10828013 3300025923 Bacteria 774
113 Ga0207694_10631797 3300025924 Bacteria 901
114 Ga0207694_10914112 3300025924 Bacteria 742
115 Ga0207694_11213466 3300025924 Bacteria 638
116 Ga0207659_10118435 3300025926 Bacteria 2025
117 Ga0207659_10777781 3300025926 Bacteria 822
118 Ga0207659_11138311 3300025926 Bacteria 671
119 Ga0207687_11479749 3300025927 Bacteria 583
120 Ga0207690_10276620 3300025932 Bacteria 1306
121 Ga0207690_10975622 3300025932 Bacteria 704
122 Ga0207706_10063755 3300025933 Bacteria 3244
123 Ga0207670_11038480 3300025936 Bacteria 690
124 Ga0207691_10658816 3300025940 Bacteria 884
125 Ga0207691_11216227 3300025940 Bacteria 624
126 Ga0207711_10317932 3300025941 Bacteria 1438
127 Ga0207711_10429534 3300025941 Bacteria 1229
128 Ga0207711_11402457 3300025941 Bacteria 641
129 Ga0207661_10057487 3300025944 Bacteria 3127
130 Ga0207661_10564158 3300025944 Bacteria 1043
131 Ga0207679_10111990 3300025945 Bacteria 2156
132 Ga0207679_10148737 3300025945 Bacteria 1903
133 Ga0207679_10327457 3300025945 Bacteria 1328
134 Ga0207667_10011655 3300025949 Bacteria 10202
135 Ga0207667_10169864 3300025949 Bacteria 2241
136 Ga0207667_10457700 3300025949 Bacteria 1296
137 Ga0207667_10549004 3300025949 Bacteria 1169
138 Ga0207651_10966877 3300025960 Bacteria 760
139 Ga0207712_11355426 3300025961 Bacteria 636
140 Ga0207668_10000951 3300025972 Bacteria 17432
141 Ga0207668_10033370 3300025972 Bacteria 3409
142 Ga0207640_10127474 3300025981 Bacteria 1834
143 Ga0207640_10164638 3300025981 Bacteria 1645
144 Ga0207640_11127256 3300025981 Bacteria 695
145 Ga0207640_11738905 3300025981 Bacteria 563
146 Ga0207658_10018162 3300025986 Bacteria 4852
147 Ga0207658_10222079 3300025986 Bacteria 1590
148 Ga0207658_10595655 3300025986 Bacteria 993
149 Ga0207703_11334631 3300026035 Bacteria 690
150 Ga0207639_10564467 3300026041 Bacteria 1046
151 Ga0207639_11014135 3300026041 Bacteria 777
152 Ga0207639_11639130 3300026041 Bacteria 603
153 Ga0207678_10167760 3300026067 Bacteria 1874
154 Ga0207678_10581666 3300026067 Bacteria 981
155 Ga0207678_10938140 3300026067 Bacteria 766
156 Ga0207702_10192338 3300026078 Bacteria 1886
157 Ga0207702_10250865 3300026078 Bacteria 1662
158 Ga0207702_11196590 3300026078 Bacteria 754
159 Ga0207674_10100903 3300026116 Bacteria 2867
160 Ga0207674_10563657 3300026116 Bacteria 1100
161 Ga0207683_10068214 3300026121 Bacteria 3139
162 Ga0207683_10688535 3300026121 Bacteria 947
163 Ga0207698_10004358 3300026142 Bacteria 8616
164 Ga0207698_10046268 3300026142 Bacteria 3284
165 Ga0207698_10533698 3300026142 Bacteria 1147
166 Ga0207698_10727785 3300026142 Bacteria 989
167 Ga0209983_1132861 3300027665 Bacteria 569
168 Ga0268266_10044828 3300028379 Bacteria 3781
169 Ga0268266_10063853 3300028379 Bacteria 3179
170 Ga0268266_10997469 3300028379 Bacteria 810
171 Ga0268265_10068003 3300028380 Bacteria 2760
172 Ga0268265_10374250 3300028380 Bacteria 1308
173 Ga0268264_10913934 3300028381 Bacteria 881
174 Ga0268264_11699389 3300028381 Bacteria 642
175 Ga0265338_10908791 3300028800 Bacteria 599
176 Ga0265332_10230985 3300031238 Bacteria 767
177 Ga0265327_10000567 3300031251 Bacteria 62820
178 Ga0307408_100999979 3300031548 Bacteria 771
179 Ga0316575_10014513 3300031665 Bacteria 2958
180 Ga0316575_10031217 3300031665 Bacteria 2085
181 Ga0316575_10044781 3300031665 Bacteria 1756
182 Ga0316575_10093259 3300031665 Bacteria 1221
183 Ga0316575_10109094 3300031665 Bacteria 1129
184 Ga0316575_10109925 3300031665 Bacteria 1124
185 Ga0316575_10138499 3300031665 Bacteria 1001
186 Ga0316575_10182970 3300031665 Bacteria 870
187 Ga0316579_10000774 3300031691 Bacteria 10932
188 Ga0316579_10001634 3300031691 Bacteria 8220
189 Ga0316579_10006095 3300031691 Bacteria 4898
190 Ga0316579_10576729 3300031691 Bacteria 544
191 Ga0265342_10054963 3300031712 Bacteria 2365
192 Ga0316576_10012781 3300031727 Bacteria 5556
193 Ga0316576_10029603 3300031727 Bacteria 3873
194 Ga0316576_10059781 3300031727 Bacteria 2791
195 Ga0316576_10088252 3300031727 Bacteria 2309
196 Ga0316576_10115395 3300031727 Bacteria 2015
197 Ga0316576_10238416 3300031727 Bacteria 1367
198 Ga0316576_10278378 3300031727 Unclassified 1253
199 Ga0316578_10012423 3300031728 Bacteria 4492
200 Ga0316578_10013092 3300031728 Bacteria 4387
201 Ga0316578_10035121 3300031728 Bacteria 2881
202 Ga0316578_10253531 3300031728 Bacteria 1055
203 Ga0316578_10417372 3300031728 Bacteria 795
204 Ga0316577_10005044 3300031733 Bacteria 6883
205 Ga0316577_10005199 3300031733 Bacteria 6801
206 Ga0316577_10125305 3300031733 Bacteria 1444
207 Ga0316577_10409906 3300031733 Bacteria 770
208 Ga0316577_10588845 3300031733 Bacteria 633
209 Ga0316577_10736465 3300031733 Bacteria 560
210 Ga0307406_10373624 3300031901 Bacteria 1122
211 Ga0307406_11310746 3300031901 Bacteria 632
212 Ga0316583_10001329 3300032133 Bacteria 8173
213 Ga0316583_10008644 3300032133 Bacteria 3674
214 Ga0316583_10014812 3300032133 Bacteria 2807
215 Ga0316585_10005159 3300032137 Bacteria 3676
216 Ga0316585_10033327 3300032137 Unclassified 1625
217 Ga0316585_10137608 3300032137 Bacteria 806
218 Ga0316580_10008553 3300032139 Bacteria 3067
219 Ga0316580_10170032 3300032139 Bacteria 670
220 Ga0316593_10000345 3300032168 Bacteria 8083
221 Ga0316593_10001515 3300032168 Bacteria 5148
222 Ga0316593_10003433 3300032168 Bacteria 3931
223 Ga0316593_10004060 3300032168 Bacteria 3711
224 Ga0316593_10018193 3300032168 Bacteria 2156
225 Ga0316593_10022461 3300032168 Bacteria 1982
226 Ga0316593_10029807 3300032168 Bacteria 1767
227 Ga0316593_10036843 3300032168 Bacteria 1614
228 Ga0316593_10037270 3300032168 Bacteria 1606
229 Ga0316593_10040218 3300032168 Bacteria 1553
230 Ga0316593_10154046 3300032168 Bacteria 837
231 Ga0316593_10161338 3300032168 Bacteria 819
232 Ga0316593_10198468 3300032168 Bacteria 741
233 Ga0316593_10257227 3300032168 Unclassified 654
234 Ga0316593_10335790 3300032168 Bacteria 576
235 Ga0316592_1034341 3300033524 Bacteria 1111
236 Ga0316592_1080847 3300033524 Bacteria 739
237 Ga0316592_1082464 3300033524 Bacteria 732
238 Ga0316592_1113972 3300033524 Bacteria 626
239 Ga0316586_1018063 3300033527 Bacteria 1142
240 Ga0316586_1042520 3300033527 Bacteria 802
241 Ga0316587_1003290 3300033529 Bacteria 2252
242 Ga0316587_1016312 3300033529 Bacteria 1239
243 Ga0316587_1019263 3300033529 Bacteria 1153
244 Ga0316587_1034286 3300033529 Unclassified 904
245 Ga0316587_1076451 3300033529 Bacteria 630
246 Ga0316596_1004197 3300033541 Bacteria 3215
247 Ga0316596_1013472 3300033541 Bacteria 2020
248 Ga0316596_1021541 3300033541 Bacteria 1644
249 Ga0316596_1033363 3300033541 Bacteria 1341
250 Ga0316596_1068036 3300033541 Bacteria 953
251 Ga0316596_1103726 3300033541 Bacteria 770
252 Ga0316596_1190965 3300033541 Unclassified 568
253 Ga0316596_1225473 3300033541 Bacteria 525
254 Ga0373929_0081156 3300035085 Bacteria 791
255 Ga0373949_0047606 3300035090 Unclassified 1072
256 Ga0373951_0077579 3300035091 Bacteria 855
257 Ga0373942_0067284 3300035207 Bacteria 1039
258 Ga0373962_0245218 3300035242 Bacteria 620
259 Ga0316574_0002542 3300035398 Bacteria 9175
260 Ga0316574_0005038 3300035398 Bacteria 7014
261 Ga0316574_0014130 3300035398 Bacteria 4606
262 Ga0316574_0046962 3300035398 Bacteria 2679
263 Ga0316574_0049859 3300035398 Bacteria 2604
264 Ga0316574_0055736 3300035398 Bacteria 2471
265 Ga0316574_0057374 3300035398 Bacteria 2437
266 Ga0316574_0066255 3300035398 Bacteria 2275
267 Ga0316574_0195744 3300035398 Bacteria 1299
268 Ga0316574_0240316 3300035398 Bacteria 1158
269 Ga0316574_0264065 3300035398 Bacteria 1099
270 Ga0316574_0358279 3300035398 Bacteria 922
271 Ga0316574_0387925 3300035398 Bacteria 880
272 Ga0316574_0480236 3300035398 Bacteria 776
273 Ga0316574_0769001 3300035398 Bacteria 588
274 Ga0316574_0833307 3300035398 Bacteria 560
275 Ga0373935_0267843 3300035692 Bacteria 1200
276 Ga0373935_0444775 3300035692 Bacteria 936
277 Ga0373937_0165155 3300036401 Bacteria 2076
278 Ga0316582_0005358 3300036647 Bacteria 6596
279 Ga0316582_0005359 3300036647 Bacteria 6596
280 Ga0316582_0020502 3300036647 Bacteria 3888
281 Ga0316582_0024048 3300036647 Bacteria 3639
282 Ga0316582_0037669 3300036647 Bacteria 3000
283 Ga0316582_0042670 3300036647 Bacteria 2842
284 Ga0316582_0066972 3300036647 Bacteria 2316
285 Ga0316582_0216535 3300036647 Bacteria 1309
286 Ga0316582_0223350 3300036647 Bacteria 1288
287 Ga0316582_0436017 3300036647 Bacteria 903
288 Ga0316582_0466669 3300036647 Bacteria 870
289 Ga0316582_0782315 3300036647 Bacteria 654
290 Ga0316584_0001174 3300036712 Bacteria 15465
291 Ga0316584_0005399 3300036712 Bacteria 8575
292 Ga0316584_0019918 3300036712 Bacteria 4855
293 Ga0316584_0062445 3300036712 Bacteria 2790
294 Ga0316584_0091456 3300036712 Bacteria 2278
295 Ga0316584_0129811 3300036712 Bacteria 1882
296 Ga0316584_0190192 3300036712 Bacteria 1518
297 Ga0316584_0374340 3300036712 Bacteria 1019
298 Ga0316584_0547524 3300036712 Bacteria 808
299 Ga0316584_0939823 3300036712 Bacteria 580
300 Ga0395899_0118794 3300037312 Bacteria 1895
301 Ga0395900_0092766 3300037418 Bacteria 3102
302 Ga0395898_0104233 3300037466 Bacteria 2720
303 Ga0395898_0108757 3300037466 Bacteria 2658
304 Ga0316581_0006328 3300037588 Bacteria 3127
305 Ga0316581_0022326 3300037588 Bacteria 1866
306 Ga0316581_0081819 3300037588 Bacteria 993
307 Ga0395901_0193531 3300038443 Bacteria 2132
308 Ga0395901_0836981 3300038443 Bacteria 906
309 Ga0395901_1449899 3300038443 Bacteria 644
310 Ga0400490_11186 3300038726 Bacteria 1330
311 Ga0436361_0240934 3300039447 Bacteria 1124
312 Ga0436363_0763569 3300039450 Bacteria 579
313 Ga0451798_0108112 3300041458 Bacteria 626
314 Ga0451837_0495108 3300041494 Bacteria 545
315 Ga0439448_0056592 3300042005 Bacteria 1291
316 Ga0495586_0764275 3300046535 Bacteria 558
317 Ga0495687_052817 3300047443 Bacteria 1716
318 Ga0495602_0576140 3300048088 Bacteria 777
319 Ga0496112_0780545 3300048915 Bacteria 881
320 Ga0496117_0032224 3300048920 Bacteria 3985
321 Ga0496118_0013427 3300048921 Bacteria 7749
322 Ga0496121_0174671 3300048924 Bacteria 1557
323 Ga0496122_0004318 3300048925 Bacteria 17801
324 Ga0496123_0000663 3300048926 Bacteria 56880
325 Ga0496125_0297607 3300048928 Bacteria 990
326 Ga0501309_066956 3300049129 Bacteria 585
327 Ga0501316_003818 3300049532 Bacteria 1486
328 Ga0501323_069296 3300049539 Bacteria 562
329 Ga0501031_0074482 3300049568 Bacteria 2211
330 Ga0501031_0451350 3300049568 Bacteria 830
331 Ga0501032_0018233 3300049569 Bacteria 4920
332 Ga0501033_0004952 3300049570 Bacteria 10593
333 Ga0501034_0006481 3300049571 Bacteria 12599
334 Ga0501034_0179934 3300049571 Bacteria 2079
335 Ga0501034_1156278 3300049571 Bacteria 653
336 Ga0501036_0087307 3300049572 Bacteria 2636
337 Ga0501037_0004546 3300049573 Bacteria 10091
338 Ga0501038_0002932 3300049574 Bacteria 15916
339 Ga0501039_0069605 3300049575 Bacteria 2733
340 Ga0501039_0183546 3300049575 Bacteria 1645
341 Ga0501042_0214559 3300049578 Bacteria 1388
342 Ga0501043_0003530 3300049579 Bacteria 12855
343 Ga0501043_0369796 3300049579 Unclassified 1087
344 Ga0501046_0116185 3300049580 Bacteria 2040
345 Ga0501046_0334999 3300049580 Bacteria 1100
346 Ga0501047_0083839 3300049581 Bacteria 3063
347 Ga0501047_0623036 3300049581 Bacteria 899
348 Ga0501067_0089711 3300049583 Bacteria 1706
349 Ga0501068_0259058 3300049584 Bacteria 1109
350 Ga0501070_0106816 3300049586 Bacteria 2314
351 Ga0501071_0162263 3300049587 Unclassified 1671
352 Ga0501071_0556364 3300049587 Unclassified 881
353 Ga0501072_0127259 3300049588 Bacteria 2030
354 Ga0501073_0004438 3300049589 Bacteria 10542
355 Ga0501073_0346392 3300049589 Bacteria 1026
356 Ga0501074_0600001 3300049590 Bacteria 779
357 Ga0501075_0045724 3300049591 Bacteria 3287
358 Ga0501076_0354912 3300049592 Bacteria 1204
359 Ga0501076_1212808 3300049592 Bacteria 621
360 Ga0501239_093124 3300049672 Bacteria 500
361 Ga0501079_0744271 3300049741 Bacteria 772
362 Ga0501080_0002320 3300049742 Bacteria 16608
363 Ga0501080_0301051 3300049742 Unclassified 1454
364 Ga0501083_0070503 3300049744 Bacteria 2324
365 Ga0501035_0008347 3300049822 Bacteria 9641
366 Ga0501044_0013320 3300049823 Bacteria 8900
367 Ga0501045_0206165 3300049824 Bacteria 1465
368 nmdc:mga03683_25760_c1 3300050489 Bacteria 1807
369 nmdc:mga00v17_234498_c1 3300050491 Bacteria 1189
370 nmdc:mga00v17_42921_c1 3300050491 Bacteria 2721
371 nmdc:mga0yw44_630888_c1 3300050492 Bacteria 728
372 nmdc:mga07m45_87185_c1 3300050496 Bacteria 1786
373 nmdc:mga05p37_618576_c1 3300050507 Unclassified 1219
374 nmdc:mga09592_234658_c1 3300050508 Bacteria 1589
375 nmdc:mga09592_54513_c1 3300050508 Bacteria 3378
376 nmdc:mga0qj67_34689_c1 3300050509 Bacteria 3942
377 nmdc:mga0qj67_539853_c1 3300050509 Bacteria 936
378 nmdc:mga0qj67_70121_c1 3300050509 Bacteria 2796
379 nmdc:mga06r32_108783_c1 3300050510 Bacteria 2726
380 nmdc:mga06r32_360909_c1 3300050510 Bacteria 1437
381 Ga0500652_326091 3300053131 Bacteria 587
382 Ga0500573_0396507 3300053140 Bacteria 655
383 Ga0500609_022757 3300053731 Bacteria 858
384 Ga0501084_0027130 3300054114 Bacteria 4786
385 Ga0590077_050866 3300059426 Unclassified 930
386 Ga0587070_236336 3300059491 Bacteria 502
387 Ga0587082_074319 3300059504 Bacteria 697
388 Ga0587083_0182340 3300059505 Bacteria 588
389 Ga0587085_180302 3300059506 Bacteria 506
390 Ga0587075_054286 3300059644 Bacteria 707
391 Ga0587107_063434 3300059652 Bacteria 657
392 Ga0587111_0268496 3300060346 Bacteria 511
393 Ga0501082_0011155 3300060353 Bacteria 7725
394 2939673352 2939669807 Bacteria 5028511
395 Ga0316582_0379397
396 JGI24740J21852_10015904
397 JGI24739J22299_10053974
398 JGI24737J22298_10037836
399 JGI24735J21928_10020070
400 Ga0070658_11919384
401 Ga0070683_100064576
402 Ga0070683_100111804
403 Ga0070683_100414968
404 Ga0068869_100408701
405 Ga0070680_100166531
406 Ga0070682_101462679
407 Ga0070660_100467933
408 Ga0070661_100433751
409 Ga0070661_100568515
410 Ga0070661_101162253
411 Ga0070668_100003149
412 Ga0070669_100058367
413 Ga0070667_100040046
414 Ga0070713_101122552
415 Ga0070711_100000849
416 Ga0070663_100523521
417 Ga0070662_100125704
418 Ga0070662_100163470
419 Ga0070681_10061754
420 Ga0070679_100603659
421 Ga0070679_101455968
422 Ga0070684_100789105
423 Ga0070693_100544973
424 Ga0068855_100002453
425 Ga0068855_100757609
426 Ga0070664_100069259
427 Ga0070664_100176318
428 Ga0070664_100386382
429 Ga0068857_100712905
430 Ga0068857_101039271
431 Ga0068854_100179208
432 Ga0068854_100380100
433 Ga0068854_100625684
434 Ga0068856_100387096
435 Ga0068856_101760938
436 Ga0068852_100208257
437 Ga0068852_102565404
438 Ga0068852_102565661
439 Ga0068859_101215924
440 Ga0068851_10067497
441 Ga0068860_100447586
442 Ga0068862_100029176
443 Ga0081539_10145152
444 Ga0075364_10456894
445 Ga0070712_100086748
446 Ga0068871_100150144
447 Ga0075431_100073040
448 Ga0075431_100363579
449 Ga0075429_100050775
450 Ga0075429_100272588
451 Ga0075429_101895443
452 Ga0097620_101215907
453 Ga0105240_10022660
454 Ga0105245_10749604
455 Ga0114129_10367483
456 Ga0105242_12673553
457 Ga0105238_10053133
458 Ga0105238_10968927
459 Ga0105249_10508792
460 Ga0105239_10160109
461 Ga0105239_11124704
462 Ga0105246_12339706
463 Ga0157371_11442842
464 Ga0157370_10191789
465 Ga0157370_10216568
466 Ga0157369_11337904
467 Ga0182008_10176566
468 Ga0157376_10414243
469 Ga0182005_1003539
470 Ga0206356_10180588
471 Ga0206352_11136308
472 Ga0206354_10279941
473 Ga0206354_11400852
474 Ga0206353_10631927
475 Ga0224712_10138363
476 Ga0209025_1086987
477 Ga0207656_10430824
478 Ga0207682_10062659
479 Ga0207692_10288117
480 Ga0207692_10329852
481 Ga0207647_10085458
482 Ga0207685_10360726
483 Ga0207705_10019962
484 Ga0207705_10199325
485 Ga0207654_10263764
486 Ga0207707_10175420
487 Ga0207707_10851788
488 Ga0207707_11196273
489 Ga0207695_10005515
490 Ga0207695_10191472
491 Ga0207671_10690658
492 Ga0207693_10095647
493 Ga0207663_10007398
494 Ga0207663_10137476
495 Ga0207660_10075973
496 Ga0207660_10255760
497 Ga0207657_10032432
498 Ga0207657_10134247
499 Ga0207657_10138940
500 Ga0207649_10038292
501 Ga0207649_10748201
502 Ga0207649_11207020
503 Ga0207652_10263986
504 Ga0207652_11097072
505 Ga0207681_10042919
506 Ga0207681_10828013
507 Ga0207694_10631797
508 Ga0207694_10914112
509 Ga0207694_11213466
510 Ga0207659_10118435
511 Ga0207659_10777781
512 Ga0207659_11138311
513 Ga0207687_11479749
514 Ga0207690_10276620
515 Ga0207690_10975622
516 Ga0207706_10063755
517 Ga0207670_11038480
518 Ga0207691_10658816
519 Ga0207691_11216227
520 Ga0207711_10317932
521 Ga0207711_10429534
522 Ga0207711_11402457
523 Ga0207661_10057487
524 Ga0207661_10564158
525 Ga0207679_10111990
526 Ga0207679_10148737
527 Ga0207679_10327457
528 Ga0207667_10011655
529 Ga0207667_10169864
530 Ga0207667_10457700
531 Ga0207667_10549004
532 Ga0207651_10966877
533 Ga0207712_11355426
534 Ga0207668_10000951
535 Ga0207668_10033370
536 Ga0207640_10127474
537 Ga0207640_10164638
538 Ga0207640_11127256
539 Ga0207640_11738905
540 Ga0207658_10018162
541 Ga0207658_10222079
542 Ga0207658_10595655
543 Ga0207703_11334631
544 Ga0207639_10564467
545 Ga0207639_11014135
546 Ga0207639_11639130
547 Ga0207678_10167760
548 Ga0207678_10581666
549 Ga0207678_10938140
550 Ga0207702_10192338
551 Ga0207702_10250865
552 Ga0207702_11196590
553 Ga0207674_10100903
554 Ga0207674_10563657
555 Ga0207683_10068214
556 Ga0207683_10688535
557 Ga0207698_10004358
558 Ga0207698_10046268
559 Ga0207698_10533698
560 Ga0207698_10727785
561 Ga0209983_1132861
562 Ga0268266_10044828
563 Ga0268266_10063853
564 Ga0268266_10997469
565 Ga0268265_10068003
566 Ga0268265_10374250
567 Ga0268264_10913934
568 Ga0268264_11699389
569 Ga0265338_10908791
570 Ga0265332_10230985
571 Ga0265327_10000567
572 Ga0307408_100999979
573 Ga0316575_10014513
574 Ga0316575_10031217
575 Ga0316575_10044781
576 Ga0316575_10093259
577 Ga0316575_10109094
578 Ga0316575_10109925
579 Ga0316575_10138499
580 Ga0316575_10182970
581 Ga0316579_10000774
582 Ga0316579_10001634
583 Ga0316579_10006095
584 Ga0316579_10576729
585 Ga0265342_10054963
586 Ga0316576_10012781
587 Ga0316576_10029603
588 Ga0316576_10059781
589 Ga0316576_10088252
590 Ga0316576_10115395
591 Ga0316576_10238416
592 Ga0316576_10278378
593 Ga0316578_10012423
594 Ga0316578_10013092
595 Ga0316578_10035121
596 Ga0316578_10253531
597 Ga0316578_10417372
598 Ga0316577_10005044
599 Ga0316577_10005199
600 Ga0316577_10125305
601 Ga0316577_10409906
602 Ga0316577_10588845
603 Ga0316577_10736465
604 Ga0307406_10373624
605 Ga0307406_11310746
606 Ga0316583_10001329
607 Ga0316583_10008644
608 Ga0316583_10014812
609 Ga0316585_10005159
610 Ga0316585_10033327
611 Ga0316585_10137608
612 Ga0316580_10008553
613 Ga0316580_10170032
614 Ga0316593_10000345
615 Ga0316593_10001515
616 Ga0316593_10003433
617 Ga0316593_10004060
618 Ga0316593_10018193
619 Ga0316593_10022461
620 Ga0316593_10029807
621 Ga0316593_10036843
622 Ga0316593_10037270
623 Ga0316593_10040218
624 Ga0316593_10154046
625 Ga0316593_10161338
626 Ga0316593_10198468
627 Ga0316593_10257227
628 Ga0316593_10335790
629 Ga0316592_1034341
630 Ga0316592_1080847
631 Ga0316592_1082464
632 Ga0316592_1113972
633 Ga0316586_1018063
634 Ga0316586_1042520
635 Ga0316587_1003290
636 Ga0316587_1016312
637 Ga0316587_1019263
638 Ga0316587_1034286
639 Ga0316587_1076451
640 Ga0316596_1004197
641 Ga0316596_1013472
642 Ga0316596_1021541
643 Ga0316596_1033363
644 Ga0316596_1068036
645 Ga0316596_1103726
646 Ga0316596_1190965
647 Ga0316596_1225473
648 Ga0373929_0081156
649 Ga0373949_0047606
650 Ga0373951_0077579
651 Ga0373942_0067284
652 Ga0373962_0245218
653 Ga0316574_0002542
654 Ga0316574_0005038
655 Ga0316574_0014130
656 Ga0316574_0046962
657 Ga0316574_0049859
658 Ga0316574_0055736
659 Ga0316574_0057374
660 Ga0316574_0066255
661 Ga0316574_0195744
662 Ga0316574_0240316
663 Ga0316574_0264065
664 Ga0316574_0358279
665 Ga0316574_0387925
666 Ga0316574_0480236
667 Ga0316574_0769001
668 Ga0316574_0833307
669 Ga0373935_0267843
670 Ga0373935_0444775
671 Ga0373937_0165155
672 Ga0316582_0005358
673 Ga0316582_0005359
674 Ga0316582_0020502
675 Ga0316582_0024048
676 Ga0316582_0037669
677 Ga0316582_0042670
678 Ga0316582_0066972
679 Ga0316582_0216535
680 Ga0316582_0223350
681 Ga0316582_0436017
682 Ga0316582_0466669
683 Ga0316582_0782315
684 Ga0316584_0001174
685 Ga0316584_0005399
686 Ga0316584_0019918
687 Ga0316584_0062445
688 Ga0316584_0091456
689 Ga0316584_0129811
690 Ga0316584_0190192
691 Ga0316584_0374340
692 Ga0316584_0547524
693 Ga0316584_0939823
694 Ga0395899_0118794
695 Ga0395900_0092766
696 Ga0395898_0104233
697 Ga0395898_0108757
698 Ga0316581_0006328
699 Ga0316581_0022326
700 Ga0316581_0081819
701 Ga0395901_0193531
702 Ga0395901_0836981
703 Ga0395901_1449899
704 Ga0400490_11186
705 Ga0436361_0240934
706 Ga0436363_0763569
707 Ga0451798_0108112
708 Ga0451837_0495108
709 Ga0439448_0056592
710 Ga0495586_0764275
711 Ga0495687_052817
712 Ga0495602_0576140
713 Ga0496112_0780545
714 Ga0496117_0032224
715 Ga0496118_0013427
716 Ga0496121_0174671
717 Ga0496122_0004318
718 Ga0496123_0000663
719 Ga0496125_0297607
720 Ga0501309_066956
721 Ga0501316_003818
722 Ga0501323_069296
723 Ga0501031_0074482
724 Ga0501031_0451350
725 Ga0501032_0018233
726 Ga0501033_0004952
727 Ga0501034_0006481
728 Ga0501034_0179934
729 Ga0501034_1156278
730 Ga0501036_0087307
731 Ga0501037_0004546
732 Ga0501038_0002932
733 Ga0501039_0069605
734 Ga0501039_0183546
735 Ga0501042_0214559
736 Ga0501043_0003530
737 Ga0501043_0369796
738 Ga0501046_0116185
739 Ga0501046_0334999
740 Ga0501047_0083839
741 Ga0501047_0623036
742 Ga0501067_0089711
743 Ga0501068_0259058
744 Ga0501070_0106816
745 Ga0501071_0162263
746 Ga0501071_0556364
747 Ga0501072_0127259
748 Ga0501073_0004438
749 Ga0501073_0346392
750 Ga0501074_0600001
751 Ga0501075_0045724
752 Ga0501076_0354912
753 Ga0501076_1212808
754 Ga0501239_093124
755 Ga0501079_0744271
756 Ga0501080_0002320
757 Ga0501080_0301051
758 Ga0501083_0070503
759 Ga0501035_0008347
760 Ga0501044_0013320
761 Ga0501045_0206165
762 nmdc:mga03683_25760_c1
763 nmdc:mga00v17_234498_c1
764 nmdc:mga00v17_42921_c1
765 nmdc:mga0yw44_630888_c1
766 nmdc:mga07m45_87185_c1
767 nmdc:mga05p37_618576_c1
768 nmdc:mga09592_234658_c1
769 nmdc:mga09592_54513_c1
770 nmdc:mga0qj67_34689_c1
771 nmdc:mga0qj67_539853_c1
772 nmdc:mga0qj67_70121_c1
773 nmdc:mga06r32_108783_c1
774 nmdc:mga06r32_360909_c1
775 Ga0500652_326091
776 Ga0500573_0396507
777 Ga0500609_022757
778 Ga0501084_0027130
779 Ga0590077_050866
780 Ga0587070_236336
781 Ga0587082_074319
782 Ga0587083_0182340
783 Ga0587085_180302
784 Ga0587075_054286
785 Ga0587107_063434
786 Ga0587111_0268496
787 Ga0501082_0011155
788 2939673352

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00312

Ribosomal_S15

Ribosomal protein S15

25

105

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cdu-assembly1.cif.gz_O rnase r bound to a 30s degradation intermediate (main state) 0.9944 4 88
7nhn-assembly1.cif.gz_p vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9941 3 88
7p7u-assembly1.cif.gz_p e. faecalis 70s ribosome with p-trna, state iv 0.9931 4 88
7p7t-assembly1.cif.gz_p poxta-eq2 antibiotic resistance abcf bound to e. faecalis 70s ribosome, state iii 0.9926 4 88
7p7q-assembly1.cif.gz_p e. faecalis 70s ribosome bound by poxta-eq2, high-resolution combined volume 0.9924 4 88
ID Description Score Start End Superfamily
4dr7O00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding 0.9776 3 89 1.10.287.10
4ji4O00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding 0.9767 3 88 1.10.287.10
6az1T02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding 0.9763 29 72 1.10.287.10
1iblO00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding 0.9749 3 89 1.10.287.10
4dv5O00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding 0.9748 3 88 1.10.287.10
ID Description Score Start End GO Terms
AF-A1UU53-F1-model_v4 Small ribosomal subunit protein uS15 (30S ribosomal protein S15) 1.001 1 89 GO:0003735
GO:0006412
GO:0019843
GO:0022627
AF-A0A2L1SBK9-F1-model_v4 Small ribosomal subunit protein uS15 1.001 2 89 GO:0003735
GO:0006412
GO:0019843
GO:0022627
AF-A1R524-F1-model_v4 Small ribosomal subunit protein uS15 (30S ribosomal protein S15) 1.001 1 89 GO:0003735
GO:0006412
GO:0019843
GO:0022627
AF-A0A3T0EDH2-F1-model_v4 Small ribosomal subunit protein uS15 1 2 89 GO:0003735
GO:0006412
GO:0019843
GO:0022627
AF-A0A4R1BHH2-F1-model_v4 Small ribosomal subunit protein uS15 1 6 89 GO:0003735
GO:0006412
GO:0019843
GO:0022627

Map