F432731

General Info

Members Datasets Scaffolds Average Seq Length
393 210 381 245

Family's Representative Sequence

Representative Sequence 3300049683|Ga0501253_061651|Ga0501253_061651_17_682
Length 210
Sequence MVAFVTVLLLSNVIGAGKVATVDLPGIGDWPFGAGILFFPVSYVIGDVLTEVYGFARARRCIWAGFVALLFMAFMSWVVVKLPPAADWTGQAAYEAVFGQVPRIVFASIAVLAKMKVWTAGRHLWTRTIGSTVVGQGVDSLIFYPLAFLGAAGWTNELVLQVLVTQWVLKIAWEALLTPFTYAVVGFLKRREGVDVYDEKTEFNPFRVET

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
3 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
4 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
5 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
6 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
7 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
8 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
9 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
10 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
11 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
12 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
13 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
14 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
15 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
16 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
17 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
18 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
19 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
20 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
21 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
22 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
23 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
24 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
27 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
30 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
33 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
147 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
148 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
149 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
150 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
151 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
155 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
156 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
157 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
158 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
159 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
160 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
161 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
162 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
163 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
164 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
165 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
166 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
167 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
168 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
169 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
170 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
171 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
172 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
173 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
174 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
175 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
176 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
177 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
178 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
189 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
190 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
191 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
192 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
193 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
196 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
197 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
198 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
199 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
200 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
201 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
203 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
204 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
205 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
206 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
207 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
208 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
209 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
210 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.95
Metatranscriptomes 0
Isolates 3.05

Biome Distribution

Category Percentage (%)
Aerial Root 1.27
Bulb 0
Endosphere 2.8
Nodule 0
Rhizoplane 4.33
Rhizosphere 87.53
Stem 0
Stem Tuber 0
Unclassified 4.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_11747510 2162886012 Bacteria 1172
2 JGI24741J21665_1006745 3300001915 Bacteria 2283
3 JGI24752J21851_1000126 3300001976 Bacteria 10332
4 JGI24739J22299_10003190 3300001989 Bacteria 6254
5 JGI24739J22299_10020616 3300001989 Bacteria 2354
6 JGI24737J22298_10011612 3300001990 Bacteria 2882
7 JGI24750J21931_1000525 3300002070 Bacteria 5934
8 JGI24748J21848_1000054 3300002074 Bacteria 49652
9 JGI24748J21848_1000091 3300002074 Bacteria 25436
10 JGI24738J21930_10001846 3300002075 Bacteria 5738
11 JGI24749J21850_1000121 3300002076 Bacteria 13204
12 JGI24749J21850_1000329 3300002076 Bacteria 7201
13 JGI24034J26672_10000022 3300002239 Bacteria 116342
14 JGI24034J26672_10000052 3300002239 Bacteria 49811
15 JGI24742J22300_10002852 3300002244 Bacteria 2792
16 JGI24751J29686_10000110 3300002459 Bacteria 43210
17 Ga0065165_1014729 3300005262 Bacteria 3021
18 Ga0065712_10002012 3300005290 Bacteria 5439
19 Ga0065707_10082679 3300005295 Bacteria 12785
20 Ga0065707_10085154 3300005295 Bacteria 6381
21 Ga0065707_10216886 3300005295 Bacteria 1241
22 Ga0070658_10000001 3300005327 Bacteria 856789
23 Ga0070658_10027901 3300005327 Bacteria 4531
24 Ga0070658_10050954 3300005327 Bacteria 3355
25 Ga0070676_10021440 3300005328 Unclassified 3618
26 Ga0070676_10068013 3300005328 Bacteria 2132
27 Ga0070676_10268816 3300005328 Bacteria 1144
28 Ga0070690_100000038 3300005330 Bacteria 60092
29 Ga0070670_100000031 3300005331 Bacteria 159070
30 Ga0070670_100009246 3300005331 Bacteria 8420
31 Ga0070670_100020782 3300005331 Bacteria 5645
32 Ga0070670_100037654 3300005331 Bacteria 4161
33 Ga0070670_100047328 3300005331 Bacteria 3700
34 Ga0070670_100525433 3300005331 Bacteria 1054
35 Ga0070677_10002236 3300005333 Bacteria 6171
36 Ga0070677_10002299 3300005333 Bacteria 6098
37 Ga0070677_10073841 3300005333 Bacteria 1441
38 Ga0068869_100138720 3300005334 Bacteria 1876
39 Ga0070666_10000002 3300005335 Bacteria 478684
40 Ga0068868_100000392 3300005338 Bacteria 29751
41 Ga0070660_100000503 3300005339 Bacteria 26134
42 Ga0070660_100133345 3300005339 Bacteria 1989
43 Ga0070689_100496908 3300005340 Bacteria 1044
44 Ga0070661_100006917 3300005344 Bacteria 7827
45 Ga0070661_100103459 3300005344 Bacteria 2121
46 Ga0070661_100147697 3300005344 Bacteria 1776
47 Ga0070661_100229472 3300005344 Bacteria 1426
48 Ga0070692_10004857 3300005345 Bacteria 5656
49 Ga0070668_100032069 3300005347 Bacteria 3998
50 Ga0070668_100095530 3300005347 Bacteria 2348
51 Ga0070669_100000026 3300005353 Bacteria 170346
52 Ga0070669_100000237 3300005353 Bacteria 45913
53 Ga0070669_100010829 3300005353 Bacteria 6472
54 Ga0070669_100181776 3300005353 Bacteria 1645
55 Ga0070675_100000513 3300005354 Bacteria 26418
56 Ga0070675_100000913 3300005354 Bacteria 20987
57 Ga0070675_100002260 3300005354 Bacteria 14285
58 Ga0070671_100001033 3300005355 Bacteria 20484
59 Ga0070671_100001074 3300005355 Bacteria 20205
60 Ga0070671_100016051 3300005355 Bacteria 6052
61 Ga0070671_100039205 3300005355 Bacteria 3933
62 Ga0070674_100031723 3300005356 Bacteria 3504
63 Ga0070674_100150937 3300005356 Bacteria 1754
64 Ga0070673_100001062 3300005364 Bacteria 15666
65 Ga0070673_100018456 3300005364 Bacteria 4983
66 Ga0070688_100000864 3300005365 Bacteria 15042
67 Ga0070659_100005074 3300005366 Bacteria 9439
68 Ga0070659_100061378 3300005366 Bacteria 2971
69 Ga0070659_100305509 3300005366 Bacteria 1327
70 Ga0070667_100007257 3300005367 Bacteria 9209
71 Ga0070667_100013978 3300005367 Bacteria 6635
72 Ga0070667_100082320 3300005367 Bacteria 2755
73 Ga0070667_100136051 3300005367 Bacteria 2148
74 Ga0070700_100200015 3300005441 Bacteria 1403
75 Ga0070663_100210437 3300005455 Bacteria 1522
76 Ga0070678_100009552 3300005456 Bacteria 5883
77 Ga0070662_100005907 3300005457 Bacteria 7853
78 Ga0070662_100011921 3300005457 Bacteria 5747
79 Ga0070662_100036584 3300005457 Bacteria 3473
80 Ga0070662_100115729 3300005457 Bacteria 2048
81 Ga0070662_100217419 3300005457 Bacteria 1523
82 Ga0070685_10000559 3300005466 Bacteria 20824
83 Ga0070684_100206096 3300005535 Bacteria 1792
84 Ga0068853_100030640 3300005539 Bacteria 4546
85 Ga0068853_100061256 3300005539 Bacteria 3254
86 Ga0068853_100447322 3300005539 Bacteria 1215
87 Ga0070672_100006258 3300005543 Bacteria 7975
88 Ga0070672_100080781 3300005543 Bacteria 2605
89 Ga0070672_100184676 3300005543 Bacteria 1739
90 Ga0070672_100272765 3300005543 Bacteria 1429
91 Ga0070686_100000003 3300005544 Bacteria 308397
92 Ga0070686_100000280 3300005544 Bacteria 34516
93 Ga0070665_100000036 3300005548 Bacteria 314603
94 Ga0070665_100000105 3300005548 Bacteria 157734
95 Ga0070665_100068501 3300005548 Bacteria 3558
96 Ga0070665_100292634 3300005548 Bacteria 1631
97 Ga0070665_100506135 3300005548 Bacteria 1219
98 Ga0070664_100010756 3300005564 Bacteria 7418
99 Ga0070664_100369896 3300005564 Bacteria 1307
100 Ga0070664_100647812 3300005564 Bacteria 982
101 Ga0068857_100023740 3300005577 Bacteria 5399
102 Ga0068857_100255134 3300005577 Bacteria 1608
103 Ga0068854_100034397 3300005578 Bacteria 3540
104 Ga0068854_100094761 3300005578 Bacteria 2227
105 Ga0068852_100004705 3300005616 Bacteria 9681
106 Ga0068852_100222054 3300005616 Bacteria 1797
107 Ga0068852_100257650 3300005616 Bacteria 1674
108 Ga0068859_100031492 3300005617 Bacteria 5326
109 Ga0068859_100057400 3300005617 Bacteria 3921
110 Ga0068864_100000075 3300005618 Bacteria 108554
111 Ga0068864_100005525 3300005618 Bacteria 10359
112 Ga0068864_100005910 3300005618 Bacteria 10029
113 Ga0068864_100785962 3300005618 Bacteria 935
114 Ga0068861_100008311 3300005719 Bacteria 7137
115 Ga0068863_100000095 3300005841 Bacteria 96080
116 Ga0068858_100002452 3300005842 Bacteria 18725
117 Ga0068858_100689882 3300005842 Bacteria 993
118 Ga0068860_100000001 3300005843 Bacteria 703043
119 Ga0068862_100000006 3300005844 Bacteria 346828
120 Ga0068862_100000736 3300005844 Bacteria 32921
121 Ga0068862_100158964 3300005844 Bacteria 2016
122 Ga0081455_10000175 3300005937 Bacteria 80027
123 Ga0081539_10089323 3300005985 Bacteria 1596
124 Ga0075366_10185526 3300006195 Bacteria 1264
125 Ga0075366_10297543 3300006195 Bacteria 987
126 Ga0097621_100003074 3300006237 Bacteria 11443
127 Ga0068871_100000155 3300006358 Bacteria 45123
128 Ga0075430_100503242 3300006846 Bacteria 1000
129 Ga0097620_100031492 3300006931 Bacteria 5326
130 Ga0097620_100057403 3300006931 Bacteria 3921
131 Ga0105247_10021995 3300009101 Bacteria 3838
132 Ga0105241_10033034 3300009174 Bacteria 3882
133 Ga0105248_10000810 3300009177 Bacteria 35072
134 Ga0105248_10014771 3300009177 Bacteria 8598
135 Ga0105248_10063583 3300009177 Bacteria 4143
136 Ga0105248_10132500 3300009177 Bacteria 2812
137 Ga0105237_10016101 3300009545 Bacteria 7777
138 Ga0105237_10086347 3300009545 Bacteria 3127
139 Ga0105238_10038976 3300009551 Bacteria 4822
140 Ga0105249_10000026 3300009553 Bacteria 232053
141 Ga0105239_10177182 3300010375 Bacteria 2385
142 Ga0157326_1000881 3300012513 Bacteria 3454
143 Ga0157370_10023064 3300013104 Bacteria 6187
144 Ga0157369_10191913 3300013105 Bacteria 2146
145 Ga0157369_10482545 3300013105 Bacteria 1283
146 Ga0157374_10040304 3300013296 Bacteria 4300
147 Ga0157378_10012355 3300013297 Bacteria 7476
148 Ga0157378_10059343 3300013297 Bacteria 3413
149 Ga0163162_10043226 3300013306 Bacteria 4511
150 Ga0163162_10193349 3300013306 Bacteria 2162
151 Ga0163162_10388444 3300013306 Bacteria 1529
152 Ga0157372_10049039 3300013307 Bacteria 4695
153 Ga0157372_11307977 3300013307 Bacteria 836
154 Ga0157375_10009562 3300013308 Bacteria 8511
155 Ga0163163_10031883 3300014325 Bacteria 5090
156 Ga0163163_10466156 3300014325 Bacteria 1324
157 Ga0157380_10000395 3300014326 Bacteria 26307
158 Ga0157380_10000612 3300014326 Bacteria 21982
159 Ga0157380_10003531 3300014326 Bacteria 10746
160 Ga0157380_10152480 3300014326 Bacteria 1999
161 Ga0157379_10013991 3300014968 Bacteria 7032
162 Ga0157376_10009526 3300014969 Bacteria 7060
163 Ga0163161_10000008 3300017792 Bacteria 294642
164 Ga0163161_10046050 3300017792 Bacteria 3147
165 Ga0213876_10000120 3300021384 Bacteria 85450
166 Ga0207697_10083565 3300025315 Bacteria 1347
167 Ga0207656_10023466 3300025321 Bacteria 2485
168 Ga0207682_10004175 3300025893 Bacteria 6108
169 Ga0207682_10017731 3300025893 Bacteria 2780
170 Ga0207682_10059263 3300025893 Bacteria 1600
171 Ga0207688_10015433 3300025901 Bacteria 4143
172 Ga0207680_10000004 3300025903 Bacteria 827324
173 Ga0207647_10008339 3300025904 Bacteria 7431
174 Ga0207645_10047798 3300025907 Bacteria 2732
175 Ga0207645_10092378 3300025907 Bacteria 1947
176 Ga0207645_10188989 3300025907 Bacteria 1353
177 Ga0207705_10000002 3300025909 Bacteria 2046852
178 Ga0207705_10039417 3300025909 Bacteria 3386
179 Ga0207705_10434009 3300025909 Bacteria 1018
180 Ga0207654_10003694 3300025911 Bacteria 7719
181 Ga0207695_10015410 3300025913 Bacteria 9001
182 Ga0207671_10006083 3300025914 Bacteria 10865
183 Ga0207671_10038605 3300025914 Bacteria 3539
184 Ga0207662_10324852 3300025918 Bacteria 1028
185 Ga0207657_10003717 3300025919 Bacteria 16208
186 Ga0207657_10452657 3300025919 Bacteria 1007
187 Ga0207649_10014362 3300025920 Bacteria 4432
188 Ga0207649_10082378 3300025920 Bacteria 2086
189 Ga0207681_10000001 3300025923 Bacteria 1105841
190 Ga0207681_10000280 3300025923 Bacteria 37943
191 Ga0207681_10056131 3300025923 Bacteria 2685
192 Ga0207681_10453013 3300025923 Bacteria 1044
193 Ga0207694_10009677 3300025924 Bacteria 7267
194 Ga0207650_10000055 3300025925 Bacteria 158325
195 Ga0207650_10005815 3300025925 Bacteria 8415
196 Ga0207650_10031216 3300025925 Unclassified 3845
197 Ga0207650_10088618 3300025925 Bacteria 2360
198 Ga0207650_10106046 3300025925 Bacteria 2170
199 Ga0207650_10263464 3300025925 Bacteria 1399
200 Ga0207650_10464624 3300025925 Bacteria 1054
201 Ga0207659_10013389 3300025926 Bacteria 5251
202 Ga0207659_10134055 3300025926 Bacteria 1916
203 Ga0207644_10000693 3300025931 Bacteria 21342
204 Ga0207644_10002424 3300025931 Bacteria 12011
205 Ga0207690_10002487 3300025932 Bacteria 11134
206 Ga0207690_10042449 3300025932 Bacteria 2987
207 Ga0207706_10002602 3300025933 Bacteria 17565
208 Ga0207706_10051805 3300025933 Bacteria 3624
209 Ga0207706_10085230 3300025933 Bacteria 2778
210 Ga0207706_10103783 3300025933 Bacteria 2501
211 Ga0207706_10596157 3300025933 Bacteria 949
212 Ga0207670_10017277 3300025936 Bacteria 4359
213 Ga0207670_10449272 3300025936 Bacteria 1039
214 Ga0207669_10024816 3300025937 Bacteria 3228
215 Ga0207669_10169285 3300025937 Bacteria 1553
216 Ga0207669_10255160 3300025937 Bacteria 1308
217 Ga0207691_10036392 3300025940 Bacteria 4560
218 Ga0207691_10067222 3300025940 Bacteria 3241
219 Ga0207691_10302371 3300025940 Bacteria 1374
220 Ga0207711_10003593 3300025941 Bacteria 13413
221 Ga0207711_10016492 3300025941 Bacteria 6137
222 Ga0207689_10210699 3300025942 Bacteria 1605
223 Ga0207679_10013817 3300025945 Bacteria 5296
224 Ga0207679_10046835 3300025945 Bacteria 3137
225 Ga0207679_10422506 3300025945 Bacteria 1177
226 Ga0207667_10014962 3300025949 Bacteria 8824
227 Ga0207651_10062029 3300025960 Bacteria 2603
228 Ga0207651_10088284 3300025960 Bacteria 2260
229 Ga0207712_10000001 3300025961 Bacteria 750309
230 Ga0207668_10009914 3300025972 Bacteria 5729
231 Ga0207668_10012746 3300025972 Bacteria 5155
232 Ga0207640_10007617 3300025981 Bacteria 5976
233 Ga0207640_10033057 3300025981 Bacteria 3213
234 Ga0207640_10037396 3300025981 Bacteria 3054
235 Ga0207658_10003609 3300025986 Bacteria 10936
236 Ga0207658_10007306 3300025986 Bacteria 7534
237 Ga0207658_10399706 3300025986 Bacteria 1207
238 Ga0207658_10429483 3300025986 Bacteria 1166
239 Ga0207677_10001381 3300026023 Bacteria 12956
240 Ga0207703_10003396 3300026035 Bacteria 13374
241 Ga0207639_10004074 3300026041 Bacteria 9859
242 Ga0207639_10043410 3300026041 Bacteria 3375
243 Ga0207639_10112727 3300026041 Bacteria 2220
244 Ga0207678_10049841 3300026067 Bacteria 3619
245 Ga0207708_10065738 3300026075 Bacteria 2772
246 Ga0207702_10011731 3300026078 Bacteria 7299
247 Ga0207641_10000148 3300026088 Bacteria 99601
248 Ga0207676_10000004 3300026095 Bacteria 725417
249 Ga0207676_10007367 3300026095 Bacteria 7805
250 Ga0207676_10026221 3300026095 Bacteria 4333
251 Ga0207676_10228126 3300026095 Bacteria 1663
252 Ga0207674_10033011 3300026116 Bacteria 5424
253 Ga0207674_10092581 3300026116 Bacteria 3012
254 Ga0207683_10000189 3300026121 Bacteria 52818
255 Ga0207698_10001338 3300026142 Bacteria 14348
256 Ga0207698_10012353 3300026142 Bacteria 5585
257 Ga0268266_10000042 3300028379 Bacteria 316826
258 Ga0268266_10000394 3300028379 Bacteria 66190
259 Ga0268266_10054987 3300028379 Bacteria 3421
260 Ga0268265_10000002 3300028380 Bacteria 1035381
261 Ga0268265_10000233 3300028380 Bacteria 63492
262 Ga0268265_10137587 3300028380 Bacteria 2040
263 Ga0268265_10636385 3300028380 Bacteria 1024
264 Ga0268264_10000006 3300028381 Bacteria 827324
265 Ga0307408_100071104 3300031548 Bacteria 2571
266 Ga0307408_100377174 3300031548 Bacteria 1211
267 Ga0307408_100577290 3300031548 Bacteria 996
268 Ga0307405_10007143 3300031731 Bacteria 5554
269 Ga0307405_10120547 3300031731 Bacteria 1794
270 Ga0307405_10162271 3300031731 Bacteria 1584
271 Ga0307405_10197725 3300031731 Bacteria 1457
272 Ga0307413_10010038 3300031824 Bacteria 4565
273 Ga0307413_10035258 3300031824 Bacteria 2868
274 Ga0307413_10258069 3300031824 Bacteria 1297
275 Ga0307413_10335093 3300031824 Bacteria 1161
276 Ga0307413_10637704 3300031824 Bacteria 877
277 Ga0307410_10045757 3300031852 Bacteria 2916
278 Ga0307406_10021598 3300031901 Bacteria 3810
279 Ga0307406_10110586 3300031901 Bacteria 1891
280 Ga0307406_10289148 3300031901 Bacteria 1254
281 Ga0307406_10325083 3300031901 Bacteria 1191
282 Ga0307407_10034644 3300031903 Bacteria 2766
283 Ga0307407_10043813 3300031903 Bacteria 2518
284 Ga0307412_10021051 3300031911 Bacteria 3979
285 Ga0307412_10064716 3300031911 Bacteria 2471
286 Ga0307412_10131889 3300031911 Bacteria 1816
287 Ga0307412_10195257 3300031911 Bacteria 1533
288 Ga0307412_10591555 3300031911 Bacteria 938
289 Ga0307409_100064967 3300031995 Bacteria 2869
290 Ga0307409_100091963 3300031995 Bacteria 2488
291 Ga0307409_100150230 3300031995 Bacteria 2021
292 Ga0307409_100182522 3300031995 Bacteria 1859
293 Ga0307409_100200072 3300031995 Bacteria 1786
294 Ga0307409_100234708 3300031995 Bacteria 1665
295 Ga0307409_100444310 3300031995 Bacteria 1250
296 Ga0307409_100504144 3300031995 Bacteria 1179
297 Ga0307416_100049275 3300032002 Bacteria 3348
298 Ga0307416_100248198 3300032002 Bacteria 1730
299 Ga0307416_100334744 3300032002 Bacteria 1523
300 Ga0307416_100339661 3300032002 Bacteria 1514
301 Ga0307416_100488383 3300032002 Bacteria 1293
302 Ga0307416_100992957 3300032002 Bacteria 942
303 Ga0307414_10045411 3300032004 Bacteria 3008
304 Ga0307414_10073037 3300032004 Bacteria 2480
305 Ga0307414_10139718 3300032004 Bacteria 1894
306 Ga0307414_10143106 3300032004 Bacteria 1875
307 Ga0307414_10599928 3300032004 Bacteria 987
308 Ga0307411_10007559 3300032005 Bacteria 5550
309 Ga0307411_10012136 3300032005 Bacteria 4684
310 Ga0307411_10053177 3300032005 Bacteria 2652
311 Ga0307411_10059475 3300032005 Bacteria 2534
312 Ga0307411_10107778 3300032005 Bacteria 1986
313 Ga0307415_100043089 3300032126 Bacteria 3008
314 Ga0307415_100095190 3300032126 Bacteria 2167
315 Ga0307415_100160588 3300032126 Bacteria 1741
316 Ga0307415_100427168 3300032126 Bacteria 1139
317 Ga0395901_0026445 3300038443 Bacteria 5958
318 Ga0436365_0010969 3300039437 Bacteria 175809
319 Ga0451853_0120698 3300041512 Bacteria 1655
320 Ga0439449_0097121 3300042007 Bacteria 1088
321 Ga0450912_003188 3300042116 Bacteria 1155
322 Ga0450914_008243 3300042118 Bacteria 960
323 Ga0450890_023972 3300042127 Bacteria 840
324 Ga0466966_0229918 3300044684 Bacteria 1119
325 Ga0466959_0127573 3300045049 Bacteria 1805
326 Ga0466958_0029216 3300045836 Bacteria 3271
327 Ga0495638_0001065 3300046460 Bacteria 26779
328 Ga0495648_0021033 3300046524 Bacteria 4531
329 Ga0495663_0011028 3300046525 Bacteria 2516
330 Ga0495663_0031744 3300046525 Bacteria 1570
331 Ga0495654_0000264 3300046530 Bacteria 47686
332 Ga0495621_0013293 3300046539 Bacteria 2583
333 Ga0495668_0000984 3300046616 Bacteria 31110
334 Ga0495668_0101668 3300046616 Bacteria 1572
335 Ga0495625_0000091 3300046660 Bacteria 146647
336 Ga0495625_0036271 3300046660 Bacteria 3626
337 Ga0495669_0020004 3300046684 Bacteria 2892
338 Ga0495649_0152348 3300046694 Bacteria 1214
339 Ga0495589_0030945 3300046794 Bacteria 2695
340 Ga0496100_0099294 3300048903 Bacteria 2003
341 Ga0496101_0049657 3300048904 Bacteria 3019
342 Ga0496102_0029270 3300048905 Bacteria 4927
343 Ga0496103_0001411 3300048906 Bacteria 16135
344 Ga0496105_0111744 3300048908 Bacteria 2255
345 Ga0496105_0243280 3300048908 Bacteria 1459
346 Ga0496107_0097148 3300048910 Bacteria 2156
347 Ga0496108_0013534 3300048911 Bacteria 6659
348 Ga0496109_0122577 3300048912 Bacteria 2422
349 Ga0496109_0228064 3300048912 Bacteria 1752
350 Ga0496110_0031418 3300048913 Bacteria 4582
351 Ga0496110_0066529 3300048913 Bacteria 3187
352 Ga0496110_0273184 3300048913 Bacteria 1539
353 Ga0496111_0009171 3300048914 Bacteria 6587
354 Ga0496111_0060564 3300048914 Bacteria 2744
355 Ga0496114_0440149 3300048917 Bacteria 1154
356 Ga0496117_0005582 3300048920 Bacteria 13156
357 Ga0496118_0270047 3300048921 Bacteria 953
358 Ga0496122_0054515 3300048925 Bacteria 3002
359 Ga0496123_0036931 3300048926 Bacteria 3456
360 Ga0496124_0024089 3300048927 Bacteria 5541
361 Ga0496124_0124937 3300048927 Bacteria 2051
362 Ga0496124_0259115 3300048927 Bacteria 1281
363 Ga0495678_129443 3300049459 Bacteria 838
364 Ga0501047_0002625 3300049581 Bacteria 17104
365 Ga0501047_0249349 3300049581 Bacteria 1624
366 Ga0501223_003948 3300049663 Bacteria 3200
367 Ga0501227_009090 3300049665 Bacteria 2137
368 Ga0501249_000133 3300049679 Bacteria 23209
369 Ga0501253_061651 3300049683 Bacteria 809
370 Ga0501245_010827 3300049708 Bacteria 1321
371 Ga0501080_0031996 3300049742 Bacteria 4904
372 Ga0501044_0096493 3300049823 Bacteria 2978
373 Ga0501212_012479 3300049851 Bacteria 1237
374 nmdc:mga0k408_133659_c1 3300050493 Bacteria 1473
375 Ga0500566_0051570 3300053094 Bacteria 2353
376 Ga0500562_005534 3300053108 Bacteria 3173
377 Ga0500592_000227 3300053116 Bacteria 10268
378 Ga0500658_0001636 3300053134 Bacteria 8933
379 Ga0500573_0000117 3300053140 Bacteria 32538
380 Ga0500604_0008962 3300053151 Bacteria 2661
381 Ga0500627_0000188 3300053158 Bacteria 18122

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006195 Ga0075366_10185526 Ga0075366_101855263 206
2 3300049683 Ga0501253_061651 Ga0501253_061651_17_682 210
3 3300005331 Ga0070670_100525433 Ga0070670_1005254331 221
4 3300005333 Ga0070677_10073841 Ga0070677_100738413 221
5 3300025315 Ga0207697_10083565 Ga0207697_100835651 221
6 3300025925 Ga0207650_10464624 Ga0207650_104646241 221
7 3300026095 Ga0207676_10228126 Ga0207676_102281263 221
8 3300048917 Ga0496114_0440149 Ga0496114_0440149_24_689 221
9 3300013307 Ga0157372_11307977 Ga0157372_113079771 228
10 3300031731 Ga0307405_10007143 Ga0307405_100071435 233
11 3300031903 Ga0307407_10034644 Ga0307407_100346445 233
12 3300031911 Ga0307412_10131889 Ga0307412_101318893 233
13 3300032004 Ga0307414_10045411 Ga0307414_100454114 233
14 3300032005 Ga0307411_10012136 Ga0307411_100121365 233
15 3300042118 Ga0450914_008243 Ga0450914_008243_76_777 233
16 3300005327 Ga0070658_10027901 Ga0070658_100279013 234
17 3300005328 Ga0070676_10021440 Ga0070676_100214402 234
18 3300005331 Ga0070670_100009246 Ga0070670_1000092464 234
19 3300005333 Ga0070677_10002236 Ga0070677_100022364 234
20 3300005334 Ga0068869_100138720 Ga0068869_1001387202 234
21 3300005338 Ga0068868_100000392 Ga0068868_1000003923 234
22 3300005339 Ga0070660_100133345 Ga0070660_1001333451 234
23 3300005340 Ga0070689_100496908 Ga0070689_1004969082 234
24 3300005344 Ga0070661_100006917 Ga0070661_1000069174 234
25 3300005354 Ga0070675_100000513 Ga0070675_1000005134 234
26 3300005355 Ga0070671_100001074 Ga0070671_1000010748 234
27 3300005364 Ga0070673_100018456 Ga0070673_1000184564 234
28 3300005367 Ga0070667_100136051 Ga0070667_1001360512 234
29 3300005456 Ga0070678_100009552 Ga0070678_1000095526 234
30 3300005457 Ga0070662_100217419 Ga0070662_1002174192 234
31 3300005543 Ga0070672_100006258 Ga0070672_1000062582 234
32 3300005548 Ga0070665_100506135 Ga0070665_1005061351 234
33 3300005564 Ga0070664_100010756 Ga0070664_1000107567 234
34 3300005578 Ga0068854_100094761 Ga0068854_1000947613 234
35 3300005616 Ga0068852_100004705 Ga0068852_1000047059 234
36 3300005618 Ga0068864_100005525 Ga0068864_1000055256 234
37 3300005842 Ga0068858_100689882 Ga0068858_1006898821 234
38 3300006237 Ga0097621_100003074 Ga0097621_1000030746 234
39 3300006358 Ga0068871_100000155 Ga0068871_10000015522 234
40 3300009177 Ga0105248_10063583 Ga0105248_100635834 234
41 3300013105 Ga0157369_10482545 Ga0157369_104825452 234
42 3300013296 Ga0157374_10040304 Ga0157374_100403045 234
43 3300013297 Ga0157378_10012355 Ga0157378_100123558 234
44 3300013306 Ga0163162_10193349 Ga0163162_101933492 234
45 3300013308 Ga0157375_10009562 Ga0157375_100095628 234
46 3300014969 Ga0157376_10009526 Ga0157376_100095267 234
47 3300025893 Ga0207682_10017731 Ga0207682_100177312 234
48 3300025907 Ga0207645_10047798 Ga0207645_100477983 234
49 3300025909 Ga0207705_10434009 Ga0207705_104340091 234
50 3300025919 Ga0207657_10452657 Ga0207657_104526571 234
51 3300025920 Ga0207649_10014362 Ga0207649_100143624 234
52 3300025925 Ga0207650_10031216 Ga0207650_100312164 234
53 3300025926 Ga0207659_10013389 Ga0207659_100133891 234
54 3300025931 Ga0207644_10000693 Ga0207644_100006932 234
55 3300025936 Ga0207670_10449272 Ga0207670_104492722 234
56 3300025937 Ga0207669_10255160 Ga0207669_102551602 234
57 3300025940 Ga0207691_10067222 Ga0207691_100672224 234
58 3300025942 Ga0207689_10210699 Ga0207689_102106991 234
59 3300025945 Ga0207679_10013817 Ga0207679_100138174 234
60 3300025960 Ga0207651_10062029 Ga0207651_100620292 234
61 3300025981 Ga0207640_10037396 Ga0207640_100373962 234
62 3300025986 Ga0207658_10399706 Ga0207658_103997062 234
63 3300026023 Ga0207677_10001381 Ga0207677_100013813 234
64 3300026095 Ga0207676_10007367 Ga0207676_100073676 234
65 3300026121 Ga0207683_10000189 Ga0207683_1000018930 234
66 3300026142 Ga0207698_10001338 Ga0207698_1000133813 234
67 3300028380 Ga0268265_10636385 Ga0268265_106363852 234
68 3300041512 Ga0451853_0120698 Ga0451853_0120698_612_1316 234
69 3300044684 Ga0466966_0229918 Ga0466966_0229918_142_846 234
70 3300045049 Ga0466959_0127573 Ga0466959_0127573_350_1054 234
71 3300045836 Ga0466958_0029216 Ga0466958_0029216_124_828 234
72 3300048904 Ga0496101_0049657 Ga0496101_0049657_1583_2287 234
73 3300048908 Ga0496105_0111744 Ga0496105_0111744_578_1282 234
74 3300048911 Ga0496108_0013534 Ga0496108_0013534_628_1332 234
75 3300048912 Ga0496109_0122577 Ga0496109_0122577_621_1325 234
76 3300048913 Ga0496110_0066529 Ga0496110_0066529_1795_2499 234
77 3300048914 Ga0496111_0060564 Ga0496111_0060564_804_1508 234
78 iso_pu_bacteria 2990265787 2990267071 235
79 iso_pu_bacteria 2993693658 2993694022 235
80 3300049581 Ga0501047_0249349 Ga0501047_0249349_869_1579 236
81 3300049742 Ga0501080_0031996 Ga0501080_0031996_3381_4091 236
82 3300049823 Ga0501044_0096493 Ga0501044_0096493_287_997 236
83 3300005355 Ga0070671_100039205 Ga0070671_1000392054 240
84 iso_pu_bacteria 2928027323 2928029527 240
85 iso_pu_bacteria 2984555340 2984557453 240
86 iso_pu_bacteria 2984564862 2984568187 240
87 iso_pu_bacteria 2993356040 2993359230 240
88 3300032004 Ga0307414_10599928 Ga0307414_105999282 241
89 3300049665 Ga0501227_009090 Ga0501227_009090_1126_1854 241
90 3300026041 Ga0207639_10112727 Ga0207639_101127271 242
91 3300031911 Ga0307412_10064716 Ga0307412_100647164 242
92 3300032002 Ga0307416_100339661 Ga0307416_1003396612 242
93 3300032126 Ga0307415_100427168 Ga0307415_1004271681 242
94 iso_pu_bacteria 2599185359 2600226498 243
95 iso_pu_bacteria 2643221541 2643730262 243
96 iso_pu_bacteria 2643221605 2644037383 243
97 iso_pu_bacteria 2643221606 2644043431 243
98 iso_pu_bacteria 2643221671 2644393591 243
99 iso_pu_bacteria 2928968154 2928969400 243
100 3300005577 Ga0068857_100255134 Ga0068857_1002551342 244
101 3300005616 Ga0068852_100257650 Ga0068852_1002576503 244
102 3300026116 Ga0207674_10092581 Ga0207674_100925816 244
103 3300031548 Ga0307408_100577290 Ga0307408_1005772902 244
104 3300031824 Ga0307413_10035258 Ga0307413_100352582 244
105 3300031903 Ga0307407_10043813 Ga0307407_100438135 244
106 3300031911 Ga0307412_10021051 Ga0307412_100210516 244
107 3300031995 Ga0307409_100150230 Ga0307409_1001502304 244
108 3300032004 Ga0307414_10073037 Ga0307414_100730372 244
109 3300032004 Ga0307414_10143106 Ga0307414_101431063 244
110 3300032005 Ga0307411_10107778 Ga0307411_101077783 244
111 3300032126 Ga0307415_100043089 Ga0307415_1000430895 244
112 3300005331 Ga0070670_100037654 Ga0070670_1000376542 245
113 3300005366 Ga0070659_100005074 Ga0070659_1000050744 245
114 3300005539 Ga0068853_100447322 Ga0068853_1004473222 245
115 3300005544 Ga0070686_100000280 Ga0070686_10000028028 245
116 3300005548 Ga0070665_100000105 Ga0070665_100000105135 245
117 3300005564 Ga0070664_100647812 Ga0070664_1006478122 245
118 3300006846 Ga0075430_100503242 Ga0075430_1005032422 245
119 3300009545 Ga0105237_10016101 Ga0105237_100161012 245
120 3300025914 Ga0207671_10038605 Ga0207671_100386055 245
121 3300025925 Ga0207650_10263464 Ga0207650_102634642 245
122 3300025932 Ga0207690_10002487 Ga0207690_100024878 245
123 3300028379 Ga0268266_10000394 Ga0268266_1000039446 245
124 3300031824 Ga0307413_10258069 Ga0307413_102580692 245
125 3300031824 Ga0307413_10335093 Ga0307413_103350932 245
126 3300046524 Ga0495648_0021033 Ga0495648_0021033_1634_2377 245
127 3300046660 Ga0495625_0036271 Ga0495625_0036271_1240_1980 245
128 3300046694 Ga0495649_0152348 Ga0495649_0152348_447_1184 245
129 3300048925 Ga0496122_0054515 Ga0496122_0054515_2246_2989 245
130 3300048926 Ga0496123_0036931 Ga0496123_0036931_572_1315 245
131 3300048927 Ga0496124_0024089 Ga0496124_0024089_1333_2076 245
132 3300048927 Ga0496124_0124937 Ga0496124_0124937_70_813 245
133 3300049663 Ga0501223_003948 Ga0501223_003948_2442_3182 245
134 3300049708 Ga0501245_010827 Ga0501245_010827_316_1056 245
135 3300005262 Ga0065165_1014729 Ga0065165_10147294 246
136 3300005295 Ga0065707_10216886 Ga0065707_102168862 246
137 3300005327 Ga0070658_10000001 Ga0070658_10000001197 246
138 3300005339 Ga0070660_100000503 Ga0070660_1000005038 246
139 3300005345 Ga0070692_10004857 Ga0070692_100048575 246
140 3300005366 Ga0070659_100061378 Ga0070659_1000613783 246
141 3300006195 Ga0075366_10297543 Ga0075366_102975432 246
142 3300021384 Ga0213876_10000120 Ga0213876_1000012083 246
143 3300025909 Ga0207705_10000002 Ga0207705_100000021682 246
144 3300025919 Ga0207657_10003717 Ga0207657_1000371710 246
145 3300025932 Ga0207690_10042449 Ga0207690_100424494 246
146 3300032005 Ga0307411_10059475 Ga0307411_100594754 246
147 3300038443 Ga0395901_0026445 Ga0395901_0026445_2929_3681 246
148 3300039437 Ga0436365_0010969 Ga0436365_0010969_56609_57352 246
149 3300049581 Ga0501047_0002625 Ga0501047_0002625_11646_12392 246
150 3300049679 Ga0501249_000133 Ga0501249_000133_15309_16055 246
151 3300049851 Ga0501212_012479 Ga0501212_012479_132_878 246
152 3300053094 Ga0500566_0051570 Ga0500566_0051570_649_1395 246
153 3300053134 Ga0500658_0001636 Ga0500658_0001636_2189_2932 246
154 3300053140 Ga0500573_0000117 Ga0500573_0000117_15813_16556 246
155 3300001915 JGI24741J21665_1006745 JGI24741J21665_10067453 247
156 3300001976 JGI24752J21851_1000126 JGI24752J21851_10001262 247
157 3300001989 JGI24739J22299_10003190 JGI24739J22299_100031903 247
158 3300001989 JGI24739J22299_10020616 JGI24739J22299_100206162 247
159 3300001990 JGI24737J22298_10011612 JGI24737J22298_100116122 247
160 3300002070 JGI24750J21931_1000525 JGI24750J21931_10005257 247
161 3300002074 JGI24748J21848_1000054 JGI24748J21848_100005438 247
162 3300002074 JGI24748J21848_1000091 JGI24748J21848_100009119 247
163 3300002075 JGI24738J21930_10001846 JGI24738J21930_100018464 247
164 3300002076 JGI24749J21850_1000329 JGI24749J21850_10003297 247
165 3300002239 JGI24034J26672_10000022 JGI24034J26672_1000002224 247
166 3300002239 JGI24034J26672_10000052 JGI24034J26672_1000005217 247
167 3300002244 JGI24742J22300_10002852 JGI24742J22300_100028524 247
168 3300005295 Ga0065707_10082679 Ga0065707_100826798 247
169 3300005327 Ga0070658_10050954 Ga0070658_100509542 247
170 3300005330 Ga0070690_100000038 Ga0070690_10000003839 247
171 3300005335 Ga0070666_10000002 Ga0070666_1000000295 247
172 3300005344 Ga0070661_100229472 Ga0070661_1002294722 247
173 3300005347 Ga0070668_100095530 Ga0070668_1000955303 247
174 3300005353 Ga0070669_100000237 Ga0070669_10000023716 247
175 3300005355 Ga0070671_100016051 Ga0070671_1000160514 247
176 3300005365 Ga0070688_100000864 Ga0070688_10000086415 247
177 3300005366 Ga0070659_100305509 Ga0070659_1003055092 247
178 3300005367 Ga0070667_100007257 Ga0070667_10000725710 247
179 3300005455 Ga0070663_100210437 Ga0070663_1002104372 247
180 3300005457 Ga0070662_100011921 Ga0070662_1000119214 247
181 3300005457 Ga0070662_100115729 Ga0070662_1001157292 247
182 3300005466 Ga0070685_10000559 Ga0070685_1000055917 247
183 3300005535 Ga0070684_100206096 Ga0070684_1002060962 247
184 3300005539 Ga0068853_100030640 Ga0068853_1000306402 247
185 3300005539 Ga0068853_100061256 Ga0068853_1000612562 247
186 3300005544 Ga0070686_100000003 Ga0070686_100000003272 247
187 3300005548 Ga0070665_100000036 Ga0070665_100000036243 247
188 3300005577 Ga0068857_100023740 Ga0068857_1000237402 247
189 3300005578 Ga0068854_100034397 Ga0068854_1000343972 247
190 3300005616 Ga0068852_100222054 Ga0068852_1002220542 247
191 3300005617 Ga0068859_100057400 Ga0068859_1000574006 247
192 3300005618 Ga0068864_100005910 Ga0068864_1000059108 247
193 3300005841 Ga0068863_100000095 Ga0068863_1000000953 247
194 3300005842 Ga0068858_100002452 Ga0068858_10000245219 247
195 3300005843 Ga0068860_100000001 Ga0068860_10000000195 247
196 3300005844 Ga0068862_100000736 Ga0068862_1000007362 247
197 3300005937 Ga0081455_10000175 Ga0081455_1000017548 247
198 3300006931 Ga0097620_100057403 Ga0097620_1000574036 247
199 3300009101 Ga0105247_10021995 Ga0105247_100219956 247
200 3300009174 Ga0105241_10033034 Ga0105241_100330345 247
201 3300009177 Ga0105248_10132500 Ga0105248_101325004 247
202 3300009545 Ga0105237_10086347 Ga0105237_100863472 247
203 3300009551 Ga0105238_10038976 Ga0105238_100389767 247
204 3300009553 Ga0105249_10000026 Ga0105249_1000002694 247
205 3300010375 Ga0105239_10177182 Ga0105239_101771824 247
206 3300013104 Ga0157370_10023064 Ga0157370_100230646 247
207 3300013105 Ga0157369_10191913 Ga0157369_101919134 247
208 3300013297 Ga0157378_10059343 Ga0157378_100593431 247
209 3300013306 Ga0163162_10043226 Ga0163162_100432266 247
210 3300013307 Ga0157372_10049039 Ga0157372_100490397 247
211 3300014325 Ga0163163_10031883 Ga0163163_100318837 247
212 3300014326 Ga0157380_10000612 Ga0157380_100006126 247
213 3300014326 Ga0157380_10003531 Ga0157380_100035318 247
214 3300014968 Ga0157379_10013991 Ga0157379_100139919 247
215 3300017792 Ga0163161_10000008 Ga0163161_10000008213 247
216 3300025321 Ga0207656_10023466 Ga0207656_100234664 247
217 3300025903 Ga0207680_10000004 Ga0207680_10000004765 247
218 3300025904 Ga0207647_10008339 Ga0207647_100083395 247
219 3300025909 Ga0207705_10039417 Ga0207705_100394172 247
220 3300025911 Ga0207654_10003694 Ga0207654_100036943 247
221 3300025913 Ga0207695_10015410 Ga0207695_100154106 247
222 3300025914 Ga0207671_10006083 Ga0207671_100060836 247
223 3300025923 Ga0207681_10000280 Ga0207681_1000028031 247
224 3300025924 Ga0207694_10009677 Ga0207694_100096775 247
225 3300025925 Ga0207650_10088618 Ga0207650_100886182 247
226 3300025931 Ga0207644_10002424 Ga0207644_100024244 247
227 3300025933 Ga0207706_10002602 Ga0207706_100026026 247
228 3300025933 Ga0207706_10051805 Ga0207706_100518052 247
229 3300025936 Ga0207670_10017277 Ga0207670_100172777 247
230 3300025941 Ga0207711_10016492 Ga0207711_100164922 247
231 3300025949 Ga0207667_10014962 Ga0207667_100149626 247
232 3300025961 Ga0207712_10000001 Ga0207712_10000001639 247
233 3300025972 Ga0207668_10009914 Ga0207668_100099143 247
234 3300025981 Ga0207640_10033057 Ga0207640_100330573 247
235 3300025986 Ga0207658_10007306 Ga0207658_100073067 247
236 3300026035 Ga0207703_10003396 Ga0207703_1000339613 247
237 3300026041 Ga0207639_10004074 Ga0207639_1000407410 247
238 3300026041 Ga0207639_10043410 Ga0207639_100434102 247
239 3300026067 Ga0207678_10049841 Ga0207678_100498415 247
240 3300026078 Ga0207702_10011731 Ga0207702_100117317 247
241 3300026088 Ga0207641_10000148 Ga0207641_100001484 247
242 3300026095 Ga0207676_10026221 Ga0207676_100262214 247
243 3300026116 Ga0207674_10033011 Ga0207674_100330115 247
244 3300026142 Ga0207698_10012353 Ga0207698_100123534 247
245 3300028379 Ga0268266_10000042 Ga0268266_1000004296 247
246 3300028380 Ga0268265_10000233 Ga0268265_100002332 247
247 3300028381 Ga0268264_10000006 Ga0268264_10000006765 247
248 3300031548 Ga0307408_100071104 Ga0307408_1000711042 247
249 3300031731 Ga0307405_10162271 Ga0307405_101622712 247
250 3300031901 Ga0307406_10021598 Ga0307406_100215982 247
251 3300031995 Ga0307409_100091963 Ga0307409_1000919632 247
252 3300032002 Ga0307416_100992957 Ga0307416_1009929571 247
253 3300046525 Ga0495663_0031744 Ga0495663_0031744_555_1307 247
254 3300046530 Ga0495654_0000264 Ga0495654_0000264_32237_32989 247
255 3300046616 Ga0495668_0000984 Ga0495668_0000984_22458_23210 247
256 3300046616 Ga0495668_0101668 Ga0495668_0101668_419_1171 247
257 3300046794 Ga0495589_0030945 Ga0495589_0030945_1317_2069 247
258 3300048903 Ga0496100_0099294 Ga0496100_0099294_685_1437 247
259 3300048905 Ga0496102_0029270 Ga0496102_0029270_2394_3146 247
260 3300048906 Ga0496103_0001411 Ga0496103_0001411_11044_11796 247
261 3300048908 Ga0496105_0243280 Ga0496105_0243280_682_1434 247
262 3300048910 Ga0496107_0097148 Ga0496107_0097148_324_1076 247
263 3300048912 Ga0496109_0228064 Ga0496109_0228064_974_1726 247
264 3300048913 Ga0496110_0273184 Ga0496110_0273184_713_1465 247
265 3300048920 Ga0496117_0005582 Ga0496117_0005582_9664_10416 247
266 3300048921 Ga0496118_0270047 Ga0496118_0270047_67_819 247
267 3300048927 Ga0496124_0259115 Ga0496124_0259115_53_805 247
268 3300049459 Ga0495678_129443 Ga0495678_129443_47_799 247
269 3300053116 Ga0500592_000227 Ga0500592_000227_6539_7291 247
270 3300053151 Ga0500604_0008962 Ga0500604_0008962_785_1537 247
271 3300053158 Ga0500627_0000188 Ga0500627_0000188_4668_5420 247
272 3300005290 Ga0065712_10002012 Ga0065712_100020123 248
273 3300005328 Ga0070676_10068013 Ga0070676_100680133 248
274 3300005331 Ga0070670_100047328 Ga0070670_1000473282 248
275 3300005344 Ga0070661_100103459 Ga0070661_1001034594 248
276 3300005353 Ga0070669_100181776 Ga0070669_1001817762 248
277 3300005354 Ga0070675_100000913 Ga0070675_10000091320 248
278 3300005355 Ga0070671_100001033 Ga0070671_10000103313 248
279 3300005356 Ga0070674_100150937 Ga0070674_1001509372 248
280 3300005364 Ga0070673_100001062 Ga0070673_1000010622 248
281 3300005367 Ga0070667_100082320 Ga0070667_1000823204 248
282 3300005457 Ga0070662_100005907 Ga0070662_1000059074 248
283 3300005543 Ga0070672_100080781 Ga0070672_1000807811 248
284 3300005543 Ga0070672_100184676 Ga0070672_1001846762 248
285 3300005548 Ga0070665_100068501 Ga0070665_1000685012 248
286 3300005548 Ga0070665_100292634 Ga0070665_1002926342 248
287 3300005564 Ga0070664_100369896 Ga0070664_1003698963 248
288 3300009177 Ga0105248_10014771 Ga0105248_100147712 248
289 3300014325 Ga0163163_10466156 Ga0163163_104661563 248
290 3300017792 Ga0163161_10046050 Ga0163161_100460504 248
291 3300025893 Ga0207682_10059263 Ga0207682_100592633 248
292 3300025907 Ga0207645_10092378 Ga0207645_100923783 248
293 3300025920 Ga0207649_10082378 Ga0207649_100823783 248
294 3300025923 Ga0207681_10453013 Ga0207681_104530132 248
295 3300025925 Ga0207650_10106046 Ga0207650_101060463 248
296 3300025926 Ga0207659_10134055 Ga0207659_101340553 248
297 3300025933 Ga0207706_10085230 Ga0207706_100852302 248
298 3300025933 Ga0207706_10103783 Ga0207706_101037833 248
299 3300025937 Ga0207669_10169285 Ga0207669_101692853 248
300 3300025940 Ga0207691_10036392 Ga0207691_100363921 248
301 3300025940 Ga0207691_10302371 Ga0207691_103023712 248
302 3300025945 Ga0207679_10046835 Ga0207679_100468355 248
303 3300025945 Ga0207679_10422506 Ga0207679_104225063 248
304 3300025960 Ga0207651_10088284 Ga0207651_100882843 248
305 3300025986 Ga0207658_10429483 Ga0207658_104294831 248
306 3300028379 Ga0268266_10054987 Ga0268266_100549873 248
307 3300031995 Ga0307409_100182522 Ga0307409_1001825223 248
308 3300032002 Ga0307416_100488383 Ga0307416_1004883832 248
309 3300042007 Ga0439449_0097121 Ga0439449_0097121_158_904 248
310 3300042116 Ga0450912_003188 Ga0450912_003188_224_970 248
311 3300042127 Ga0450890_023972 Ga0450890_023972_47_793 248
312 3300046460 Ga0495638_0001065 Ga0495638_0001065_5771_6526 248
313 3300046525 Ga0495663_0011028 Ga0495663_0011028_312_1058 248
314 3300046539 Ga0495621_0013293 Ga0495621_0013293_357_1103 248
315 3300046684 Ga0495669_0020004 Ga0495669_0020004_334_1080 248
316 3300048913 Ga0496110_0031418 Ga0496110_0031418_3246_3992 248
317 3300048914 Ga0496111_0009171 Ga0496111_0009171_2834_3580 248
318 2162886012 MBSR1b_contig_11747510 MBSR1b_0532.00006630 249
319 3300002076 JGI24749J21850_1000121 JGI24749J21850_100012114 249
320 3300002459 JGI24751J29686_10000110 JGI24751J29686_1000011033 249
321 3300005295 Ga0065707_10085154 Ga0065707_100851545 249
322 3300005328 Ga0070676_10268816 Ga0070676_102688161 249
323 3300005331 Ga0070670_100000031 Ga0070670_10000003163 249
324 3300005331 Ga0070670_100020782 Ga0070670_1000207824 249
325 3300005333 Ga0070677_10002299 Ga0070677_100022995 249
326 3300005344 Ga0070661_100147697 Ga0070661_1001476973 249
327 3300005347 Ga0070668_100032069 Ga0070668_1000320696 249
328 3300005353 Ga0070669_100000026 Ga0070669_1000000266 249
329 3300005353 Ga0070669_100010829 Ga0070669_1000108295 249
330 3300005354 Ga0070675_100002260 Ga0070675_1000022608 249
331 3300005356 Ga0070674_100031723 Ga0070674_1000317233 249
332 3300005367 Ga0070667_100013978 Ga0070667_1000139783 249
333 3300005441 Ga0070700_100200015 Ga0070700_1002000151 249
334 3300005457 Ga0070662_100036584 Ga0070662_1000365843 249
335 3300005543 Ga0070672_100272765 Ga0070672_1002727651 249
336 3300005617 Ga0068859_100031492 Ga0068859_1000314922 249
337 3300005618 Ga0068864_100000075 Ga0068864_1000000756 249
338 3300005618 Ga0068864_100785962 Ga0068864_1007859621 249
339 3300005719 Ga0068861_100008311 Ga0068861_1000083112 249
340 3300005844 Ga0068862_100000006 Ga0068862_100000006250 249
341 3300005844 Ga0068862_100158964 Ga0068862_1001589644 249
342 3300005985 Ga0081539_10089323 Ga0081539_100893233 249
343 3300006931 Ga0097620_100031492 Ga0097620_1000314927 249
344 3300009177 Ga0105248_10000810 Ga0105248_1000081017 249
345 3300012513 Ga0157326_1000881 Ga0157326_10008813 249
346 3300013306 Ga0163162_10388444 Ga0163162_103884441 249
347 3300014326 Ga0157380_10000395 Ga0157380_100003953 249
348 3300014326 Ga0157380_10152480 Ga0157380_101524804 249
349 3300025893 Ga0207682_10004175 Ga0207682_100041754 249
350 3300025901 Ga0207688_10015433 Ga0207688_100154331 249
351 3300025907 Ga0207645_10188989 Ga0207645_101889891 249
352 3300025918 Ga0207662_10324852 Ga0207662_103248521 249
353 3300025923 Ga0207681_10000001 Ga0207681_10000001925 249
354 3300025923 Ga0207681_10056131 Ga0207681_100561313 249
355 3300025925 Ga0207650_10000055 Ga0207650_1000005563 249
356 3300025925 Ga0207650_10005815 Ga0207650_100058158 249
357 3300025933 Ga0207706_10596157 Ga0207706_105961571 249
358 3300025937 Ga0207669_10024816 Ga0207669_100248163 249
359 3300025941 Ga0207711_10003593 Ga0207711_100035937 249
360 3300025972 Ga0207668_10012746 Ga0207668_100127466 249
361 3300025981 Ga0207640_10007617 Ga0207640_100076174 249
362 3300025986 Ga0207658_10003609 Ga0207658_100036093 249
363 3300026075 Ga0207708_10065738 Ga0207708_100657384 249
364 3300026095 Ga0207676_10000004 Ga0207676_10000004104 249
365 3300028380 Ga0268265_10000002 Ga0268265_10000002975 249
366 3300028380 Ga0268265_10137587 Ga0268265_101375874 249
367 3300031548 Ga0307408_100377174 Ga0307408_1003771743 249
368 3300031731 Ga0307405_10120547 Ga0307405_101205471 249
369 3300031731 Ga0307405_10197725 Ga0307405_101977251 249
370 3300031824 Ga0307413_10010038 Ga0307413_100100384 249
371 3300031824 Ga0307413_10637704 Ga0307413_106377041 249
372 3300031852 Ga0307410_10045757 Ga0307410_100457574 249
373 3300031901 Ga0307406_10110586 Ga0307406_101105862 249
374 3300031901 Ga0307406_10289148 Ga0307406_102891482 249
375 3300031901 Ga0307406_10325083 Ga0307406_103250833 249
376 3300031911 Ga0307412_10195257 Ga0307412_101952573 249
377 3300031911 Ga0307412_10591555 Ga0307412_105915551 249
378 3300031995 Ga0307409_100064967 Ga0307409_1000649674 249
379 3300031995 Ga0307409_100200072 Ga0307409_1002000721 249
380 3300031995 Ga0307409_100234708 Ga0307409_1002347083 249
381 3300031995 Ga0307409_100444310 Ga0307409_1004443102 249
382 3300031995 Ga0307409_100504144 Ga0307409_1005041441 249
383 3300032002 Ga0307416_100049275 Ga0307416_1000492754 249
384 3300032002 Ga0307416_100248198 Ga0307416_1002481982 249
385 3300032002 Ga0307416_100334744 Ga0307416_1003347441 249
386 3300032004 Ga0307414_10139718 Ga0307414_101397181 249
387 3300032005 Ga0307411_10007559 Ga0307411_100075597 249
388 3300032005 Ga0307411_10053177 Ga0307411_100531773 249
389 3300032126 Ga0307415_100095190 Ga0307415_1000951904 249
390 3300032126 Ga0307415_100160588 Ga0307415_1001605883 249
391 3300046660 Ga0495625_0000091 Ga0495625_0000091_30849_31613 249
392 3300050493 nmdc:mga0k408_133659_c1 nmdc:mga0k408_133659_c1_604_1362 249
393 3300053108 Ga0500562_005534 Ga0500562_005534_1183_1947 249

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02592

Vut_1

Putative vitamin uptake transporter

33

184

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7w78-assembly1.cif.gz_B heme exporter hrtba in complex with mg-amppnp 0.4397 117 230
5t16-assembly1.cif.gz_B crystal structure of yeast rnase iii (rnt1p) complexed with a non-hydrolyzable rna substrate analog 0.4214 135 231
5t16-assembly2.cif.gz_I crystal structure of yeast rnase iii (rnt1p) complexed with a non-hydrolyzable rna substrate analog 0.4198 135 231
4c9j-assembly1.cif.gz_A structure of yeast mitochondrial adp/atp carrier isoform 3 inhibited by carboxyatractyloside (p212121 crystal form) 0.4189 62 227
7w7c-assembly1.cif.gz_B-2 heme exporter in the unliganded form 0.3779 80 220
ID Description Score Start End Superfamily
af_Q2FYK0_57_218_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8925 63 222 1.10.1760.20
af_Q2FYK0_57_218_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8723 63 222 1.10.1760.20
af_P37619_43_201_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.6744 63 223 1.10.1760.20
af_P37619_43_201_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.661 63 223 1.10.1760.20
af_Q4DRR4_110_306_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.5226 84 227 1.50.40.10
ID Description Score Start End GO Terms
AF-A0A6L7GFN8-F1-model_v4 Probable queuosine precursor transporter (Q precursor transporter) 0.9781 18 246 GO:0005886
GO:0022857
GO:1990397
AF-A0A2P0B112-F1-model_v4 Probable queuosine precursor transporter (Q precursor transporter) 0.9738 21 246 GO:0005886
GO:0022857
GO:1990397
AF-W9BR97-F1-model_v4 Probable queuosine precursor transporter (Q precursor transporter) 0.9538 19 249 GO:0005886
GO:0022857
GO:1990397
AF-I4EFN6-F1-model_v4 Probable queuosine precursor transporter (Q precursor transporter) 0.952 12 246 GO:0005886
GO:0022857
GO:1990397
AF-A0A2M7ZIX1-F1-model_v4 Queuosine precursor transporter 0.9515 30 202 GO:0016020
GO:1990397

Feature Viewer

pLDDT pTM Quality
79.74 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map