F432863

General Info

Members Datasets Scaffolds Average Seq Length
394 212 789 274

Family's Representative Sequence

Representative Sequence 3300006175|Ga0070712_100050011|Ga0070712_1000500113
Length 275
Sequence MDRMPALFVGHGSPMNALETNGYTNAWRVFGQQLPRPRALLVISAHWYFGATAVTAMPKPRTIHDFYGFPKDLFEFEYPASGAPDLAQEVVEVVKPHWLGLDHDQWVLAHIYPEADVPVVQLSINALRPLDYHLDLAARLAPLRDRGVMILASGNVVHNLRRVQWDQPDAAFDWAERFDDAVVQQLARDPGDILRLVEHPDFGLAVPTPDHFIPLLYLAALAAAEGVPPEVLVRGYAMGSISMTCYGLGAKGILPQEPERAARLPDGVPPDQTNM

Samples

Sample ID Description Type Environment
1 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
117 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
118 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
125 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
126 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
130 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
131 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
132 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
133 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
134 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
140 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
141 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
142 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
143 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
144 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
145 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
146 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
147 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
148 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
149 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
150 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
151 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
152 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
153 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
156 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
157 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
158 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
161 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
168 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
169 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
170 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
171 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
185 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
186 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
187 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
188 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
189 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
190 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
191 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
192 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
193 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
194 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
195 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
196 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
197 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
198 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
199 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
202 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
203 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
204 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
205 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
206 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
207 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
208 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
209 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
210 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
211 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
212 649633069 Micromonospora sp. L5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.98
Metatranscriptomes 0.25
Isolates 0.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.02
Nodule 0
Rhizoplane 3.05
Rhizosphere 92.13
Stem 0
Stem Tuber 0
Unclassified 1.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070712_100050011 3300006175 Bacteria 2906
2 JGI24739J22299_10000268 3300001989 Bacteria 17502
3 JGI24737J22298_10000441 3300001990 Bacteria 14198
4 JGI24735J21928_10001442 3300002067 Bacteria 8405
5 JGI24738J21930_10000543 3300002075 Bacteria 10769
6 JGI25406J46586_10029776 3300003203 Bacteria 2061
7 rootH1_10015619 3300003316 Bacteria 3772
8 rootH1_10015619 3300003323 Bacteria 3720
9 Ga0070658_10048161 3300005327 Bacteria 3450
10 Ga0070658_10195196 3300005327 Bacteria 1707
11 Ga0070676_10160064 3300005328 Bacteria 1448
12 Ga0070683_100050448 3300005329 Bacteria 3852
13 Ga0070683_100117009 3300005329 Bacteria 2517
14 Ga0070683_100147365 3300005329 Bacteria 2231
15 Ga0070683_100244895 3300005329 Bacteria 1705
16 Ga0070683_100485712 3300005329 Bacteria 1179
17 Ga0070670_100035221 3300005331 Bacteria 4310
18 Ga0070677_10111730 3300005333 Bacteria 1221
19 Ga0068869_100073241 3300005334 Bacteria 2539
20 Ga0070680_100000498 3300005336 Bacteria 26970
21 Ga0070680_100007601 3300005336 Bacteria 8267
22 Ga0070680_100171704 3300005336 Bacteria 1824
23 Ga0070680_100396943 3300005336 Bacteria 1175
24 Ga0070680_100409537 3300005336 Bacteria 1156
25 Ga0070682_100017104 3300005337 Bacteria 4225
26 Ga0070682_100081579 3300005337 Bacteria 2094
27 Ga0068868_100178109 3300005338 Bacteria 1762
28 Ga0068868_100244762 3300005338 Bacteria 1508
29 Ga0070660_100034039 3300005339 Bacteria 3846
30 Ga0070660_100067154 3300005339 Bacteria 2793
31 Ga0070660_100110453 3300005339 Bacteria 2187
32 Ga0070660_100114758 3300005339 Bacteria 2146
33 Ga0070660_100120943 3300005339 Bacteria 2089
34 Ga0070660_100204934 3300005339 Bacteria 1600
35 Ga0070660_100309922 3300005339 Bacteria 1295
36 Ga0070660_100596922 3300005339 Unclassified 923
37 Ga0070689_100099243 3300005340 Bacteria 2304
38 Ga0070661_100009426 3300005344 Bacteria 6756
39 Ga0070661_100024487 3300005344 Bacteria 4330
40 Ga0070661_100032005 3300005344 Bacteria 3805
41 Ga0070661_100124215 3300005344 Bacteria 1935
42 Ga0070661_100163228 3300005344 Bacteria 1688
43 Ga0070661_100238059 3300005344 Bacteria 1401
44 Ga0070692_10170570 3300005345 Bacteria 1254
45 Ga0070668_100050604 3300005347 Bacteria 3199
46 Ga0070675_100256435 3300005354 Bacteria 1532
47 Ga0070674_100031146 3300005356 Bacteria 3532
48 Ga0070659_100008405 3300005366 Bacteria 7540
49 Ga0070659_100010450 3300005366 Bacteria 6827
50 Ga0070659_100062138 3300005366 Bacteria 2952
51 Ga0070659_100073640 3300005366 Bacteria 2719
52 Ga0070659_100104835 3300005366 Bacteria 2278
53 Ga0070659_100135659 3300005366 Bacteria 2001
54 Ga0070659_100225649 3300005366 Bacteria 1547
55 Ga0070659_100567753 3300005366 Unclassified 972
56 Ga0070714_100143070 3300005435 Bacteria 2149
57 Ga0070713_100309761 3300005436 Bacteria 1456
58 Ga0070700_100124037 3300005441 Bacteria 1734
59 Ga0070694_100008270 3300005444 Bacteria 6362
60 Ga0070708_100000450 3300005445 Bacteria 30851
61 Ga0070663_100030876 3300005455 Bacteria 3676
62 Ga0070663_100077748 3300005455 Bacteria 2430
63 Ga0070663_100124106 3300005455 Bacteria 1954
64 Ga0070663_100185852 3300005455 Bacteria 1615
65 Ga0070678_100044403 3300005456 Bacteria 3174
66 Ga0070662_100000934 3300005457 Bacteria 17887
67 Ga0070662_100026273 3300005457 Bacteria 4031
68 Ga0070662_100115688 3300005457 Bacteria 2049
69 Ga0070662_100209477 3300005457 Bacteria 1551
70 Ga0070681_10022967 3300005458 Bacteria 6268
71 Ga0070681_10095796 3300005458 Bacteria 2916
72 Ga0070681_10170236 3300005458 Bacteria 2100
73 Ga0070681_10297988 3300005458 Bacteria 1522
74 Ga0068867_100100087 3300005459 Bacteria 2213
75 Ga0070685_10041727 3300005466 Bacteria 2616
76 Ga0070685_10045673 3300005466 Bacteria 2512
77 Ga0070679_100392989 3300005530 Bacteria 1333
78 Ga0070684_100230928 3300005535 Bacteria 1689
79 Ga0070697_100240091 3300005536 Bacteria 1547
80 Ga0068853_100028472 3300005539 Bacteria 4699
81 Ga0068853_100184576 3300005539 Bacteria 1893
82 Ga0070672_100332522 3300005543 Bacteria 1293
83 Ga0070695_100061398 3300005545 Bacteria 2439
84 Ga0070696_100146902 3300005546 Bacteria 1727
85 Ga0070693_100032603 3300005547 Bacteria 2867
86 Ga0070664_100021723 3300005564 Bacteria 5293
87 Ga0070664_100036193 3300005564 Bacteria 4147
88 Ga0070664_100162806 3300005564 Bacteria 1975
89 Ga0070664_100564886 3300005564 Bacteria 1053
90 Ga0068857_100307116 3300005577 Bacteria 1463
91 Ga0068854_100023490 3300005578 Bacteria 4212
92 Ga0068854_100031688 3300005578 Bacteria 3675
93 Ga0068854_100125265 3300005578 Bacteria 1956
94 Ga0068856_100009582 3300005614 Bacteria 9407
95 Ga0068856_100123583 3300005614 Bacteria 2590
96 Ga0068856_100301588 3300005614 Bacteria 1620
97 Ga0068856_100692880 3300005614 Bacteria 1039
98 Ga0068852_100019340 3300005616 Bacteria 5387
99 Ga0068852_100064024 3300005616 Bacteria 3204
100 Ga0068852_100168568 3300005616 Bacteria 2051
101 Ga0068852_100216090 3300005616 Bacteria 1821
102 Ga0068859_100634624 3300005617 Bacteria 1160
103 Ga0068864_100026115 3300005618 Bacteria 4923
104 Ga0068864_100094741 3300005618 Bacteria 2639
105 Ga0068858_100018190 3300005842 Bacteria 6580
106 Ga0068860_100424225 3300005843 Bacteria 1319
107 Ga0081539_10000205 3300005985 Bacteria 137262
108 Ga0070717_10104251 3300006028 Bacteria 2412
109 Ga0068865_100588740 3300006881 Bacteria 939
110 Ga0097620_100634643 3300006931 Bacteria 1160
111 Ga0105240_10244302 3300009093 Bacteria 2079
112 Ga0105245_10127784 3300009098 Bacteria 2381
113 Ga0105245_10399438 3300009098 Bacteria 1373
114 Ga0105243_10021985 3300009148 Bacteria 4844
115 Ga0105248_10190206 3300009177 Bacteria 2313
116 Ga0105248_10440234 3300009177 Bacteria 1468
117 Ga0105238_10068201 3300009551 Bacteria 3558
118 Ga0105238_10138752 3300009551 Bacteria 2409
119 Ga0105238_10450809 3300009551 Bacteria 1283
120 Ga0105238_10566236 3300009551 Bacteria 1141
121 Ga0105249_10401649 3300009553 Bacteria 1401
122 Ga0105239_10111021 3300010375 Bacteria 3039
123 Ga0105239_10172640 3300010375 Bacteria 2418
124 Ga0105239_10395389 3300010375 Bacteria 1564
125 Ga0105239_10723618 3300010375 Bacteria 1138
126 Ga0105246_10225552 3300011119 Bacteria 1472
127 Ga0157373_10045630 3300013100 Bacteria 3128
128 Ga0157371_10022761 3300013102 Bacteria 4585
129 Ga0157371_10040275 3300013102 Bacteria 3337
130 Ga0157371_10059222 3300013102 Bacteria 2715
131 Ga0157371_10317985 3300013102 Bacteria 1129
132 Ga0157371_10391800 3300013102 Bacteria 1015
133 Ga0157370_10019732 3300013104 Bacteria 6748
134 Ga0157370_10053017 3300013104 Bacteria 3870
135 Ga0157370_10138346 3300013104 Bacteria 2269
136 Ga0157370_10232147 3300013104 Bacteria 1707
137 Ga0157370_10283699 3300013104 Bacteria 1530
138 Ga0157370_10633014 3300013104 Bacteria 978
139 Ga0157369_10010995 3300013105 Bacteria 10302
140 Ga0157369_10148583 3300013105 Bacteria 2477
141 Ga0157369_10169640 3300013105 Bacteria 2300
142 Ga0157369_10186843 3300013105 Bacteria 2179
143 Ga0157369_10194517 3300013105 Bacteria 2130
144 Ga0157369_10312647 3300013105 Bacteria 1633
145 Ga0157374_10057282 3300013296 Bacteria 3640
146 Ga0157374_10382952 3300013296 Bacteria 1401
147 Ga0157378_10716571 3300013297 Bacteria 1021
148 Ga0163162_10256074 3300013306 Bacteria 1882
149 Ga0163162_10260067 3300013306 Bacteria 1867
150 Ga0157372_10930744 3300013307 Unclassified 1008
151 Ga0157375_10007341 3300013308 Bacteria 9651
152 Ga0163163_10021138 3300014325 Bacteria 6139
153 Ga0157377_10023385 3300014745 Bacteria 3274
154 Ga0157379_10039154 3300014968 Bacteria 4230
155 Ga0163161_10078590 3300017792 Bacteria 2425
156 Ga0206353_11845874 3300020082 Bacteria 1751
157 Ga0207656_10003567 3300025321 Bacteria 5365
158 Ga0207682_10002781 3300025893 Bacteria 7746
159 Ga0207710_10032135 3300025900 Bacteria 2299
160 Ga0207688_10006748 3300025901 Bacteria 6245
161 Ga0207688_10069542 3300025901 Bacteria 1995
162 Ga0207647_10000316 3300025904 Bacteria 40242
163 Ga0207647_10001296 3300025904 Bacteria 19244
164 Ga0207647_10021376 3300025904 Bacteria 4320
165 Ga0207647_10025516 3300025904 Bacteria 3881
166 Ga0207647_10176964 3300025904 Bacteria 1241
167 Ga0207645_10009613 3300025907 Bacteria 6681
168 Ga0207643_10030576 3300025908 Bacteria 2998
169 Ga0207705_10007602 3300025909 Bacteria 7968
170 Ga0207705_10011928 3300025909 Bacteria 6279
171 Ga0207705_10013566 3300025909 Bacteria 5882
172 Ga0207705_10024445 3300025909 Bacteria 4311
173 Ga0207705_10027057 3300025909 Bacteria 4087
174 Ga0207705_10047397 3300025909 Bacteria 3090
175 Ga0207705_10076375 3300025909 Bacteria 2435
176 Ga0207705_10113009 3300025909 Bacteria 2008
177 Ga0207705_10216942 3300025909 Bacteria 1452
178 Ga0207707_10087614 3300025912 Bacteria 2720
179 Ga0207707_10390222 3300025912 Bacteria 1196
180 Ga0207695_10063837 3300025913 Bacteria 3794
181 Ga0207695_10181153 3300025913 Bacteria 2027
182 Ga0207693_10091114 3300025915 Bacteria 2390
183 Ga0207660_10003723 3300025917 Bacteria 9938
184 Ga0207660_10027396 3300025917 Bacteria 3888
185 Ga0207660_10036958 3300025917 Bacteria 3399
186 Ga0207660_10076133 3300025917 Bacteria 2453
187 Ga0207660_10094568 3300025917 Bacteria 2221
188 Ga0207657_10002718 3300025919 Bacteria 19043
189 Ga0207657_10004197 3300025919 Bacteria 15264
190 Ga0207657_10028389 3300025919 Bacteria 5104
191 Ga0207657_10047102 3300025919 Bacteria 3773
192 Ga0207657_10118084 3300025919 Bacteria 2184
193 Ga0207657_10247999 3300025919 Bacteria 1420
194 Ga0207649_10109244 3300025920 Bacteria 1845
195 Ga0207649_10266554 3300025920 Bacteria 1240
196 Ga0207649_10401386 3300025920 Bacteria 1026
197 Ga0207652_10113414 3300025921 Bacteria 2406
198 Ga0207650_10004837 3300025925 Bacteria 9202
199 Ga0207659_10171250 3300025926 Bacteria 1713
200 Ga0207664_10332742 3300025929 Bacteria 1342
201 Ga0207690_10049224 3300025932 Bacteria 2808
202 Ga0207690_10200257 3300025932 Bacteria 1516
203 Ga0207706_10000576 3300025933 Bacteria 39094
204 Ga0207706_10018713 3300025933 Bacteria 6230
205 Ga0207706_10027488 3300025933 Bacteria 5086
206 Ga0207706_10031538 3300025933 Bacteria 4721
207 Ga0207706_10069389 3300025933 Bacteria 3100
208 Ga0207706_10094670 3300025933 Bacteria 2627
209 Ga0207706_10123565 3300025933 Bacteria 2277
210 Ga0207669_10330376 3300025937 Bacteria 1170
211 Ga0207704_10661345 3300025938 Bacteria 861
212 Ga0207691_10138426 3300025940 Bacteria 2146
213 Ga0207661_10170583 3300025944 Bacteria 1894
214 Ga0207661_10276906 3300025944 Bacteria 1499
215 Ga0207661_10503216 3300025944 Unclassified 1107
216 Ga0207679_10003185 3300025945 Bacteria 10122
217 Ga0207679_10118448 3300025945 Bacteria 2103
218 Ga0207667_10059329 3300025949 Bacteria 4007
219 Ga0207667_10162052 3300025949 Bacteria 2300
220 Ga0207667_10333857 3300025949 Bacteria 1547
221 Ga0207677_10504954 3300026023 Bacteria 1046
222 Ga0207703_10033833 3300026035 Unclassified 4053
223 Ga0207639_10041226 3300026041 Bacteria 3452
224 Ga0207639_10220274 3300026041 Bacteria 1638
225 Ga0207639_10376835 3300026041 Bacteria 1273
226 Ga0207678_10003211 3300026067 Bacteria 14775
227 Ga0207678_10006004 3300026067 Bacteria 10807
228 Ga0207678_10063883 3300026067 Bacteria 3163
229 Ga0207678_10089008 3300026067 Bacteria 2639
230 Ga0207678_10095011 3300026067 Bacteria 2547
231 Ga0207678_10224595 3300026067 Bacteria 1608
232 Ga0207678_10292614 3300026067 Bacteria 1399
233 Ga0207702_10000859 3300026078 Bacteria 31767
234 Ga0207702_10046091 3300026078 Bacteria 3669
235 Ga0207702_10046544 3300026078 Bacteria 3652
236 Ga0207702_10345115 3300026078 Bacteria 1423
237 Ga0207641_10107396 3300026088 Bacteria 2469
238 Ga0207648_10050136 3300026089 Bacteria 3651
239 Ga0207674_10052184 3300026116 Bacteria 4170
240 Ga0207674_10113480 3300026116 Bacteria 2683
241 Ga0207675_100025843 3300026118 Bacteria 5462
242 Ga0207683_10054767 3300026121 Bacteria 3497
243 Ga0207683_10066019 3300026121 Bacteria 3190
244 Ga0207683_10096792 3300026121 Bacteria 2631
245 Ga0207698_10044873 3300026142 Bacteria 3325
246 Ga0207698_10064986 3300026142 Bacteria 2863
247 Ga0207698_10065368 3300026142 Bacteria 2856
248 Ga0207698_10070344 3300026142 Bacteria 2772
249 Ga0207698_10121650 3300026142 Bacteria 2211
250 Ga0207698_10195545 3300026142 Bacteria 1806
251 Ga0307515_10005159 3300028794 Bacteria 26553
252 Ga0307515_10033135 3300028794 Bacteria 8519
253 Ga0307512_10003932 3300030522 Bacteria 16625
254 Ga0307513_10011704 3300031456 Bacteria 10885
255 Ga0307513_10099337 3300031456 Bacteria 2939
256 Ga0307408_100310765 3300031548 Bacteria 1324
257 Ga0307508_10029623 3300031616 Bacteria 4947
258 Ga0307405_10323756 3300031731 Bacteria 1178
259 Ga0307413_10000800 3300031824 Bacteria 10954
260 Ga0307413_10003571 3300031824 Bacteria 6579
261 Ga0307413_10069103 3300031824 Bacteria 2215
262 Ga0307413_10152228 3300031824 Bacteria 1613
263 Ga0307410_10001280 3300031852 Bacteria 11190
264 Ga0307410_10001493 3300031852 Bacteria 10607
265 Ga0307410_10020924 3300031852 Bacteria 4014
266 Ga0307410_10146813 3300031852 Bacteria 1751
267 Ga0307406_10110516 3300031901 Bacteria 1891
268 Ga0307407_10002484 3300031903 Bacteria 7230
269 Ga0307407_10003434 3300031903 Bacteria 6496
270 Ga0307412_10004071 3300031911 Bacteria 8142
271 Ga0307412_10005181 3300031911 Bacteria 7304
272 Ga0307412_10073074 3300031911 Bacteria 2345
273 Ga0307409_100002303 3300031995 Bacteria 9898
274 Ga0307409_100012072 3300031995 Bacteria 5486
275 Ga0307409_100029313 3300031995 Bacteria 3937
276 Ga0307409_100030125 3300031995 Bacteria 3894
277 Ga0307409_100057394 3300031995 Bacteria 3016
278 Ga0307409_100086788 3300031995 Bacteria 2548
279 Ga0307416_100002520 3300032002 Bacteria 10536
280 Ga0307416_100008074 3300032002 Bacteria 6749
281 Ga0307416_100160080 3300032002 Bacteria 2079
282 Ga0307416_100519386 3300032002 Bacteria 1259
283 Ga0307414_10001585 3300032004 Bacteria 11798
284 Ga0307414_10027396 3300032004 Bacteria 3682
285 Ga0307414_10028589 3300032004 Bacteria 3618
286 Ga0307414_10050858 3300032004 Bacteria 2873
287 Ga0307411_10000176 3300032005 Bacteria 20455
288 Ga0307411_10003932 3300032005 Bacteria 7012
289 Ga0307411_10023814 3300032005 Bacteria 3636
290 Ga0307415_100003198 3300032126 Bacteria 8312
291 Ga0307415_100276143 3300032126 Bacteria 1379
292 Ga0373960_0046249 3300035121 Bacteria 1277
293 Ga0373931_0060637 3300035691 Bacteria 2037
294 Ga0395899_0003579 3300037312 Bacteria 12304
295 Ga0395899_0064087 3300037312 Bacteria 2702
296 Ga0395899_0108665 3300037312 Bacteria 1996
297 Ga0395900_0012059 3300037418 Bacteria 8833
298 Ga0395900_0058574 3300037418 Bacteria 3965
299 Ga0395900_0069249 3300037418 Bacteria 3626
300 Ga0395900_0096087 3300037418 Bacteria 3044
301 Ga0395900_0343514 3300037418 Bacteria 1467
302 Ga0395898_0008311 3300037466 Bacteria 10974
303 Ga0395898_0308551 3300037466 Bacteria 1509
304 Ga0395905_0005688 3300037471 Bacteria 12668
305 Ga0395905_0084624 3300037471 Bacteria 2972
306 Ga0395905_0219073 3300037471 Bacteria 1781
307 Ga0395901_0000086 3300038443 Bacteria 125359
308 Ga0395901_0009588 3300038443 Bacteria 9821
309 Ga0395901_0155647 3300038443 Bacteria 2400
310 Ga0395901_0496046 3300038443 Bacteria 1243
311 Ga0436365_1487283 3300039437 Bacteria 2979
312 Ga0436363_0435808 3300039450 Bacteria 1057
313 Ga0439465_0062891 3300041413 Bacteria 1232
314 Ga0439432_015529 3300042006 Bacteria 2569
315 Ga0439449_0038548 3300042007 Bacteria 1777
316 Ga0450889_000034 3300042144 Bacteria 11809
317 Ga0466972_0033553 3300044658 Bacteria 2517
318 Ga0466965_0002894 3300044683 Bacteria 7412
319 Ga0466965_0003465 3300044683 Bacteria 6921
320 Ga0466961_0125091 3300044693 Bacteria 1613
321 Ga0466963_0011747 3300044694 Bacteria 5339
322 Ga0466968_0161403 3300044735 Bacteria 1034
323 Ga0466970_0001507 3300044765 Bacteria 11213
324 Ga0466957_0006527 3300044842 Bacteria 6587
325 Ga0466957_0116058 3300044842 Bacteria 1703
326 Ga0466957_0163100 3300044842 Bacteria 1448
327 Ga0466960_0090258 3300044901 Bacteria 1560
328 Ga0466959_0051736 3300045049 Bacteria 3010
329 Ga0466967_0111760 3300045976 Bacteria 2511
330 Ga0466967_0801537 3300045976 Bacteria 935
331 Ga0495629_0006769 3300046459 Bacteria 8470
332 Ga0495608_0044555 3300046511 Bacteria 2960
333 Ga0495657_0018201 3300046675 Bacteria 5089
334 Ga0495599_0271772 3300046678 Bacteria 1028
335 Ga0496101_0090891 3300048904 Bacteria 2271
336 Ga0496105_0105012 3300048908 Bacteria 2332
337 Ga0496107_0090288 3300048910 Bacteria 2238
338 Ga0496108_0013567 3300048911 Bacteria 6650
339 Ga0496108_0333176 3300048911 Bacteria 1324
340 Ga0496111_0189819 3300048914 Bacteria 1527
341 Ga0496112_0127922 3300048915 Bacteria 2511
342 Ga0496113_0460102 3300048916 Bacteria 1022
343 Ga0496113_0511893 3300048916 Bacteria 963
344 Ga0496114_0000084 3300048917 Bacteria 67352
345 Ga0496114_0055244 3300048917 Bacteria 3312
346 Ga0496115_0015861 3300048918 Bacteria 5724
347 Ga0496123_0014699 3300048926 Bacteria 6470
348 Ga0496125_0174705 3300048928 Bacteria 1439
349 Ga0496126_0003501 3300048929 Bacteria 19807
350 Ga0501032_0023283 3300049569 Bacteria 4284
351 Ga0501033_0098136 3300049570 Bacteria 2140
352 Ga0501033_0128407 3300049570 Bacteria 1837
353 Ga0501034_0001623 3300049571 Bacteria 29167
354 Ga0501036_0010896 3300049572 Bacteria 7515
355 Ga0501037_0033563 3300049573 Bacteria 3790
356 Ga0501038_0024615 3300049574 Bacteria 5369
357 Ga0501038_0444301 3300049574 Bacteria 998
358 Ga0501039_0067039 3300049575 Bacteria 2787
359 Ga0501040_0014692 3300049576 Bacteria 5165
360 Ga0501041_0006654 3300049577 Bacteria 6768
361 Ga0501042_0000727 3300049578 Bacteria 17844
362 Ga0501043_0361721 3300049579 Bacteria 1101
363 Ga0501046_0085879 3300049580 Bacteria 2426
364 Ga0501048_0003892 3300049582 Bacteria 11359
365 Ga0501069_0031312 3300049585 Bacteria 2925
366 Ga0501071_0007715 3300049587 Bacteria 7093
367 Ga0501072_0008195 3300049588 Bacteria 7934
368 Ga0501073_0031562 3300049589 Bacteria 3780
369 Ga0501075_0010017 3300049591 Bacteria 6649
370 Ga0501076_0018219 3300049592 Bacteria 5349
371 Ga0501202_014892 3300049652 Bacteria 1492
372 Ga0501227_025912 3300049665 Bacteria 1379
373 Ga0501235_001571 3300049669 Bacteria 4895
374 Ga0501257_002119 3300049686 Bacteria 4145
375 Ga0501257_004449 3300049686 Bacteria 3062
376 Ga0501080_0075911 3300049742 Bacteria 3126
377 Ga0501081_0069664 3300049743 Bacteria 2450
378 Ga0501083_0151281 3300049744 Bacteria 1519
379 Ga0501268_003113 3300049765 Bacteria 2246
380 Ga0501283_003306 3300049779 Bacteria 2127
381 Ga0501035_0028568 3300049822 Bacteria 5091
382 Ga0501044_0000776 3300049823 Bacteria 38704
383 Ga0501044_0482039 3300049823 Bacteria 1143
384 Ga0501045_0010487 3300049824 Bacteria 6491
385 nmdc:mga08y16_264229_c1 3300050511 Bacteria 1777
386 Ga0500646_0003973 3300053090 Bacteria 3760
387 Ga0500641_0022062 3300053096 Bacteria 2434
388 Ga0500650_0050713 3300053098 Bacteria 1927
389 Ga0500556_0034455 3300053104 Bacteria 1743
390 Ga0501084_0061702 3300054114 Bacteria 3139
391 Ga0501082_0096183 3300060353 Bacteria 2560
392 Ga0530510_0052219 3300061734 Bacteria 2954
393 2831936206 2831935698 Bacteria 5963223
394 2867507190 2867507094 Bacteria 6506033
395 649812176 649633069 Bacteria 6962533
396 Ga0070712_100050011
397 JGI24739J22299_10000268
398 JGI24737J22298_10000441
399 JGI24735J21928_10001442
400 JGI24738J21930_10000543
401 JGI25406J46586_10029776
402 rootH1_10015619
403 Ga0070658_10048161
404 Ga0070658_10195196
405 Ga0070676_10160064
406 Ga0070683_100050448
407 Ga0070683_100117009
408 Ga0070683_100147365
409 Ga0070683_100244895
410 Ga0070683_100485712
411 Ga0070670_100035221
412 Ga0070677_10111730
413 Ga0068869_100073241
414 Ga0070680_100000498
415 Ga0070680_100007601
416 Ga0070680_100171704
417 Ga0070680_100396943
418 Ga0070680_100409537
419 Ga0070682_100017104
420 Ga0070682_100081579
421 Ga0068868_100178109
422 Ga0068868_100244762
423 Ga0070660_100034039
424 Ga0070660_100067154
425 Ga0070660_100110453
426 Ga0070660_100114758
427 Ga0070660_100120943
428 Ga0070660_100204934
429 Ga0070660_100309922
430 Ga0070660_100596922
431 Ga0070689_100099243
432 Ga0070661_100009426
433 Ga0070661_100024487
434 Ga0070661_100032005
435 Ga0070661_100124215
436 Ga0070661_100163228
437 Ga0070661_100238059
438 Ga0070692_10170570
439 Ga0070668_100050604
440 Ga0070675_100256435
441 Ga0070674_100031146
442 Ga0070659_100008405
443 Ga0070659_100010450
444 Ga0070659_100062138
445 Ga0070659_100073640
446 Ga0070659_100104835
447 Ga0070659_100135659
448 Ga0070659_100225649
449 Ga0070659_100567753
450 Ga0070714_100143070
451 Ga0070713_100309761
452 Ga0070700_100124037
453 Ga0070694_100008270
454 Ga0070708_100000450
455 Ga0070663_100030876
456 Ga0070663_100077748
457 Ga0070663_100124106
458 Ga0070663_100185852
459 Ga0070678_100044403
460 Ga0070662_100000934
461 Ga0070662_100026273
462 Ga0070662_100115688
463 Ga0070662_100209477
464 Ga0070681_10022967
465 Ga0070681_10095796
466 Ga0070681_10170236
467 Ga0070681_10297988
468 Ga0068867_100100087
469 Ga0070685_10041727
470 Ga0070685_10045673
471 Ga0070679_100392989
472 Ga0070684_100230928
473 Ga0070697_100240091
474 Ga0068853_100028472
475 Ga0068853_100184576
476 Ga0070672_100332522
477 Ga0070695_100061398
478 Ga0070696_100146902
479 Ga0070693_100032603
480 Ga0070664_100021723
481 Ga0070664_100036193
482 Ga0070664_100162806
483 Ga0070664_100564886
484 Ga0068857_100307116
485 Ga0068854_100023490
486 Ga0068854_100031688
487 Ga0068854_100125265
488 Ga0068856_100009582
489 Ga0068856_100123583
490 Ga0068856_100301588
491 Ga0068856_100692880
492 Ga0068852_100019340
493 Ga0068852_100064024
494 Ga0068852_100168568
495 Ga0068852_100216090
496 Ga0068859_100634624
497 Ga0068864_100026115
498 Ga0068864_100094741
499 Ga0068858_100018190
500 Ga0068860_100424225
501 Ga0081539_10000205
502 Ga0070717_10104251
503 Ga0068865_100588740
504 Ga0097620_100634643
505 Ga0105240_10244302
506 Ga0105245_10127784
507 Ga0105245_10399438
508 Ga0105243_10021985
509 Ga0105248_10190206
510 Ga0105248_10440234
511 Ga0105238_10068201
512 Ga0105238_10138752
513 Ga0105238_10450809
514 Ga0105238_10566236
515 Ga0105249_10401649
516 Ga0105239_10111021
517 Ga0105239_10172640
518 Ga0105239_10395389
519 Ga0105239_10723618
520 Ga0105246_10225552
521 Ga0157373_10045630
522 Ga0157371_10022761
523 Ga0157371_10040275
524 Ga0157371_10059222
525 Ga0157371_10317985
526 Ga0157371_10391800
527 Ga0157370_10019732
528 Ga0157370_10053017
529 Ga0157370_10138346
530 Ga0157370_10232147
531 Ga0157370_10283699
532 Ga0157370_10633014
533 Ga0157369_10010995
534 Ga0157369_10148583
535 Ga0157369_10169640
536 Ga0157369_10186843
537 Ga0157369_10194517
538 Ga0157369_10312647
539 Ga0157374_10057282
540 Ga0157374_10382952
541 Ga0157378_10716571
542 Ga0163162_10256074
543 Ga0163162_10260067
544 Ga0157372_10930744
545 Ga0157375_10007341
546 Ga0163163_10021138
547 Ga0157377_10023385
548 Ga0157379_10039154
549 Ga0163161_10078590
550 Ga0206353_11845874
551 Ga0207656_10003567
552 Ga0207682_10002781
553 Ga0207710_10032135
554 Ga0207688_10006748
555 Ga0207688_10069542
556 Ga0207647_10000316
557 Ga0207647_10001296
558 Ga0207647_10021376
559 Ga0207647_10025516
560 Ga0207647_10176964
561 Ga0207645_10009613
562 Ga0207643_10030576
563 Ga0207705_10007602
564 Ga0207705_10011928
565 Ga0207705_10013566
566 Ga0207705_10024445
567 Ga0207705_10027057
568 Ga0207705_10047397
569 Ga0207705_10076375
570 Ga0207705_10113009
571 Ga0207705_10216942
572 Ga0207707_10087614
573 Ga0207707_10390222
574 Ga0207695_10063837
575 Ga0207695_10181153
576 Ga0207693_10091114
577 Ga0207660_10003723
578 Ga0207660_10027396
579 Ga0207660_10036958
580 Ga0207660_10076133
581 Ga0207660_10094568
582 Ga0207657_10002718
583 Ga0207657_10004197
584 Ga0207657_10028389
585 Ga0207657_10047102
586 Ga0207657_10118084
587 Ga0207657_10247999
588 Ga0207649_10109244
589 Ga0207649_10266554
590 Ga0207649_10401386
591 Ga0207652_10113414
592 Ga0207650_10004837
593 Ga0207659_10171250
594 Ga0207664_10332742
595 Ga0207690_10049224
596 Ga0207690_10200257
597 Ga0207706_10000576
598 Ga0207706_10018713
599 Ga0207706_10027488
600 Ga0207706_10031538
601 Ga0207706_10069389
602 Ga0207706_10094670
603 Ga0207706_10123565
604 Ga0207669_10330376
605 Ga0207704_10661345
606 Ga0207691_10138426
607 Ga0207661_10170583
608 Ga0207661_10276906
609 Ga0207661_10503216
610 Ga0207679_10003185
611 Ga0207679_10118448
612 Ga0207667_10059329
613 Ga0207667_10162052
614 Ga0207667_10333857
615 Ga0207677_10504954
616 Ga0207703_10033833
617 Ga0207639_10041226
618 Ga0207639_10220274
619 Ga0207639_10376835
620 Ga0207678_10003211
621 Ga0207678_10006004
622 Ga0207678_10063883
623 Ga0207678_10089008
624 Ga0207678_10095011
625 Ga0207678_10224595
626 Ga0207678_10292614
627 Ga0207702_10000859
628 Ga0207702_10046091
629 Ga0207702_10046544
630 Ga0207702_10345115
631 Ga0207641_10107396
632 Ga0207648_10050136
633 Ga0207674_10052184
634 Ga0207674_10113480
635 Ga0207675_100025843
636 Ga0207683_10054767
637 Ga0207683_10066019
638 Ga0207683_10096792
639 Ga0207698_10044873
640 Ga0207698_10064986
641 Ga0207698_10065368
642 Ga0207698_10070344
643 Ga0207698_10121650
644 Ga0207698_10195545
645 Ga0307515_10005159
646 Ga0307515_10033135
647 Ga0307512_10003932
648 Ga0307513_10011704
649 Ga0307513_10099337
650 Ga0307408_100310765
651 Ga0307508_10029623
652 Ga0307405_10323756
653 Ga0307413_10000800
654 Ga0307413_10003571
655 Ga0307413_10069103
656 Ga0307413_10152228
657 Ga0307410_10001280
658 Ga0307410_10001493
659 Ga0307410_10020924
660 Ga0307410_10146813
661 Ga0307406_10110516
662 Ga0307407_10002484
663 Ga0307407_10003434
664 Ga0307412_10004071
665 Ga0307412_10005181
666 Ga0307412_10073074
667 Ga0307409_100002303
668 Ga0307409_100012072
669 Ga0307409_100029313
670 Ga0307409_100030125
671 Ga0307409_100057394
672 Ga0307409_100086788
673 Ga0307416_100002520
674 Ga0307416_100008074
675 Ga0307416_100160080
676 Ga0307416_100519386
677 Ga0307414_10001585
678 Ga0307414_10027396
679 Ga0307414_10028589
680 Ga0307414_10050858
681 Ga0307411_10000176
682 Ga0307411_10003932
683 Ga0307411_10023814
684 Ga0307415_100003198
685 Ga0307415_100276143
686 Ga0373960_0046249
687 Ga0373931_0060637
688 Ga0395899_0003579
689 Ga0395899_0064087
690 Ga0395899_0108665
691 Ga0395900_0012059
692 Ga0395900_0058574
693 Ga0395900_0069249
694 Ga0395900_0096087
695 Ga0395900_0343514
696 Ga0395898_0008311
697 Ga0395898_0308551
698 Ga0395905_0005688
699 Ga0395905_0084624
700 Ga0395905_0219073
701 Ga0395901_0000086
702 Ga0395901_0009588
703 Ga0395901_0155647
704 Ga0395901_0496046
705 Ga0436365_1487283
706 Ga0436363_0435808
707 Ga0439465_0062891
708 Ga0439432_015529
709 Ga0439449_0038548
710 Ga0450889_000034
711 Ga0466972_0033553
712 Ga0466965_0002894
713 Ga0466965_0003465
714 Ga0466961_0125091
715 Ga0466963_0011747
716 Ga0466968_0161403
717 Ga0466970_0001507
718 Ga0466957_0006527
719 Ga0466957_0116058
720 Ga0466957_0163100
721 Ga0466960_0090258
722 Ga0466959_0051736
723 Ga0466967_0111760
724 Ga0466967_0801537
725 Ga0495629_0006769
726 Ga0495608_0044555
727 Ga0495657_0018201
728 Ga0495599_0271772
729 Ga0496101_0090891
730 Ga0496105_0105012
731 Ga0496107_0090288
732 Ga0496108_0013567
733 Ga0496108_0333176
734 Ga0496111_0189819
735 Ga0496112_0127922
736 Ga0496113_0460102
737 Ga0496113_0511893
738 Ga0496114_0000084
739 Ga0496114_0055244
740 Ga0496115_0015861
741 Ga0496123_0014699
742 Ga0496125_0174705
743 Ga0496126_0003501
744 Ga0501032_0023283
745 Ga0501033_0098136
746 Ga0501033_0128407
747 Ga0501034_0001623
748 Ga0501036_0010896
749 Ga0501037_0033563
750 Ga0501038_0024615
751 Ga0501038_0444301
752 Ga0501039_0067039
753 Ga0501040_0014692
754 Ga0501041_0006654
755 Ga0501042_0000727
756 Ga0501043_0361721
757 Ga0501046_0085879
758 Ga0501048_0003892
759 Ga0501069_0031312
760 Ga0501071_0007715
761 Ga0501072_0008195
762 Ga0501073_0031562
763 Ga0501075_0010017
764 Ga0501076_0018219
765 Ga0501202_014892
766 Ga0501227_025912
767 Ga0501235_001571
768 Ga0501257_002119
769 Ga0501257_004449
770 Ga0501080_0075911
771 Ga0501081_0069664
772 Ga0501083_0151281
773 Ga0501268_003113
774 Ga0501283_003306
775 Ga0501035_0028568
776 Ga0501044_0000776
777 Ga0501044_0482039
778 Ga0501045_0010487
779 nmdc:mga08y16_264229_c1
780 Ga0500646_0003973
781 Ga0500641_0022062
782 Ga0500650_0050713
783 Ga0500556_0034455
784 Ga0501084_0061702
785 Ga0501082_0096183
786 Ga0530510_0052219
787 2831936206
788 2867507190
789 649812176

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02900

LigB

Catalytic LigB subunit of aromatic ring-opening dioxygenase

6

249

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pw6-assembly1.cif.gz_A-2 crystal structure of uncharacterized protein jw3007 from escherichia coli k12 0.8733 4 257
2pw6-assembly1.cif.gz_A-2 crystal structure of uncharacterized protein jw3007 from escherichia coli k12 0.8665 4 257
7txy-assembly2.cif.gz_E crystal structure of the 2-aminophenol 1,6-dioxygenase from the aro bacterial microcompartment of micromonospora rosaria 0.7846 4 255
3vsj-assembly1.cif.gz_D crystal structure of 1,6-apd (2-animophenol-1,6-dioxygenase) complexed with intermediate products 0.7406 4 255
5hee-assembly1.cif.gz_B crystal structure of the tk2203 protein 0.7327 4 256
ID Description Score Start End Superfamily
af_P24197_1_271_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.9183 2 257 3.40.830.10
af_Q54W77_1_267_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.8834 1 256 3.40.830.10
af_P24197_1_271_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.8668 2 257 3.40.830.10
2pw6A00 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.8608 5 257 3.40.830.10
2pw6A00 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.854 5 257 3.40.830.10
ID Description Score Start End GO Terms
AF-A0A845A672-F1-model_v4 4,5-DOPA dioxygenase extradiol (EC 1.13.11.29) 0.9396 1 257 GO:0008198
GO:0008270
GO:0016701
GO:0051213
AF-A0A254N974-F1-model_v4 Extradiol ring-cleavage dioxygenase class III enzyme subunit B domain-containing protein 0.9356 117 245 GO:0008198
GO:0008270
GO:0016701
AF-A0A2S0LW63-F1-model_v4 4,5-DOPA dioxygenase extradiol 0.9353 1 256 GO:0008198
GO:0008270
GO:0016701
GO:0051213
AF-A0A1A0SAQ4-F1-model_v4 deleted 0.9338 4 256
AF-A0A1Q4UH87-F1-model_v4 deleted 0.9335 4 255

Map