F432820

General Info

Members Datasets Scaffolds Average Seq Length
394 214 788 200

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_100125978|Ga0070659_1001259782
Length 230
Sequence VVSVRSAVRHGTGNMDAMADEHYFTADPQAAFKRIPVSANVWGHWLELTSGSGVFAQGRLDVGTGVLLREQPAPEGARRVLDLGCGYGVIGLAIAVAVPECTVTAIDVNERAVLLANENAAALGLGDRFTACPPDEVDAGATFDEIWSNPPIRIGKDALHALLLSWLPRLVPEGRARMVVGKNLGADSLAAWLSAQGFPTAKVASAKGFRVLESRRPLSHPAGAPVDEGG

Samples

Sample ID Description Type Environment
1 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
25 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
32 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
83 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
84 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
85 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
86 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
87 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
88 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
89 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
90 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
91 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
94 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
95 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
96 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
97 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
99 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
102 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
103 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
104 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
105 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
106 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
107 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
108 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
109 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
110 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
111 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
112 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
113 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
114 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
115 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
116 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
117 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
118 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
119 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
120 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
121 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
122 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
123 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
124 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
125 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
126 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
127 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
128 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
129 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
130 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
131 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
132 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
133 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
134 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
135 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
136 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
137 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
138 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
139 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
140 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
141 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
157 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
158 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
159 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
160 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
161 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
162 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
163 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
164 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
165 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
166 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
167 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
168 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
169 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
170 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
173 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
174 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
175 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
176 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
177 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
178 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
179 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
180 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
181 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
182 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
183 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
184 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
185 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
186 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
187 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
188 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
189 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
190 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
191 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
192 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
193 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
194 2643221615 Nocardioides sp. Root224 Isolate Unclassified
195 2643221641 Nocardioides sp. Root122 Isolate Unclassified
196 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
197 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
198 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
199 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
200 2739367898 Nocardioides sp. CF479 Isolate Unclassified
201 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
202 2857479173 Micrococcus sp. R-74225 Isolate Unclassified
203 2857632687 Micrococcus sp. R-73081 Isolate Unclassified
204 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
205 2870801768 Micrococcus endophyticus DSM 17945 Isolate Unclassified
206 2870804320 Micrococcus yunnanensis DSM 21948 Isolate Unclassified
207 2893684298 Kocuria palustris DSM 11925 Isolate Rhizosphere
208 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
209 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
210 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
211 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
212 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
213 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
214 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.42
Metatranscriptomes 0
Isolates 5.58

Biome Distribution

Category Percentage (%)
Aerial Root 0.51
Bulb 0
Endosphere 6.35
Nodule 0.25
Rhizoplane 4.82
Rhizosphere 82.99
Stem 0
Stem Tuber 0
Unclassified 0.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070659_100125978 3300005366 Bacteria 2078
2 Ga0070658_10189391 3300005327 Bacteria 1734
3 Ga0070683_100057679 3300005329 Bacteria 3608
4 Ga0070683_100733003 3300005329 Bacteria 947
5 Ga0070691_10114278 3300005341 Bacteria 1353
6 Ga0070687_100033487 3300005343 Bacteria 2537
7 Ga0070692_10027512 3300005345 Bacteria 2819
8 Ga0070668_100043295 3300005347 Bacteria 3453
9 Ga0070675_100313479 3300005354 Bacteria 1384
10 Ga0070674_100013387 3300005356 Bacteria 5069
11 Ga0070674_100078700 3300005356 Bacteria 2350
12 Ga0070674_100220867 3300005356 Bacteria 1474
13 Ga0070659_100042286 3300005366 Bacteria 3562
14 Ga0070659_100057412 3300005366 Bacteria 3069
15 Ga0070659_100201925 3300005366 Bacteria 1637
16 Ga0070700_100003053 3300005441 Bacteria 8574
17 Ga0070663_100145853 3300005455 Bacteria 1811
18 Ga0070663_100285256 3300005455 Bacteria 1317
19 Ga0070678_100028616 3300005456 Bacteria 3804
20 Ga0070662_100121488 3300005457 Bacteria 2003
21 Ga0070662_100355020 3300005457 Bacteria 1202
22 Ga0068867_100001157 3300005459 Bacteria 18043
23 Ga0070685_10022555 3300005466 Bacteria 3434
24 Ga0070698_100149542 3300005471 Bacteria 2283
25 Ga0070684_100033917 3300005535 Bacteria 4361
26 Ga0070684_100114121 3300005535 Bacteria 2425
27 Ga0068853_100256764 3300005539 Bacteria 1605
28 Ga0068853_100363380 3300005539 Bacteria 1349
29 Ga0070672_100054774 3300005543 Bacteria 3123
30 Ga0068855_100113150 3300005563 Bacteria 3114
31 Ga0068855_100383482 3300005563 Bacteria 1543
32 Ga0070664_100161503 3300005564 Bacteria 1983
33 Ga0068857_100375613 3300005577 Bacteria 1319
34 Ga0068861_100013764 3300005719 Bacteria 5666
35 Ga0068861_100072013 3300005719 Bacteria 2681
36 Ga0068851_10092999 3300005834 Bacteria 1590
37 Ga0068870_10025519 3300005840 Bacteria 2934
38 Ga0081455_10001393 3300005937 Bacteria 29861
39 Ga0081455_10064417 3300005937 Bacteria 3069
40 Ga0075365_10019626 3300006038 Bacteria 4177
41 Ga0075365_10057078 3300006038 Bacteria 2597
42 Ga0075365_10197278 3300006038 Bacteria 1410
43 Ga0075365_10445031 3300006038 Bacteria 915
44 Ga0075365_10499313 3300006038 Bacteria 860
45 Ga0075368_10025141 3300006042 Bacteria 2285
46 Ga0075363_100146567 3300006048 Bacteria 1331
47 Ga0075364_10139559 3300006051 Bacteria 1629
48 Ga0075432_10010677 3300006058 Bacteria 3121
49 Ga0075432_10020760 3300006058 Bacteria 2246
50 Ga0075362_10182262 3300006177 Bacteria 1018
51 Ga0075367_10001967 3300006178 Bacteria 9148
52 Ga0075367_10138156 3300006178 Bacteria 1508
53 Ga0075428_100004189 3300006844 Bacteria 15880
54 Ga0075428_100010070 3300006844 Bacteria 10503
55 Ga0075430_100191378 3300006846 Bacteria 1700
56 Ga0075431_100021145 3300006847 Bacteria 6649
57 Ga0075433_10001532 3300006852 Bacteria 17068
58 Ga0075433_10004903 3300006852 Bacteria 10474
59 Ga0075434_100005228 3300006871 Bacteria 11791
60 Ga0075434_100006176 3300006871 Bacteria 10969
61 Ga0075429_100026400 3300006880 Bacteria 5042
62 Ga0068865_100059219 3300006881 Bacteria 2678
63 Ga0075436_100003245 3300006914 Bacteria 11142
64 Ga0075435_100010972 3300007076 Bacteria 6642
65 Ga0075435_100068054 3300007076 Bacteria 2900
66 Ga0111539_10003621 3300009094 Bacteria 20353
67 Ga0111539_10067957 3300009094 Bacteria 4207
68 Ga0111539_10083024 3300009094 Bacteria 3768
69 Ga0111539_10712338 3300009094 Bacteria 1168
70 Ga0105245_10025530 3300009098 Bacteria 5197
71 Ga0105245_11260092 3300009098 Bacteria 788
72 Ga0114129_10001788 3300009147 Bacteria 29288
73 Ga0114129_10005056 3300009147 Bacteria 18560
74 Ga0105243_10119347 3300009148 Bacteria 2220
75 Ga0105243_10251808 3300009148 Bacteria 1577
76 Ga0105248_10024219 3300009177 Bacteria 6748
77 Ga0105238_10070727 3300009551 Bacteria 3488
78 Ga0105249_10024037 3300009553 Bacteria 5473
79 Ga0105239_10056658 3300010375 Bacteria 4299
80 Ga0105239_11417882 3300010375 Bacteria 802
81 Ga0105246_10288050 3300011119 Bacteria 1320
82 Ga0105246_10294055 3300011119 Bacteria 1308
83 Ga0105246_10313578 3300011119 Bacteria 1271
84 Ga0157369_10203065 3300013105 Bacteria 2080
85 Ga0157369_11170522 3300013105 Bacteria 785
86 Ga0157374_11050449 3300013296 Bacteria 834
87 Ga0157372_10024386 3300013307 Bacteria 6570
88 Ga0157372_10931222 3300013307 Bacteria 1007
89 Ga0157375_11042244 3300013308 Bacteria 956
90 Ga0163163_10030703 3300014325 Bacteria 5180
91 Ga0157380_10181061 3300014326 Bacteria 1851
92 Ga0157380_10230693 3300014326 Bacteria 1662
93 Ga0157380_10275876 3300014326 Bacteria 1535
94 Ga0157380_10834157 3300014326 Bacteria 942
95 Ga0157377_10009358 3300014745 Bacteria 4802
96 Ga0163161_10712527 3300017792 Bacteria 836
97 Ga0207688_10012264 3300025901 Bacteria 4663
98 Ga0207647_10011965 3300025904 Bacteria 6057
99 Ga0207647_10393264 3300025904 Bacteria 782
100 Ga0207705_10180805 3300025909 Bacteria 1592
101 Ga0207705_10211711 3300025909 Bacteria 1470
102 Ga0207662_10012174 3300025918 Bacteria 4789
103 Ga0207659_10104753 3300025926 Bacteria 2139
104 Ga0207690_10029205 3300025932 Bacteria 3503
105 Ga0207690_10134401 3300025932 Bacteria 1814
106 Ga0207690_10418705 3300025932 Bacteria 1071
107 Ga0207706_10031843 3300025933 Bacteria 4697
108 Ga0207706_10157445 3300025933 Bacteria 1997
109 Ga0207669_10012794 3300025937 Bacteria 4140
110 Ga0207669_10085339 3300025937 Bacteria 2038
111 Ga0207704_10075607 3300025938 Bacteria 2154
112 Ga0207704_10094596 3300025938 Bacteria 1973
113 Ga0207691_10018301 3300025940 Bacteria 6636
114 Ga0207661_10060972 3300025944 Bacteria 3046
115 Ga0207679_10318936 3300025945 Bacteria 1345
116 Ga0207667_10043600 3300025949 Bacteria 4760
117 Ga0207651_10153680 3300025960 Bacteria 1795
118 Ga0207668_10879660 3300025972 Bacteria 796
119 Ga0207640_10036287 3300025981 Bacteria 3094
120 Ga0207677_10057658 3300026023 Bacteria 2668
121 Ga0207677_10607552 3300026023 Bacteria 960
122 Ga0207677_10859962 3300026023 Bacteria 815
123 Ga0207678_10176060 3300026067 Bacteria 1826
124 Ga0207678_10489447 3300026067 Bacteria 1071
125 Ga0207708_10001069 3300026075 Bacteria 20541
126 Ga0207648_10006828 3300026089 Bacteria 11307
127 Ga0207675_100003538 3300026118 Bacteria 15239
128 Ga0207675_100099845 3300026118 Bacteria 2734
129 Ga0207698_10236187 3300026142 Bacteria 1663
130 Ga0207428_10000964 3300027907 Bacteria 31921
131 Ga0207428_10003341 3300027907 Bacteria 15600
132 Ga0207428_10012982 3300027907 Bacteria 7298
133 Ga0307515_10286627 3300028794 Bacteria 1347
134 Ga0307408_100009777 3300031548 Bacteria 6324
135 Ga0307408_100049546 3300031548 Bacteria 3017
136 Ga0307405_10003771 3300031731 Bacteria 7040
137 Ga0307405_10113192 3300031731 Bacteria 1842
138 Ga0307405_10119663 3300031731 Bacteria 1800
139 Ga0307405_10532070 3300031731 Bacteria 948
140 Ga0307405_10622138 3300031731 Bacteria 884
141 Ga0307413_10000819 3300031824 Bacteria 10863
142 Ga0307413_10097691 3300031824 Bacteria 1932
143 Ga0307413_10151810 3300031824 Bacteria 1615
144 Ga0307413_10228510 3300031824 Bacteria 1364
145 Ga0307413_10278540 3300031824 Bacteria 1257
146 Ga0307413_10977653 3300031824 Bacteria 724
147 Ga0307410_10000502 3300031852 Bacteria 15911
148 Ga0307410_10091447 3300031852 Bacteria 2160
149 Ga0307410_10136204 3300031852 Bacteria 1811
150 Ga0307410_10169278 3300031852 Bacteria 1644
151 Ga0307410_10200448 3300031852 Bacteria 1523
152 Ga0307410_10346623 3300031852 Bacteria 1185
153 Ga0307406_10000895 3300031901 Bacteria 16751
154 Ga0307406_10010836 3300031901 Bacteria 5152
155 Ga0307406_10031355 3300031901 Bacteria 3236
156 Ga0307406_10302300 3300031901 Bacteria 1230
157 Ga0307407_10003877 3300031903 Bacteria 6234
158 Ga0307407_10015101 3300031903 Bacteria 3804
159 Ga0307407_10162421 3300031903 Bacteria 1463
160 Ga0307412_10005890 3300031911 Bacteria 6904
161 Ga0307412_10010230 3300031911 Bacteria 5400
162 Ga0307412_10030812 3300031911 Bacteria 3382
163 Ga0307412_10557321 3300031911 Bacteria 964
164 Ga0307412_10640484 3300031911 Bacteria 905
165 Ga0307409_100000050 3300031995 Bacteria 42042
166 Ga0307409_100077904 3300031995 Bacteria 2664
167 Ga0307409_100135751 3300031995 Bacteria 2111
168 Ga0307409_100236440 3300031995 Bacteria 1660
169 Ga0307409_100243938 3300031995 Bacteria 1637
170 Ga0307409_100360129 3300031995 Bacteria 1376
171 Ga0307409_101189187 3300031995 Bacteria 785
172 Ga0307416_100000150 3300032002 Bacteria 41366
173 Ga0307416_100023779 3300032002 Bacteria 4456
174 Ga0307416_100340330 3300032002 Bacteria 1513
175 Ga0307416_100421753 3300032002 Bacteria 1379
176 Ga0307414_10035357 3300032004 Bacteria 3324
177 Ga0307414_10073770 3300032004 Bacteria 2470
178 Ga0307414_10202242 3300032004 Bacteria 1617
179 Ga0307414_10329125 3300032004 Bacteria 1303
180 Ga0307411_10103886 3300032005 Bacteria 2016
181 Ga0307411_10562965 3300032005 Bacteria 974
182 Ga0307411_10591869 3300032005 Bacteria 952
183 Ga0307411_10631075 3300032005 Bacteria 925
184 Ga0307411_10776338 3300032005 Bacteria 842
185 Ga0307415_100050871 3300032126 Bacteria 2810
186 Ga0307415_100054882 3300032126 Bacteria 2723
187 Ga0307415_100115062 3300032126 Bacteria 2004
188 Ga0307415_100194620 3300032126 Bacteria 1603
189 Ga0307415_100511946 3300032126 Unclassified 1051
190 Ga0373932_0074714 3300035112 Bacteria 1059
191 Ga0373925_0000051 3300037068 Bacteria 127667
192 Ga0395900_0016920 3300037418 Bacteria 7443
193 Ga0395898_0268023 3300037466 Bacteria 1628
194 Ga0395898_0428346 3300037466 Bacteria 1261
195 Ga0395901_0581641 3300038443 Bacteria 1131
196 Ga0439465_0044346 3300041413 Bacteria 1445
197 Ga0451791_0697971 3300041451 Bacteria 1719
198 Ga0451802_0039098 3300041460 Bacteria 809
199 Ga0451837_1200761 3300041494 Bacteria 1284
200 Ga0451839_0761384 3300041496 Bacteria 838
201 Ga0451845_0158049 3300041501 Bacteria 798
202 Ga0451843_0835893 3300041509 Bacteria 1889
203 Ga0451843_0994575 3300041509 Bacteria 987
204 Ga0451853_3907366 3300041512 Bacteria 3179
205 Ga0439433_0077670 3300041999 Bacteria 805
206 Ga0439444_0048195 3300042437 Bacteria 858
207 Ga0439464_0019043 3300042439 Bacteria 1872
208 Ga0439440_0000923 3300042993 Bacteria 5142
209 Ga0439440_0000938 3300042993 Bacteria 5113
210 Ga0439440_0014866 3300042993 Bacteria 1685
211 Ga0466972_0025225 3300044658 Bacteria 2948
212 Ga0466972_0031442 3300044658 Bacteria 2610
213 Ga0466965_0059397 3300044683 Bacteria 1908
214 Ga0466965_0065674 3300044683 Bacteria 1818
215 Ga0466961_0015515 3300044693 Bacteria 4888
216 Ga0466963_0139830 3300044694 Bacteria 1677
217 Ga0466964_0006136 3300044706 Bacteria 4479
218 Ga0466964_0037776 3300044706 Bacteria 1940
219 Ga0466971_0014771 3300044719 Bacteria 3436
220 Ga0466970_0013265 3300044765 Bacteria 4224
221 Ga0466957_0002263 3300044842 Bacteria 10314
222 Ga0466958_0008461 3300045836 Bacteria 5710
223 Ga0466967_0059035 3300045976 Bacteria 3393
224 Ga0466967_0111693 3300045976 Bacteria 2512
225 Ga0495638_0070528 3300046460 Bacteria 2139
226 Ga0495641_0046515 3300046461 Bacteria 1995
227 Ga0495653_0007467 3300046463 Bacteria 8940
228 Ga0495620_0044691 3300046515 Bacteria 1923
229 Ga0495644_0102189 3300046523 Bacteria 1085
230 Ga0495663_0184897 3300046525 Unclassified 723
231 Ga0495640_0302499 3300046533 Bacteria 993
232 Ga0495660_0097302 3300046810 Bacteria 1520
233 Ga0495686_0073402 3300047472 Bacteria 2102
234 Ga0496100_0804759 3300048903 Bacteria 736
235 Ga0496102_0527114 3300048905 Bacteria 1104
236 Ga0496108_0009261 3300048911 Bacteria 7967
237 Ga0496108_0063596 3300048911 Bacteria 3108
238 Ga0496109_0058757 3300048912 Bacteria 3513
239 Ga0496109_0336184 3300048912 Bacteria 1426
240 Ga0496109_0631989 3300048912 Bacteria 1007
241 Ga0496110_0054752 3300048913 Bacteria 3509
242 Ga0496110_0114661 3300048913 Bacteria 2425
243 Ga0496110_0203331 3300048913 Bacteria 1800
244 Ga0496110_0595114 3300048913 Bacteria 1004
245 Ga0496111_0605519 3300048914 Bacteria 802
246 Ga0496113_0070502 3300048916 Bacteria 2657
247 Ga0496113_0260025 3300048916 Bacteria 1387
248 Ga0496114_0202158 3300048917 Bacteria 1740
249 Ga0496114_0274045 3300048917 Bacteria 1487
250 Ga0496114_0824620 3300048917 Bacteria 807
251 Ga0496118_0188679 3300048921 Bacteria 1235
252 Ga0501031_0003208 3300049568 Bacteria 10493
253 Ga0501031_0052559 3300049568 Bacteria 2655
254 Ga0501031_0282948 3300049568 Bacteria 1076
255 Ga0501032_0016498 3300049569 Bacteria 5194
256 Ga0501033_0066223 3300049570 Bacteria 2656
257 Ga0501033_0117420 3300049570 Bacteria 1933
258 Ga0501033_0533695 3300049570 Bacteria 809
259 Ga0501034_0021227 3300049571 Bacteria 6623
260 Ga0501034_0099408 3300049571 Bacteria 2904
261 Ga0501034_0105976 3300049571 Bacteria 2804
262 Ga0501034_0308939 3300049571 Bacteria 1516
263 Ga0501036_0006349 3300049572 Bacteria 9592
264 Ga0501036_0060551 3300049572 Bacteria 3207
265 Ga0501036_0075789 3300049572 Bacteria 2845
266 Ga0501036_0148203 3300049572 Bacteria 1979
267 Ga0501036_0423557 3300049572 Bacteria 1110
268 Ga0501037_0003345 3300049573 Bacteria 11655
269 Ga0501037_0061368 3300049573 Bacteria 2741
270 Ga0501037_0110443 3300049573 Bacteria 1981
271 Ga0501038_0001608 3300049574 Bacteria 20970
272 Ga0501038_0008686 3300049574 Bacteria 9327
273 Ga0501038_0079139 3300049574 Bacteria 2772
274 Ga0501039_0028763 3300049575 Bacteria 4279
275 Ga0501039_0063725 3300049575 Bacteria 2856
276 Ga0501039_0096071 3300049575 Bacteria 2310
277 Ga0501039_0187873 3300049575 Bacteria 1625
278 Ga0501039_0250706 3300049575 Bacteria 1392
279 Ga0501039_0281587 3300049575 Bacteria 1307
280 Ga0501040_0076695 3300049576 Bacteria 2311
281 Ga0501040_0268445 3300049576 Bacteria 1218
282 Ga0501041_0109948 3300049577 Bacteria 1710
283 Ga0501041_0274275 3300049577 Bacteria 1061
284 Ga0501041_0336417 3300049577 Bacteria 953
285 Ga0501042_0008843 3300049578 Bacteria 6677
286 Ga0501042_0011839 3300049578 Bacteria 5893
287 Ga0501042_0077983 3300049578 Bacteria 2372
288 Ga0501042_0139784 3300049578 Bacteria 1746
289 Ga0501042_0205340 3300049578 Bacteria 1421
290 Ga0501042_0366542 3300049578 Bacteria 1042
291 Ga0501042_0397861 3300049578 Bacteria 998
292 Ga0501043_0027852 3300049579 Bacteria 4435
293 Ga0501043_0085069 3300049579 Bacteria 2485
294 Ga0501043_0159884 3300049579 Bacteria 1760
295 Ga0501043_0268325 3300049579 Bacteria 1311
296 Ga0501046_0004864 3300049580 Bacteria 12102
297 Ga0501046_0024932 3300049580 Bacteria 4900
298 Ga0501046_0127455 3300049580 Bacteria 1932
299 Ga0501047_0008061 3300049581 Bacteria 9939
300 Ga0501047_0092988 3300049581 Bacteria 2894
301 Ga0501048_0002442 3300049582 Bacteria 14185
302 Ga0501048_0004741 3300049582 Bacteria 10354
303 Ga0501048_0078811 3300049582 Bacteria 2325
304 Ga0501048_0464155 3300049582 Bacteria 907
305 Ga0501048_0513121 3300049582 Bacteria 860
306 Ga0501067_0098714 3300049583 Bacteria 1622
307 Ga0501068_0228226 3300049584 Bacteria 1184
308 Ga0501069_0162962 3300049585 Bacteria 1284
309 Ga0501069_0279261 3300049585 Bacteria 977
310 Ga0501069_0331818 3300049585 Bacteria 895
311 Ga0501070_0059671 3300049586 Bacteria 3162
312 Ga0501070_0128132 3300049586 Bacteria 2097
313 Ga0501070_0397345 3300049586 Bacteria 1115
314 Ga0501071_0009725 3300049587 Bacteria 6415
315 Ga0501071_0717554 3300049587 Bacteria 770
316 Ga0501072_0106379 3300049588 Bacteria 2231
317 Ga0501072_0761133 3300049588 Bacteria 759
318 Ga0501074_0050824 3300049590 Bacteria 2992
319 Ga0501074_0538447 3300049590 Bacteria 827
320 Ga0501075_0049033 3300049591 Bacteria 3174
321 Ga0501075_0122909 3300049591 Bacteria 1976
322 Ga0501075_0590425 3300049591 Bacteria 847
323 Ga0501076_0643438 3300049592 Bacteria 875
324 Ga0501077_0029709 3300049593 Bacteria 3476
325 Ga0501209_069645 3300049656 Bacteria 998
326 Ga0501079_0518749 3300049741 Bacteria 937
327 Ga0501080_0017838 3300049742 Bacteria 6571
328 Ga0501080_0041844 3300049742 Bacteria 4268
329 Ga0501081_0076635 3300049743 Bacteria 2335
330 Ga0501081_0383513 3300049743 Bacteria 1039
331 Ga0501035_0008507 3300049822 Bacteria 9554
332 Ga0501035_0011104 3300049822 Bacteria 8340
333 Ga0501044_0022059 3300049823 Bacteria 6790
334 Ga0501044_0076141 3300049823 Bacteria 3406
335 Ga0501045_0025222 3300049824 Bacteria 4272
336 Ga0501045_0100767 3300049824 Bacteria 2138
337 Ga0501045_0238869 3300049824 Bacteria 1353
338 Ga0501045_0458521 3300049824 Bacteria 947
339 Ga0501045_0543292 3300049824 Bacteria 862
340 Ga0501045_0750653 3300049824 Bacteria 719
341 nmdc:mga00v17_232151_c1 3300050491 Bacteria 1195
342 nmdc:mga00v17_379397_c1 3300050491 Bacteria 919
343 nmdc:mga0yw44_168821_c1 3300050492 Bacteria 1436
344 nmdc:mga0yw44_173645_c1 3300050492 Bacteria 1416
345 nmdc:mga0yw44_519005_c1 3300050492 Bacteria 808
346 nmdc:mga0yw44_637743_c1 3300050492 Bacteria 724
347 nmdc:mga06z11_113673_c1 3300050494 Bacteria 1502
348 nmdc:mga06z11_2449_c1 3300050494 Bacteria 7080
349 nmdc:mga05p37_160760_c1 3300050507 Bacteria 2743
350 nmdc:mga05p37_173448_c1 3300050507 Bacteria 2629
351 nmdc:mga05p37_61088_c1 3300050507 Bacteria 4640
352 nmdc:mga0qj67_449459_c1 3300050509 Bacteria 1038
353 nmdc:mga06r32_86664_c1 3300050510 Bacteria 3054
354 nmdc:mga08y16_41002_c1 3300050511 Bacteria 4850
355 nmdc:mga08y16_741993_c1 3300050511 Bacteria 979
356 nmdc:mga0n895_234230_c1 3300050512 Bacteria 1864
357 nmdc:mga0n895_6199_c1 3300050512 Bacteria 10115
358 nmdc:mga0rr50_40923_c1 3300050513 Bacteria 3372
359 nmdc:mga0rr50_45694_c1 3300050513 Bacteria 3221
360 nmdc:mga08x19_4005_c1 3300050514 Bacteria 8768
361 nmdc:mga0a205_32479_c1 3300050515 Bacteria 5005
362 nmdc:mga0sz30_250558_c1 3300050516 Bacteria 788
363 Ga0495655_0051768 3300053083 Bacteria 1090
364 Ga0500556_0001877 3300053104 Bacteria 7544
365 Ga0500593_000062 3300053117 Bacteria 39716
366 Ga0500593_000363 3300053117 Bacteria 18295
367 Ga0500559_0000496 3300053136 Bacteria 27644
368 Ga0500616_0155372 3300053153 Bacteria 1054
369 Ga0501084_0059100 3300054114 Bacteria 3208
370 Ga0501082_0160093 3300060353 Bacteria 1956
371 Ga0501082_0231854 3300060353 Bacteria 1607
372 Ga0466962_0015985 3300061719 Bacteria 3621
373 2515851645 2515154155 Bacteria 7985436
374 2644091125 2643221615 Bacteria 5487866
375 2644229183 2643221641 Bacteria 4490190
376 2644320928 2643221657 Bacteria 5490246
377 2645720790 2643221961 Bacteria 3919167
378 2645723800 2643221962 Bacteria 3874254
379 2723642616 2721755702 Bacteria 4373124
380 2740168017 2739367898 Bacteria 4367674
381 2852680380 2852677369 Bacteria 3768884
382 2857479246 2857479173 Bacteria 2469263
383 2857633515 2857632687 Bacteria 2448521
384 2861525544 2861520306 Bacteria 8348283
385 2870802931 2870801768 Bacteria 2710986
386 2870804998 2870804320 Bacteria 2552467
387 2893684880 2893684298 Bacteria 2897960
388 2919443194 2919443155 Bacteria 4072969
389 2966923906 2966921586 Bacteria 3092803
390 2984579722 2984576629 Bacteria 4248407
391 2990257328 2990256926 Bacteria 4252839
392 3001891781 3001889506 Bacteria 2975194
393 8054613781 8054609563 Bacteria 5170090
394 8057570064 8057568493 Bacteria 7221719
395 Ga0070659_100125978
396 Ga0070658_10189391
397 Ga0070683_100057679
398 Ga0070683_100733003
399 Ga0070691_10114278
400 Ga0070687_100033487
401 Ga0070692_10027512
402 Ga0070668_100043295
403 Ga0070675_100313479
404 Ga0070674_100013387
405 Ga0070674_100078700
406 Ga0070674_100220867
407 Ga0070659_100042286
408 Ga0070659_100057412
409 Ga0070659_100201925
410 Ga0070700_100003053
411 Ga0070663_100145853
412 Ga0070663_100285256
413 Ga0070678_100028616
414 Ga0070662_100121488
415 Ga0070662_100355020
416 Ga0068867_100001157
417 Ga0070685_10022555
418 Ga0070698_100149542
419 Ga0070684_100033917
420 Ga0070684_100114121
421 Ga0068853_100256764
422 Ga0068853_100363380
423 Ga0070672_100054774
424 Ga0068855_100113150
425 Ga0068855_100383482
426 Ga0070664_100161503
427 Ga0068857_100375613
428 Ga0068861_100013764
429 Ga0068861_100072013
430 Ga0068851_10092999
431 Ga0068870_10025519
432 Ga0081455_10001393
433 Ga0081455_10064417
434 Ga0075365_10019626
435 Ga0075365_10057078
436 Ga0075365_10197278
437 Ga0075365_10445031
438 Ga0075365_10499313
439 Ga0075368_10025141
440 Ga0075363_100146567
441 Ga0075364_10139559
442 Ga0075432_10010677
443 Ga0075432_10020760
444 Ga0075362_10182262
445 Ga0075367_10001967
446 Ga0075367_10138156
447 Ga0075428_100004189
448 Ga0075428_100010070
449 Ga0075430_100191378
450 Ga0075431_100021145
451 Ga0075433_10001532
452 Ga0075433_10004903
453 Ga0075434_100005228
454 Ga0075434_100006176
455 Ga0075429_100026400
456 Ga0068865_100059219
457 Ga0075436_100003245
458 Ga0075435_100010972
459 Ga0075435_100068054
460 Ga0111539_10003621
461 Ga0111539_10067957
462 Ga0111539_10083024
463 Ga0111539_10712338
464 Ga0105245_10025530
465 Ga0105245_11260092
466 Ga0114129_10001788
467 Ga0114129_10005056
468 Ga0105243_10119347
469 Ga0105243_10251808
470 Ga0105248_10024219
471 Ga0105238_10070727
472 Ga0105249_10024037
473 Ga0105239_10056658
474 Ga0105239_11417882
475 Ga0105246_10288050
476 Ga0105246_10294055
477 Ga0105246_10313578
478 Ga0157369_10203065
479 Ga0157369_11170522
480 Ga0157374_11050449
481 Ga0157372_10024386
482 Ga0157372_10931222
483 Ga0157375_11042244
484 Ga0163163_10030703
485 Ga0157380_10181061
486 Ga0157380_10230693
487 Ga0157380_10275876
488 Ga0157380_10834157
489 Ga0157377_10009358
490 Ga0163161_10712527
491 Ga0207688_10012264
492 Ga0207647_10011965
493 Ga0207647_10393264
494 Ga0207705_10180805
495 Ga0207705_10211711
496 Ga0207662_10012174
497 Ga0207659_10104753
498 Ga0207690_10029205
499 Ga0207690_10134401
500 Ga0207690_10418705
501 Ga0207706_10031843
502 Ga0207706_10157445
503 Ga0207669_10012794
504 Ga0207669_10085339
505 Ga0207704_10075607
506 Ga0207704_10094596
507 Ga0207691_10018301
508 Ga0207661_10060972
509 Ga0207679_10318936
510 Ga0207667_10043600
511 Ga0207651_10153680
512 Ga0207668_10879660
513 Ga0207640_10036287
514 Ga0207677_10057658
515 Ga0207677_10607552
516 Ga0207677_10859962
517 Ga0207678_10176060
518 Ga0207678_10489447
519 Ga0207708_10001069
520 Ga0207648_10006828
521 Ga0207675_100003538
522 Ga0207675_100099845
523 Ga0207698_10236187
524 Ga0207428_10000964
525 Ga0207428_10003341
526 Ga0207428_10012982
527 Ga0307515_10286627
528 Ga0307408_100009777
529 Ga0307408_100049546
530 Ga0307405_10003771
531 Ga0307405_10113192
532 Ga0307405_10119663
533 Ga0307405_10532070
534 Ga0307405_10622138
535 Ga0307413_10000819
536 Ga0307413_10097691
537 Ga0307413_10151810
538 Ga0307413_10228510
539 Ga0307413_10278540
540 Ga0307413_10977653
541 Ga0307410_10000502
542 Ga0307410_10091447
543 Ga0307410_10136204
544 Ga0307410_10169278
545 Ga0307410_10200448
546 Ga0307410_10346623
547 Ga0307406_10000895
548 Ga0307406_10010836
549 Ga0307406_10031355
550 Ga0307406_10302300
551 Ga0307407_10003877
552 Ga0307407_10015101
553 Ga0307407_10162421
554 Ga0307412_10005890
555 Ga0307412_10010230
556 Ga0307412_10030812
557 Ga0307412_10557321
558 Ga0307412_10640484
559 Ga0307409_100000050
560 Ga0307409_100077904
561 Ga0307409_100135751
562 Ga0307409_100236440
563 Ga0307409_100243938
564 Ga0307409_100360129
565 Ga0307409_101189187
566 Ga0307416_100000150
567 Ga0307416_100023779
568 Ga0307416_100340330
569 Ga0307416_100421753
570 Ga0307414_10035357
571 Ga0307414_10073770
572 Ga0307414_10202242
573 Ga0307414_10329125
574 Ga0307411_10103886
575 Ga0307411_10562965
576 Ga0307411_10591869
577 Ga0307411_10631075
578 Ga0307411_10776338
579 Ga0307415_100050871
580 Ga0307415_100054882
581 Ga0307415_100115062
582 Ga0307415_100194620
583 Ga0307415_100511946
584 Ga0373932_0074714
585 Ga0373925_0000051
586 Ga0395900_0016920
587 Ga0395898_0268023
588 Ga0395898_0428346
589 Ga0395901_0581641
590 Ga0439465_0044346
591 Ga0451791_0697971
592 Ga0451802_0039098
593 Ga0451837_1200761
594 Ga0451839_0761384
595 Ga0451845_0158049
596 Ga0451843_0835893
597 Ga0451843_0994575
598 Ga0451853_3907366
599 Ga0439433_0077670
600 Ga0439444_0048195
601 Ga0439464_0019043
602 Ga0439440_0000923
603 Ga0439440_0000938
604 Ga0439440_0014866
605 Ga0466972_0025225
606 Ga0466972_0031442
607 Ga0466965_0059397
608 Ga0466965_0065674
609 Ga0466961_0015515
610 Ga0466963_0139830
611 Ga0466964_0006136
612 Ga0466964_0037776
613 Ga0466971_0014771
614 Ga0466970_0013265
615 Ga0466957_0002263
616 Ga0466958_0008461
617 Ga0466967_0059035
618 Ga0466967_0111693
619 Ga0495638_0070528
620 Ga0495641_0046515
621 Ga0495653_0007467
622 Ga0495620_0044691
623 Ga0495644_0102189
624 Ga0495663_0184897
625 Ga0495640_0302499
626 Ga0495660_0097302
627 Ga0495686_0073402
628 Ga0496100_0804759
629 Ga0496102_0527114
630 Ga0496108_0009261
631 Ga0496108_0063596
632 Ga0496109_0058757
633 Ga0496109_0336184
634 Ga0496109_0631989
635 Ga0496110_0054752
636 Ga0496110_0114661
637 Ga0496110_0203331
638 Ga0496110_0595114
639 Ga0496111_0605519
640 Ga0496113_0070502
641 Ga0496113_0260025
642 Ga0496114_0202158
643 Ga0496114_0274045
644 Ga0496114_0824620
645 Ga0496118_0188679
646 Ga0501031_0003208
647 Ga0501031_0052559
648 Ga0501031_0282948
649 Ga0501032_0016498
650 Ga0501033_0066223
651 Ga0501033_0117420
652 Ga0501033_0533695
653 Ga0501034_0021227
654 Ga0501034_0099408
655 Ga0501034_0105976
656 Ga0501034_0308939
657 Ga0501036_0006349
658 Ga0501036_0060551
659 Ga0501036_0075789
660 Ga0501036_0148203
661 Ga0501036_0423557
662 Ga0501037_0003345
663 Ga0501037_0061368
664 Ga0501037_0110443
665 Ga0501038_0001608
666 Ga0501038_0008686
667 Ga0501038_0079139
668 Ga0501039_0028763
669 Ga0501039_0063725
670 Ga0501039_0096071
671 Ga0501039_0187873
672 Ga0501039_0250706
673 Ga0501039_0281587
674 Ga0501040_0076695
675 Ga0501040_0268445
676 Ga0501041_0109948
677 Ga0501041_0274275
678 Ga0501041_0336417
679 Ga0501042_0008843
680 Ga0501042_0011839
681 Ga0501042_0077983
682 Ga0501042_0139784
683 Ga0501042_0205340
684 Ga0501042_0366542
685 Ga0501042_0397861
686 Ga0501043_0027852
687 Ga0501043_0085069
688 Ga0501043_0159884
689 Ga0501043_0268325
690 Ga0501046_0004864
691 Ga0501046_0024932
692 Ga0501046_0127455
693 Ga0501047_0008061
694 Ga0501047_0092988
695 Ga0501048_0002442
696 Ga0501048_0004741
697 Ga0501048_0078811
698 Ga0501048_0464155
699 Ga0501048_0513121
700 Ga0501067_0098714
701 Ga0501068_0228226
702 Ga0501069_0162962
703 Ga0501069_0279261
704 Ga0501069_0331818
705 Ga0501070_0059671
706 Ga0501070_0128132
707 Ga0501070_0397345
708 Ga0501071_0009725
709 Ga0501071_0717554
710 Ga0501072_0106379
711 Ga0501072_0761133
712 Ga0501074_0050824
713 Ga0501074_0538447
714 Ga0501075_0049033
715 Ga0501075_0122909
716 Ga0501075_0590425
717 Ga0501076_0643438
718 Ga0501077_0029709
719 Ga0501209_069645
720 Ga0501079_0518749
721 Ga0501080_0017838
722 Ga0501080_0041844
723 Ga0501081_0076635
724 Ga0501081_0383513
725 Ga0501035_0008507
726 Ga0501035_0011104
727 Ga0501044_0022059
728 Ga0501044_0076141
729 Ga0501045_0025222
730 Ga0501045_0100767
731 Ga0501045_0238869
732 Ga0501045_0458521
733 Ga0501045_0543292
734 Ga0501045_0750653
735 nmdc:mga00v17_232151_c1
736 nmdc:mga00v17_379397_c1
737 nmdc:mga0yw44_168821_c1
738 nmdc:mga0yw44_173645_c1
739 nmdc:mga0yw44_519005_c1
740 nmdc:mga0yw44_637743_c1
741 nmdc:mga06z11_113673_c1
742 nmdc:mga06z11_2449_c1
743 nmdc:mga05p37_160760_c1
744 nmdc:mga05p37_173448_c1
745 nmdc:mga05p37_61088_c1
746 nmdc:mga0qj67_449459_c1
747 nmdc:mga06r32_86664_c1
748 nmdc:mga08y16_41002_c1
749 nmdc:mga08y16_741993_c1
750 nmdc:mga0n895_234230_c1
751 nmdc:mga0n895_6199_c1
752 nmdc:mga0rr50_40923_c1
753 nmdc:mga0rr50_45694_c1
754 nmdc:mga08x19_4005_c1
755 nmdc:mga0a205_32479_c1
756 nmdc:mga0sz30_250558_c1
757 Ga0495655_0051768
758 Ga0500556_0001877
759 Ga0500593_000062
760 Ga0500593_000363
761 Ga0500559_0000496
762 Ga0500616_0155372
763 Ga0501084_0059100
764 Ga0501082_0160093
765 Ga0501082_0231854
766 Ga0466962_0015985
767 2515851645
768 2644091125
769 2644229183
770 2644320928
771 2645720790
772 2645723800
773 2723642616
774 2740168017
775 2852680380
776 2857479246
777 2857633515
778 2861525544
779 2870802931
780 2870804998
781 2893684880
782 2919443194
783 2966923906
784 2984579722
785 2990257328
786 3001891781
787 8054613781
788 8057570064

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05175

MTS

Methyltransferase small domain

45

213

0.9

PF13649

Methyltransf_25

Methyltransferase domain

80

174

0.85

PF06325

PrmA

Ribosomal protein L11 methyltransferase (PrmA)

66

199

0.83

PF13847

Methyltransf_31

Methyltransferase domain

74

163

0.81

PF10294

Methyltransf_16

Lysine methyltransferase

34

130

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
1dus-assembly1.cif.gz_A mj0882-a hypothetical protein from m. jannaschii 0.8856 10 199
1dus-assembly1.cif.gz_A mj0882-a hypothetical protein from m. jannaschii 0.8643 10 199
5fcd-assembly2.cif.gz_B crystal structure of mccd protein 0.8501 61 162
5eeg-assembly1.cif.gz_A crystal structure of carminomycin-4-o-methyltransferase dnrk in complex with tetrazole-sah 0.8448 59 200
7phf-assembly2.cif.gz_D chimeric carminomycin-4-o-methyltransferase (dnrk) with regions from 10-hydroxylase rdmb and 10-decarboxylase tamk 0.8418 59 200
ID Description Score Start End Superfamily
af_P95137_118_295_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9187 61 115 3.40.50.150
af_Q2G0N7_5_202_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9128 9 200 3.40.50.150
af_Q2G0N7_5_202_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8827 9 200 3.40.50.150
1dusA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8776 10 199 3.40.50.150
af_Q8I3G1_737_866_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8564 61 132 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2E8LFZ1-F1-model_v4 Methyltransferase small domain-containing protein 0.9909 115 197 GO:0008168
AF-A0A7W0FSU6-F1-model_v4 Methyltransferase 0.9889 63 199 GO:0008757
GO:0032259
AF-A0A7V9LMY0-F1-model_v4 Methyltransferase 0.9876 21 197 GO:0008757
GO:0032259
AF-A0A7Y2D853-F1-model_v4 Methyltransferase 0.9855 117 198 GO:0008168
GO:0032259
AF-A0A2A9CTX8-F1-model_v4 16S rRNA m(2)G 1207 methyltransferase 0.9825 11 199 GO:0008757
GO:0032259

Map