F432891

General Info

Members Datasets Scaffolds Average Seq Length
394 223 788 400

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10162786|Ga0157369_101627862
Length 470
Sequence MKESMTVVATTTLVFVDTDESAKKVRSLLLRAQSIHFIDNAPTTLLTLTYRLEGRPLKIGNNVPFPPVEQQLTYLKKGLADLIREEDLRERLTQSLKANRPLRVKAGFDPTAPDLHLGHTVLLRKMKHFQDLGHTVIFLIGDMTGLIGDPTGRNLTRPPMTREDLNLNAETYKRQVFKILDPEKTEIRFNSEWLEGLTFENIVRLCSRYTLARLMERNDFTNRFKENIPISVHELLYPLTQAYDSVALKCDVEMGGTDQTTNLLVGREIQKDYGQPPQIVATVPILEGLDGVEKMSKSKGNYIGITEPPKVMFRKVMQISDDLMYRYYELLTDVSMAEIAQLRSDIAAGSQNPMEAKMSLARRIVTDFHSDEEACAAHEAFDREVRQGLEPADTETVDLPPTASTEKGIRVDKLVAGVGLTASVNDAVRKIKSGAVEIDGRIQNDLLCTEPASMLVLRVGKKWKRVRIHT

Samples

Sample ID Description Type Environment
1 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
99 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
102 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
103 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
104 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
105 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
161 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
162 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
163 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
164 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
165 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
166 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
167 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
168 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
169 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
170 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
171 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
172 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
173 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
174 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
175 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
178 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
179 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
182 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
183 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
184 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
185 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
186 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
187 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
188 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
189 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
190 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
191 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
192 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
193 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
194 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
195 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
196 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
197 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
201 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
205 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
206 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
207 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
208 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
211 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
212 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
213 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
216 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
217 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
218 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
219 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
220 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
221 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
222 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
223 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.03
Nodule 0
Rhizoplane 1.52
Rhizosphere 91.62
Stem 0
Stem Tuber 0
Unclassified 0.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157369_10162786 3300013105 Bacteria 2354
2 LJNas_1001998 3300000546 Bacteria 2616
3 Ga0065715_10103563 3300005293 Bacteria 3025
4 Ga0070658_10016230 3300005327 Bacteria 5959
5 Ga0070690_100117669 3300005330 Bacteria 1780
6 Ga0070680_100001987 3300005336 Bacteria 15051
7 Ga0070680_100003490 3300005336 Bacteria 11739
8 Ga0070680_100155810 3300005336 Bacteria 1919
9 Ga0068868_100278516 3300005338 Bacteria 1415
10 Ga0070660_100144586 3300005339 Bacteria 1909
11 Ga0070660_100302185 3300005339 Bacteria 1312
12 Ga0070689_100072329 3300005340 Bacteria 2695
13 Ga0070689_100076431 3300005340 Bacteria 2623
14 Ga0070691_10000567 3300005341 Bacteria 14113
15 Ga0070687_100008436 3300005343 Bacteria 4366
16 Ga0070661_100019156 3300005344 Bacteria 4874
17 Ga0070661_100190925 3300005344 Bacteria 1562
18 Ga0070668_100128040 3300005347 Bacteria 2035
19 Ga0070675_100149566 3300005354 Bacteria 2001
20 Ga0070688_100031305 3300005365 Bacteria 3200
21 Ga0070688_100062625 3300005365 Bacteria 2355
22 Ga0070659_100022195 3300005366 Bacteria 4843
23 Ga0070659_100071951 3300005366 Bacteria 2751
24 Ga0070667_100152566 3300005367 Bacteria 2030
25 Ga0070709_10012901 3300005434 Bacteria 4684
26 Ga0070713_100000704 3300005436 Bacteria 21470
27 Ga0070713_100019436 3300005436 Bacteria 5187
28 Ga0070713_100063100 3300005436 Bacteria 3105
29 Ga0070713_100072904 3300005436 Bacteria 2905
30 Ga0070710_10011633 3300005437 Bacteria 4352
31 Ga0070701_10058294 3300005438 Bacteria 2026
32 Ga0070711_100000276 3300005439 Bacteria 26659
33 Ga0070711_100013607 3300005439 Bacteria 5112
34 Ga0070711_100053057 3300005439 Bacteria 2793
35 Ga0070700_100025213 3300005441 Bacteria 3500
36 Ga0070694_100088806 3300005444 Bacteria 2165
37 Ga0070708_100064272 3300005445 Bacteria 3287
38 Ga0070663_100004381 3300005455 Bacteria 8287
39 Ga0070681_10017703 3300005458 Bacteria 7121
40 Ga0070681_10025510 3300005458 Bacteria 5945
41 Ga0070681_10083819 3300005458 Bacteria 3140
42 Ga0070681_10352501 3300005458 Bacteria 1382
43 Ga0068867_100046004 3300005459 Bacteria 3203
44 Ga0070685_10114884 3300005466 Bacteria 1664
45 Ga0070706_100022256 3300005467 Bacteria 5836
46 Ga0070706_100134433 3300005467 Bacteria 2309
47 Ga0070706_100263607 3300005467 Bacteria 1608
48 Ga0070707_100062306 3300005468 Bacteria 3578
49 Ga0070698_100003118 3300005471 Bacteria 18281
50 Ga0070698_100230891 3300005471 Bacteria 1783
51 Ga0070699_100013591 3300005518 Bacteria 7008
52 Ga0070679_100001380 3300005530 Bacteria 21432
53 Ga0070679_100127442 3300005530 Bacteria 2527
54 Ga0070684_100002491 3300005535 Bacteria 13561
55 Ga0070684_100013842 3300005535 Bacteria 6515
56 Ga0070684_100029329 3300005535 Bacteria 4661
57 Ga0070684_100062925 3300005535 Bacteria 3251
58 Ga0068853_100042951 3300005539 Bacteria 3867
59 Ga0068853_100071854 3300005539 Bacteria 3014
60 Ga0070686_100227357 3300005544 Bacteria 1351
61 Ga0070695_100055336 3300005545 Bacteria 2556
62 Ga0070695_100126126 3300005545 Bacteria 1758
63 Ga0070696_100004170 3300005546 Bacteria 9631
64 Ga0070665_100117025 3300005548 Bacteria 2668
65 Ga0070704_100083402 3300005549 Bacteria 2359
66 Ga0068855_100008970 3300005563 Bacteria 12087
67 Ga0068855_100050475 3300005563 Bacteria 4902
68 Ga0068855_100053082 3300005563 Bacteria 4770
69 Ga0068855_100053485 3300005563 Bacteria 4750
70 Ga0070664_100029544 3300005564 Bacteria 4570
71 Ga0070664_100343488 3300005564 Bacteria 1356
72 Ga0068857_100001369 3300005577 Bacteria 19207
73 Ga0068857_100099515 3300005577 Bacteria 2608
74 Ga0068857_100404199 3300005577 Bacteria 1271
75 Ga0068854_100141622 3300005578 Bacteria 1846
76 Ga0068856_100014164 3300005614 Bacteria 7711
77 Ga0068856_100015818 3300005614 Bacteria 7295
78 Ga0068856_100182358 3300005614 Bacteria 2113
79 Ga0068852_100006486 3300005616 Bacteria 8458
80 Ga0068852_100060525 3300005616 Bacteria 3287
81 Ga0068859_100012410 3300005617 Bacteria 8572
82 Ga0068859_100083021 3300005617 Bacteria 3246
83 Ga0068864_100379576 3300005618 Bacteria 1339
84 Ga0068861_100069331 3300005719 Bacteria 2727
85 Ga0068863_100033235 3300005841 Bacteria 4914
86 Ga0068863_100037844 3300005841 Bacteria 4592
87 Ga0068858_100007723 3300005842 Bacteria 10379
88 Ga0068858_100159569 3300005842 Bacteria 2123
89 Ga0068858_100184627 3300005842 Bacteria 1970
90 Ga0068860_100198878 3300005843 Bacteria 1942
91 Ga0068862_100075025 3300005844 Bacteria 2924
92 Ga0081539_10024825 3300005985 Bacteria 3876
93 Ga0070717_10005102 3300006028 Bacteria 9577
94 Ga0070717_10068687 3300006028 Bacteria 2950
95 Ga0075364_10014397 3300006051 Bacteria 4886
96 Ga0070715_10007977 3300006163 Bacteria 3669
97 Ga0070712_100000123 3300006175 Bacteria 40899
98 Ga0070712_100165865 3300006175 Bacteria 1710
99 Ga0075367_10074890 3300006178 Bacteria 2041
100 Ga0075367_10080038 3300006178 Bacteria 1976
101 Ga0075366_10004597 3300006195 Bacteria 7416
102 Ga0097621_100029935 3300006237 Bacteria 4304
103 Ga0075370_10054643 3300006353 Bacteria 2268
104 Ga0068871_100043032 3300006358 Bacteria 3627
105 Ga0075428_100000340 3300006844 Bacteria 46263
106 Ga0075428_100208067 3300006844 Bacteria 2114
107 Ga0075428_100258649 3300006844 Bacteria 1875
108 Ga0075428_100368035 3300006844 Bacteria 1542
109 Ga0075430_100012374 3300006846 Bacteria 7258
110 Ga0075431_100010386 3300006847 Bacteria 9357
111 Ga0075431_100028993 3300006847 Bacteria 5693
112 Ga0075431_100073155 3300006847 Bacteria 3536
113 Ga0075433_10000396 3300006852 Bacteria 27734
114 Ga0075434_100000839 3300006871 Bacteria 24421
115 Ga0075434_100029348 3300006871 Bacteria 5410
116 Ga0075434_100239155 3300006871 Bacteria 1836
117 Ga0075429_100027392 3300006880 Bacteria 4946
118 Ga0075429_100084081 3300006880 Bacteria 2774
119 Ga0075429_100159148 3300006880 Bacteria 1977
120 Ga0068865_100241164 3300006881 Bacteria 1422
121 Ga0075436_100017885 3300006914 Bacteria 4854
122 Ga0075436_100026399 3300006914 Bacteria 4000
123 Ga0097620_100012411 3300006931 Bacteria 8572
124 Ga0097620_100083025 3300006931 Bacteria 3246
125 Ga0075435_100000861 3300007076 Bacteria 18993
126 Ga0075435_100019776 3300007076 Bacteria 5150
127 Ga0105240_10045301 3300009093 Bacteria 5581
128 Ga0105240_10065707 3300009093 Bacteria 4502
129 Ga0105240_10375632 3300009093 Bacteria 1606
130 Ga0111539_10011908 3300009094 Bacteria 10904
131 Ga0111539_10039319 3300009094 Bacteria 5703
132 Ga0111539_10070946 3300009094 Bacteria 4111
133 Ga0111539_10244610 3300009094 Bacteria 2088
134 Ga0105247_10031172 3300009101 Bacteria 3235
135 Ga0114129_10070061 3300009147 Bacteria 4889
136 Ga0114129_10074668 3300009147 Bacteria 4723
137 Ga0114129_10106754 3300009147 Bacteria 3868
138 Ga0114129_10166857 3300009147 Bacteria 3004
139 Ga0114129_10377235 3300009147 Bacteria 1874
140 Ga0114129_10377667 3300009147 Bacteria 1872
141 Ga0105243_10005426 3300009148 Bacteria 9951
142 Ga0105241_10082344 3300009174 Bacteria 2522
143 Ga0105241_10096351 3300009174 Bacteria 2344
144 Ga0105242_10072705 3300009176 Bacteria 2857
145 Ga0105248_10007643 3300009177 Bacteria 11878
146 Ga0105248_10031422 3300009177 Bacteria 5936
147 Ga0105248_10222162 3300009177 Bacteria 2127
148 Ga0105248_10264162 3300009177 Bacteria 1937
149 Ga0105237_10004649 3300009545 Bacteria 15812
150 Ga0105237_10005592 3300009545 Bacteria 14168
151 Ga0105237_10038432 3300009545 Bacteria 4832
152 Ga0105238_10032671 3300009551 Bacteria 5296
153 Ga0105238_10090839 3300009551 Bacteria 3041
154 Ga0105238_10256184 3300009551 Bacteria 1729
155 Ga0105249_10043407 3300009553 Bacteria 4088
156 Ga0105239_10004784 3300010375 Bacteria 16067
157 Ga0105239_10005176 3300010375 Bacteria 15373
158 Ga0105239_10006434 3300010375 Bacteria 13623
159 Ga0105246_10107346 3300011119 Bacteria 2044
160 Ga0105246_10200809 3300011119 Bacteria 1550
161 Ga0157371_10179349 3300013102 Bacteria 1515
162 Ga0157370_10013184 3300013104 Bacteria 8524
163 Ga0157370_10022923 3300013104 Bacteria 6206
164 Ga0157370_10041633 3300013104 Bacteria 4429
165 Ga0157370_10043091 3300013104 Bacteria 4345
166 Ga0157369_10002025 3300013105 Bacteria 24446
167 Ga0157369_10021826 3300013105 Bacteria 7159
168 Ga0157369_10023443 3300013105 Bacteria 6874
169 Ga0157369_10057801 3300013105 Bacteria 4183
170 Ga0157369_10409846 3300013105 Bacteria 1406
171 Ga0157374_10071485 3300013296 Bacteria 3271
172 Ga0157378_10108542 3300013297 Bacteria 2541
173 Ga0157378_10185048 3300013297 Bacteria 1961
174 Ga0163162_10171523 3300013306 Bacteria 2294
175 Ga0157372_10010835 3300013307 Bacteria 9706
176 Ga0157372_10011969 3300013307 Bacteria 9243
177 Ga0157372_10018291 3300013307 Bacteria 7532
178 Ga0157372_10055609 3300013307 Bacteria 4420
179 Ga0157372_10074570 3300013307 Bacteria 3826
180 Ga0157372_10240799 3300013307 Bacteria 2099
181 Ga0157372_10400407 3300013307 Bacteria 1599
182 Ga0157372_10424553 3300013307 Bacteria 1549
183 Ga0157375_10006646 3300013308 Bacteria 10066
184 Ga0157375_10031027 3300013308 Bacteria 5045
185 Ga0157375_10156205 3300013308 Bacteria 2420
186 Ga0163163_10003597 3300014325 Bacteria 13171
187 Ga0157380_10093308 3300014326 Bacteria 2489
188 Ga0157376_10080814 3300014969 Bacteria 2789
189 Ga0182006_1039896 3300015261 Bacteria 1850
190 Ga0182005_1021803 3300015265 Bacteria 1756
191 Ga0163161_10033173 3300017792 Bacteria 3689
192 Ga0213872_10000531 3300021361 Bacteria 29891
193 Ga0213874_10024115 3300021377 Bacteria 1703
194 Ga0213876_10022734 3300021384 Bacteria 3313
195 Ga0213875_10000601 3300021388 Bacteria 29135
196 Ga0213871_10004661 3300021441 Bacteria 2761
197 Ga0207647_10002678 3300025904 Bacteria 13433
198 Ga0207685_10021909 3300025905 Bacteria 2150
199 Ga0207699_10081166 3300025906 Bacteria 2011
200 Ga0207699_10091061 3300025906 Bacteria 1914
201 Ga0207705_10037136 3300025909 Bacteria 3486
202 Ga0207684_10012497 3300025910 Bacteria 7381
203 Ga0207654_10017457 3300025911 Bacteria 3751
204 Ga0207707_10001650 3300025912 Bacteria 20597
205 Ga0207707_10026620 3300025912 Bacteria 5055
206 Ga0207707_10250309 3300025912 Bacteria 1539
207 Ga0207695_10004336 3300025913 Bacteria 19431
208 Ga0207671_10068341 3300025914 Bacteria 2647
209 Ga0207693_10000268 3300025915 Bacteria 48018
210 Ga0207663_10000478 3300025916 Bacteria 17397
211 Ga0207663_10025831 3300025916 Unclassified 3402
212 Ga0207660_10002453 3300025917 Bacteria 12181
213 Ga0207662_10022661 3300025918 Bacteria 3603
214 Ga0207657_10008246 3300025919 Bacteria 10606
215 Ga0207657_10102371 3300025919 Bacteria 2375
216 Ga0207657_10162115 3300025919 Bacteria 1816
217 Ga0207657_10278031 3300025919 Bacteria 1330
218 Ga0207649_10159499 3300025920 Bacteria 1562
219 Ga0207652_10005783 3300025921 Bacteria 10034
220 Ga0207646_10009026 3300025922 Bacteria 9907
221 Ga0207681_10143095 3300025923 Bacteria 1783
222 Ga0207694_10001502 3300025924 Bacteria 19895
223 Ga0207694_10060967 3300025924 Bacteria 2936
224 Ga0207700_10003535 3300025928 Bacteria 9100
225 Ga0207664_10160523 3300025929 Bacteria 1917
226 Ga0207664_10198889 3300025929 Bacteria 1729
227 Ga0207690_10025966 3300025932 Bacteria 3686
228 Ga0207690_10051098 3300025932 Bacteria 2763
229 Ga0207706_10001796 3300025933 Bacteria 21094
230 Ga0207686_10006929 3300025934 Bacteria 6101
231 Ga0207686_10008748 3300025934 Bacteria 5469
232 Ga0207686_10062783 3300025934 Bacteria 2360
233 Ga0207686_10064547 3300025934 Bacteria 2332
234 Ga0207709_10006662 3300025935 Bacteria 6479
235 Ga0207670_10019645 3300025936 Bacteria 4131
236 Ga0207670_10183245 3300025936 Bacteria 1579
237 Ga0207704_10029678 3300025938 Bacteria 3054
238 Ga0207704_10048080 3300025938 Bacteria 2555
239 Ga0207665_10035299 3300025939 Bacteria 3319
240 Ga0207691_10009470 3300025940 Bacteria 9354
241 Ga0207711_10035563 3300025941 Bacteria 4223
242 Ga0207689_10058832 3300025942 Bacteria 3161
243 Ga0207689_10077520 3300025942 Bacteria 2731
244 Ga0207661_10007686 3300025944 Bacteria 7670
245 Ga0207661_10010768 3300025944 Bacteria 6593
246 Ga0207679_10063086 3300025945 Bacteria 2764
247 Ga0207679_10155139 3300025945 Bacteria 1869
248 Ga0207667_10006635 3300025949 Bacteria 13988
249 Ga0207667_10007508 3300025949 Bacteria 13090
250 Ga0207667_10012420 3300025949 Bacteria 9815
251 Ga0207667_10103790 3300025949 Bacteria 2931
252 Ga0207667_10128510 3300025949 Bacteria 2610
253 Ga0207651_10138111 3300025960 Bacteria 1878
254 Ga0207712_10139827 3300025961 Bacteria 1856
255 Ga0207640_10169700 3300025981 Bacteria 1624
256 Ga0207658_10153286 3300025986 Bacteria 1880
257 Ga0207677_10086158 3300026023 Bacteria 2270
258 Ga0207703_10013256 3300026035 Bacteria 6421
259 Ga0207703_10072894 3300026035 Bacteria 2839
260 Ga0207639_10032293 3300026041 Bacteria 3853
261 Ga0207678_10035779 3300026067 Bacteria 4323
262 Ga0207678_10050941 3300026067 Bacteria 3575
263 Ga0207702_10006271 3300026078 Bacteria 10275
264 Ga0207702_10028167 3300026078 Bacteria 4668
265 Ga0207702_10031166 3300026078 Bacteria 4444
266 Ga0207702_10073565 3300026078 Bacteria 2947
267 Ga0207641_10089342 3300026088 Bacteria 2692
268 Ga0207648_10046408 3300026089 Bacteria 3809
269 Ga0207676_10041992 3300026095 Bacteria 3515
270 Ga0207674_10010408 3300026116 Bacteria 10539
271 Ga0207674_10299224 3300026116 Bacteria 1558
272 Ga0207675_100096849 3300026118 Bacteria 2778
273 Ga0207683_10165270 3300026121 Bacteria 2002
274 Ga0207698_10039483 3300026142 Bacteria 3498
275 Ga0207428_10000167 3300027907 Bacteria 91345
276 Ga0207428_10015328 3300027907 Bacteria 6632
277 Ga0268266_10086153 3300028379 Bacteria 2746
278 Ga0268265_10039530 3300028380 Bacteria 3478
279 Ga0268264_10073606 3300028381 Bacteria 2900
280 Ga0265323_10001171 3300028653 Bacteria 13400
281 Ga0265322_10000364 3300028654 Bacteria 18850
282 Ga0265336_10004820 3300028666 Bacteria 5054
283 Ga0265338_10000019 3300028800 Bacteria 336040
284 Ga0265338_10062372 3300028800 Bacteria 3258
285 Ga0265324_10021713 3300029957 Bacteria 2300
286 Ga0265330_10051806 3300031235 Bacteria 1799
287 Ga0265332_10037996 3300031238 Bacteria 2087
288 Ga0265328_10028189 3300031239 Bacteria 2102
289 Ga0265320_10045748 3300031240 Bacteria 2148
290 Ga0265329_10014759 3300031242 Bacteria 2751
291 Ga0265340_10021086 3300031247 Bacteria 3342
292 Ga0265340_10042818 3300031247 Bacteria 2221
293 Ga0265339_10027965 3300031249 Bacteria 3211
294 Ga0265316_10004387 3300031344 Bacteria 14061
295 Ga0265316_10009829 3300031344 Bacteria 8778
296 Ga0265316_10012739 3300031344 Bacteria 7516
297 Ga0265316_10042639 3300031344 Bacteria 3625
298 Ga0265316_10073024 3300031344 Bacteria 2642
299 Ga0265314_10000518 3300031711 Bacteria 49782
300 Ga0265314_10001324 3300031711 Bacteria 28044
301 Ga0265314_10007447 3300031711 Bacteria 9492
302 Ga0265342_10000177 3300031712 Bacteria 70736
303 Ga0265342_10034517 3300031712 Bacteria 3103
304 Ga0316576_10000138 3300031727 Bacteria 28438
305 Ga0316576_10088823 3300031727 Bacteria 2301
306 Ga0316576_10151418 3300031727 Bacteria 1748
307 Ga0307416_100031481 3300032002 Bacteria 3994
308 Ga0307411_10046221 3300032005 Bacteria 2805
309 Ga0373927_0023850 3300035695 Bacteria 4003
310 Ga0373927_0047833 3300035695 Bacteria 2766
311 Ga0373927_0104049 3300035695 Bacteria 1848
312 Ga0373947_0000037 3300035725 Bacteria 63924
313 Ga0373947_0198967 3300035725 Bacteria 1310
314 Ga0373937_0010499 3300036401 Bacteria 8086
315 Ga0373937_0402512 3300036401 Bacteria 1299
316 Ga0316584_0028184 3300036712 Bacteria 4139
317 Ga0436364_0235296 3300037853 Bacteria 2081
318 Ga0436364_0278774 3300037853 Bacteria 400541
319 Ga0436364_0292578 3300037853 Bacteria 4296
320 Ga0436364_0498014 3300037853 Bacteria 4552
321 Ga0436364_0575975 3300037853 Bacteria 28009
322 Ga0436364_0595725 3300037853 Bacteria 4908
323 Ga0436364_0657869 3300037853 Bacteria 9342
324 Ga0436364_0979345 3300037853 Bacteria 6042
325 Ga0436364_1023247 3300037853 Bacteria 4168
326 Ga0436364_1331948 3300037853 Bacteria 5499
327 Ga0436365_0720858 3300039437 Bacteria 2764
328 Ga0436365_0915303 3300039437 Bacteria 5274
329 Ga0436360_0084875 3300039438 Bacteria 7875
330 Ga0436360_0898990 3300039438 Bacteria 2660
331 Ga0436361_0567168 3300039447 Bacteria 164343
332 Ga0436363_0157323 3300039450 Bacteria 1680
333 Ga0436363_0691492 3300039450 Bacteria 2380
334 Ga0436363_1166725 3300039450 Bacteria 2158
335 Ga0436362_0473355 3300039453 Bacteria 3888
336 Ga0436362_0826662 3300039453 Bacteria 1490
337 Ga0436362_1304293 3300039453 Bacteria 6408
338 Ga0466966_0022199 3300044684 Bacteria 4167
339 Ga0495580_0012623 3300046472 Bacteria 6476
340 Ga0495645_0107204 3300046543 Bacteria 1981
341 Ga0495672_0000772 3300047320 Bacteria 34827
342 Ga0495675_0007797 3300047444 Bacteria 6607
343 Ga0495686_0002187 3300047472 Bacteria 19022
344 Ga0496103_0142404 3300048906 Bacteria 1534
345 Ga0496107_0038753 3300048910 Bacteria 3418
346 Ga0496108_0160649 3300048911 Bacteria 1942
347 Ga0496109_0063279 3300048912 Bacteria 3384
348 Ga0496112_0001408 3300048915 Bacteria 18396
349 Ga0496115_0009297 3300048918 Bacteria 7305
350 Ga0496126_0003686 3300048929 Bacteria 19131
351 Ga0501036_0059419 3300049572 Bacteria 3239
352 Ga0501046_0084291 3300049580 Bacteria 2452
353 Ga0501047_0043370 3300049581 Bacteria 4345
354 Ga0501070_0019524 3300049586 Bacteria 5684
355 Ga0501070_0033187 3300049586 Bacteria 4319
356 Ga0501071_0016737 3300049587 Bacteria 5043
357 Ga0501075_0060371 3300049591 Bacteria 2857
358 Ga0501249_013819 3300049679 Bacteria 1718
359 Ga0501035_0008656 3300049822 Bacteria 9473
360 Ga0501035_0100216 3300049822 Bacteria 2543
361 Ga0501035_0237337 3300049822 Bacteria 1552
362 Ga0501044_0000253 3300049823 Bacteria 67988
363 Ga0501044_0004074 3300049823 Bacteria 16388
364 Ga0501045_0064958 3300049824 Bacteria 2679
365 nmdc:mga00v17_61433_c1 3300050491 Bacteria 2310
366 nmdc:mga0k408_218_c1 3300050493 Bacteria 30681
367 nmdc:mga06z11_13877_c1 3300050494 Bacteria 2479
368 nmdc:mga05p37_136624_c1 3300050507 Bacteria 3006
369 nmdc:mga05p37_207949_c1 3300050507 Bacteria 2366
370 nmdc:mga05p37_236966_c1 3300050507 Bacteria 2196
371 nmdc:mga05p37_345282_c1 3300050507 Bacteria 1754
372 nmdc:mga05p37_402917_c1 3300050507 Bacteria 1597
373 nmdc:mga05p37_59420_c1 3300050507 Bacteria 4708
374 nmdc:mga09592_17905_c1 3300050508 Bacteria 5804
375 nmdc:mga09592_20296_c1 3300050508 Bacteria 5462
376 nmdc:mga06r32_27092_c1 3300050510 Bacteria 5349
377 nmdc:mga06r32_33045_c1 3300050510 Bacteria 4872
378 nmdc:mga06r32_56627_c1 3300050510 Bacteria 3764
379 nmdc:mga06r32_86744_c1 3300050510 Bacteria 3053
380 nmdc:mga08y16_126460_c1 3300050511 Bacteria 2659
381 nmdc:mga08y16_13878_c1 3300050511 Bacteria 8477
382 nmdc:mga08y16_299789_c1 3300050511 Bacteria 1657
383 nmdc:mga08y16_74238_c1 3300050511 Bacteria 3544
384 nmdc:mga0n895_232286_c1 3300050512 Bacteria 1872
385 nmdc:mga0n895_3843_c1 3300050512 Bacteria 12190
386 nmdc:mga0rr50_958_c1 3300050513 Bacteria 15640
387 nmdc:mga08x19_2580_c2 3300050514 Bacteria 6148
388 nmdc:mga08x19_525_c1 3300050514 Bacteria 25565
389 nmdc:mga0a205_43298_c1 3300050515 Bacteria 4341
390 nmdc:mga0a205_60708_c2 3300050515 Bacteria 2147
391 nmdc:mga0a205_7106_c1 3300050515 Bacteria 10116
392 nmdc:mga0a205_77698_c1 3300050515 Bacteria 3207
393 Ga0501082_0147413 3300060353 Bacteria 2043
394 Ga0530510_0039781 3300061734 Bacteria 3394
395 Ga0157369_10162786
396 LJNas_1001998
397 Ga0065715_10103563
398 Ga0070658_10016230
399 Ga0070690_100117669
400 Ga0070680_100001987
401 Ga0070680_100003490
402 Ga0070680_100155810
403 Ga0068868_100278516
404 Ga0070660_100144586
405 Ga0070660_100302185
406 Ga0070689_100072329
407 Ga0070689_100076431
408 Ga0070691_10000567
409 Ga0070687_100008436
410 Ga0070661_100019156
411 Ga0070661_100190925
412 Ga0070668_100128040
413 Ga0070675_100149566
414 Ga0070688_100031305
415 Ga0070688_100062625
416 Ga0070659_100022195
417 Ga0070659_100071951
418 Ga0070667_100152566
419 Ga0070709_10012901
420 Ga0070713_100000704
421 Ga0070713_100019436
422 Ga0070713_100063100
423 Ga0070713_100072904
424 Ga0070710_10011633
425 Ga0070701_10058294
426 Ga0070711_100000276
427 Ga0070711_100013607
428 Ga0070711_100053057
429 Ga0070700_100025213
430 Ga0070694_100088806
431 Ga0070708_100064272
432 Ga0070663_100004381
433 Ga0070681_10017703
434 Ga0070681_10025510
435 Ga0070681_10083819
436 Ga0070681_10352501
437 Ga0068867_100046004
438 Ga0070685_10114884
439 Ga0070706_100022256
440 Ga0070706_100134433
441 Ga0070706_100263607
442 Ga0070707_100062306
443 Ga0070698_100003118
444 Ga0070698_100230891
445 Ga0070699_100013591
446 Ga0070679_100001380
447 Ga0070679_100127442
448 Ga0070684_100002491
449 Ga0070684_100013842
450 Ga0070684_100029329
451 Ga0070684_100062925
452 Ga0068853_100042951
453 Ga0068853_100071854
454 Ga0070686_100227357
455 Ga0070695_100055336
456 Ga0070695_100126126
457 Ga0070696_100004170
458 Ga0070665_100117025
459 Ga0070704_100083402
460 Ga0068855_100008970
461 Ga0068855_100050475
462 Ga0068855_100053082
463 Ga0068855_100053485
464 Ga0070664_100029544
465 Ga0070664_100343488
466 Ga0068857_100001369
467 Ga0068857_100099515
468 Ga0068857_100404199
469 Ga0068854_100141622
470 Ga0068856_100014164
471 Ga0068856_100015818
472 Ga0068856_100182358
473 Ga0068852_100006486
474 Ga0068852_100060525
475 Ga0068859_100012410
476 Ga0068859_100083021
477 Ga0068864_100379576
478 Ga0068861_100069331
479 Ga0068863_100033235
480 Ga0068863_100037844
481 Ga0068858_100007723
482 Ga0068858_100159569
483 Ga0068858_100184627
484 Ga0068860_100198878
485 Ga0068862_100075025
486 Ga0081539_10024825
487 Ga0070717_10005102
488 Ga0070717_10068687
489 Ga0075364_10014397
490 Ga0070715_10007977
491 Ga0070712_100000123
492 Ga0070712_100165865
493 Ga0075367_10074890
494 Ga0075367_10080038
495 Ga0075366_10004597
496 Ga0097621_100029935
497 Ga0075370_10054643
498 Ga0068871_100043032
499 Ga0075428_100000340
500 Ga0075428_100208067
501 Ga0075428_100258649
502 Ga0075428_100368035
503 Ga0075430_100012374
504 Ga0075431_100010386
505 Ga0075431_100028993
506 Ga0075431_100073155
507 Ga0075433_10000396
508 Ga0075434_100000839
509 Ga0075434_100029348
510 Ga0075434_100239155
511 Ga0075429_100027392
512 Ga0075429_100084081
513 Ga0075429_100159148
514 Ga0068865_100241164
515 Ga0075436_100017885
516 Ga0075436_100026399
517 Ga0097620_100012411
518 Ga0097620_100083025
519 Ga0075435_100000861
520 Ga0075435_100019776
521 Ga0105240_10045301
522 Ga0105240_10065707
523 Ga0105240_10375632
524 Ga0111539_10011908
525 Ga0111539_10039319
526 Ga0111539_10070946
527 Ga0111539_10244610
528 Ga0105247_10031172
529 Ga0114129_10070061
530 Ga0114129_10074668
531 Ga0114129_10106754
532 Ga0114129_10166857
533 Ga0114129_10377235
534 Ga0114129_10377667
535 Ga0105243_10005426
536 Ga0105241_10082344
537 Ga0105241_10096351
538 Ga0105242_10072705
539 Ga0105248_10007643
540 Ga0105248_10031422
541 Ga0105248_10222162
542 Ga0105248_10264162
543 Ga0105237_10004649
544 Ga0105237_10005592
545 Ga0105237_10038432
546 Ga0105238_10032671
547 Ga0105238_10090839
548 Ga0105238_10256184
549 Ga0105249_10043407
550 Ga0105239_10004784
551 Ga0105239_10005176
552 Ga0105239_10006434
553 Ga0105246_10107346
554 Ga0105246_10200809
555 Ga0157371_10179349
556 Ga0157370_10013184
557 Ga0157370_10022923
558 Ga0157370_10041633
559 Ga0157370_10043091
560 Ga0157369_10002025
561 Ga0157369_10021826
562 Ga0157369_10023443
563 Ga0157369_10057801
564 Ga0157369_10409846
565 Ga0157374_10071485
566 Ga0157378_10108542
567 Ga0157378_10185048
568 Ga0163162_10171523
569 Ga0157372_10010835
570 Ga0157372_10011969
571 Ga0157372_10018291
572 Ga0157372_10055609
573 Ga0157372_10074570
574 Ga0157372_10240799
575 Ga0157372_10400407
576 Ga0157372_10424553
577 Ga0157375_10006646
578 Ga0157375_10031027
579 Ga0157375_10156205
580 Ga0163163_10003597
581 Ga0157380_10093308
582 Ga0157376_10080814
583 Ga0182006_1039896
584 Ga0182005_1021803
585 Ga0163161_10033173
586 Ga0213872_10000531
587 Ga0213874_10024115
588 Ga0213876_10022734
589 Ga0213875_10000601
590 Ga0213871_10004661
591 Ga0207647_10002678
592 Ga0207685_10021909
593 Ga0207699_10081166
594 Ga0207699_10091061
595 Ga0207705_10037136
596 Ga0207684_10012497
597 Ga0207654_10017457
598 Ga0207707_10001650
599 Ga0207707_10026620
600 Ga0207707_10250309
601 Ga0207695_10004336
602 Ga0207671_10068341
603 Ga0207693_10000268
604 Ga0207663_10000478
605 Ga0207663_10025831
606 Ga0207660_10002453
607 Ga0207662_10022661
608 Ga0207657_10008246
609 Ga0207657_10102371
610 Ga0207657_10162115
611 Ga0207657_10278031
612 Ga0207649_10159499
613 Ga0207652_10005783
614 Ga0207646_10009026
615 Ga0207681_10143095
616 Ga0207694_10001502
617 Ga0207694_10060967
618 Ga0207700_10003535
619 Ga0207664_10160523
620 Ga0207664_10198889
621 Ga0207690_10025966
622 Ga0207690_10051098
623 Ga0207706_10001796
624 Ga0207686_10006929
625 Ga0207686_10008748
626 Ga0207686_10062783
627 Ga0207686_10064547
628 Ga0207709_10006662
629 Ga0207670_10019645
630 Ga0207670_10183245
631 Ga0207704_10029678
632 Ga0207704_10048080
633 Ga0207665_10035299
634 Ga0207691_10009470
635 Ga0207711_10035563
636 Ga0207689_10058832
637 Ga0207689_10077520
638 Ga0207661_10007686
639 Ga0207661_10010768
640 Ga0207679_10063086
641 Ga0207679_10155139
642 Ga0207667_10006635
643 Ga0207667_10007508
644 Ga0207667_10012420
645 Ga0207667_10103790
646 Ga0207667_10128510
647 Ga0207651_10138111
648 Ga0207712_10139827
649 Ga0207640_10169700
650 Ga0207658_10153286
651 Ga0207677_10086158
652 Ga0207703_10013256
653 Ga0207703_10072894
654 Ga0207639_10032293
655 Ga0207678_10035779
656 Ga0207678_10050941
657 Ga0207702_10006271
658 Ga0207702_10028167
659 Ga0207702_10031166
660 Ga0207702_10073565
661 Ga0207641_10089342
662 Ga0207648_10046408
663 Ga0207676_10041992
664 Ga0207674_10010408
665 Ga0207674_10299224
666 Ga0207675_100096849
667 Ga0207683_10165270
668 Ga0207698_10039483
669 Ga0207428_10000167
670 Ga0207428_10015328
671 Ga0268266_10086153
672 Ga0268265_10039530
673 Ga0268264_10073606
674 Ga0265323_10001171
675 Ga0265322_10000364
676 Ga0265336_10004820
677 Ga0265338_10000019
678 Ga0265338_10062372
679 Ga0265324_10021713
680 Ga0265330_10051806
681 Ga0265332_10037996
682 Ga0265328_10028189
683 Ga0265320_10045748
684 Ga0265329_10014759
685 Ga0265340_10021086
686 Ga0265340_10042818
687 Ga0265339_10027965
688 Ga0265316_10004387
689 Ga0265316_10009829
690 Ga0265316_10012739
691 Ga0265316_10042639
692 Ga0265316_10073024
693 Ga0265314_10000518
694 Ga0265314_10001324
695 Ga0265314_10007447
696 Ga0265342_10000177
697 Ga0265342_10034517
698 Ga0316576_10000138
699 Ga0316576_10088823
700 Ga0316576_10151418
701 Ga0307416_100031481
702 Ga0307411_10046221
703 Ga0373927_0023850
704 Ga0373927_0047833
705 Ga0373927_0104049
706 Ga0373947_0000037
707 Ga0373947_0198967
708 Ga0373937_0010499
709 Ga0373937_0402512
710 Ga0316584_0028184
711 Ga0436364_0235296
712 Ga0436364_0278774
713 Ga0436364_0292578
714 Ga0436364_0498014
715 Ga0436364_0575975
716 Ga0436364_0595725
717 Ga0436364_0657869
718 Ga0436364_0979345
719 Ga0436364_1023247
720 Ga0436364_1331948
721 Ga0436365_0720858
722 Ga0436365_0915303
723 Ga0436360_0084875
724 Ga0436360_0898990
725 Ga0436361_0567168
726 Ga0436363_0157323
727 Ga0436363_0691492
728 Ga0436363_1166725
729 Ga0436362_0473355
730 Ga0436362_0826662
731 Ga0436362_1304293
732 Ga0466966_0022199
733 Ga0495580_0012623
734 Ga0495645_0107204
735 Ga0495672_0000772
736 Ga0495675_0007797
737 Ga0495686_0002187
738 Ga0496103_0142404
739 Ga0496107_0038753
740 Ga0496108_0160649
741 Ga0496109_0063279
742 Ga0496112_0001408
743 Ga0496115_0009297
744 Ga0496126_0003686
745 Ga0501036_0059419
746 Ga0501046_0084291
747 Ga0501047_0043370
748 Ga0501070_0019524
749 Ga0501070_0033187
750 Ga0501071_0016737
751 Ga0501075_0060371
752 Ga0501249_013819
753 Ga0501035_0008656
754 Ga0501035_0100216
755 Ga0501035_0237337
756 Ga0501044_0000253
757 Ga0501044_0004074
758 Ga0501045_0064958
759 nmdc:mga00v17_61433_c1
760 nmdc:mga0k408_218_c1
761 nmdc:mga06z11_13877_c1
762 nmdc:mga05p37_136624_c1
763 nmdc:mga05p37_207949_c1
764 nmdc:mga05p37_236966_c1
765 nmdc:mga05p37_345282_c1
766 nmdc:mga05p37_402917_c1
767 nmdc:mga05p37_59420_c1
768 nmdc:mga09592_17905_c1
769 nmdc:mga09592_20296_c1
770 nmdc:mga06r32_27092_c1
771 nmdc:mga06r32_33045_c1
772 nmdc:mga06r32_56627_c1
773 nmdc:mga06r32_86744_c1
774 nmdc:mga08y16_126460_c1
775 nmdc:mga08y16_13878_c1
776 nmdc:mga08y16_299789_c1
777 nmdc:mga08y16_74238_c1
778 nmdc:mga0n895_232286_c1
779 nmdc:mga0n895_3843_c1
780 nmdc:mga0rr50_958_c1
781 nmdc:mga08x19_2580_c2
782 nmdc:mga08x19_525_c1
783 nmdc:mga0a205_43298_c1
784 nmdc:mga0a205_60708_c2
785 nmdc:mga0a205_7106_c1
786 nmdc:mga0a205_77698_c1
787 Ga0501082_0147413
788 Ga0530510_0039781

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00579

tRNA-synt_1b

tRNA synthetases class I (W and Y)

97

385

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bqz-assembly1.cif.gz_A crystal structure of tyrosine-trna synthetase from acinetobacter baumannii with bound l-tyrosine 0.955 3 223
6bqz-assembly2.cif.gz_B crystal structure of tyrosine-trna synthetase from acinetobacter baumannii with bound l-tyrosine 0.945 4 223
6bqz-assembly1.cif.gz_A crystal structure of tyrosine-trna synthetase from acinetobacter baumannii with bound l-tyrosine 0.9377 3 223
6bqy-assembly2.cif.gz_B crystal structure of tyrosine-trna synthetase from acinetobacter baumannii 0.9356 4 223
6bqz-assembly2.cif.gz_B crystal structure of tyrosine-trna synthetase from acinetobacter baumannii with bound l-tyrosine 0.9278 4 223
ID Description Score Start End Superfamily
1h3fB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9597 8 224 3.40.50.620
1h3fB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9505 8 224 3.40.50.620
1h3fB02 Mainly Alpha;Orthogonal Bundle;Tyrosyl-Transfer RNA Synthetase;Tyrosyl-Transfer RNA Synthetase 0.9223 227 305 1.10.240.10
2pidB02 Mainly Alpha;Orthogonal Bundle;Tyrosyl-Transfer RNA Synthetase;Tyrosyl-Transfer RNA Synthetase 0.8625 248 318 1.10.240.10
2janD02 Mainly Alpha;Orthogonal Bundle;Tyrosyl-Transfer RNA Synthetase;Tyrosyl-Transfer RNA Synthetase 0.8584 248 318 1.10.240.10
ID Description Score Start End GO Terms
AF-X1JGY7-F1-model_v4 tyrosine--tRNA ligase (EC 6.1.1.1) 0.9854 144 243 GO:0004831
GO:0005524
GO:0005829
GO:0006437
AF-A0A6I1INX2-F1-model_v4 deleted 0.9837 114 262
AF-A0A7S0PG61-F1-model_v4 Tyrosine--tRNA ligase (EC 6.1.1.1) (Tyrosyl-tRNA synthetase) 0.9834 136 233 GO:0004831
GO:0005524
GO:0005829
GO:0006437
AF-A0A7W0V2K0-F1-model_v4 Tyrosine--tRNA ligase (EC 6.1.1.1) 0.9782 5 299 GO:0004831
GO:0005524
GO:0005829
GO:0006437
AF-A0A7C6YC37-F1-model_v4 Tyrosine--tRNA ligase (EC 6.1.1.1) 0.9728 3 299 GO:0004831
GO:0005524
GO:0005829
GO:0006437

Map