F432614

General Info

Members Datasets Scaffolds Average Seq Length
393 224 392 234

Family's Representative Sequence

Representative Sequence 3300025938|Ga0207704_10187636|Ga0207704_101876362
Length 272
Sequence LVTSLCDPVKLSLCHSLVRPLQYSTIIKINLANSMNFSTRSYKKELLDRSDIPFADIKQNMKELDFINSKLGGHKITLEGIKTMIKKMNTRAKRNNEKVSILEIGCGGGDNLRVIKNYCEKKNILVQLSGVDINPHCIEFARSRNENTGIEFISSDYKLTNVFPKPDIIFNSLFCHHFTDEEMKEILIWMKAHSRIGFFINDLHRHPVAYYSIKWLTELFSKSYLVRNDAPLSVLRGFKRKELKMFNDQCSILNAQLKWRWAFRWLLIAYNV

Samples

Sample ID Description Type Environment
1 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
136 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
137 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
144 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
145 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
146 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
154 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
155 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
156 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
157 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
158 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
159 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
160 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
161 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
162 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
163 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
164 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
165 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
166 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
167 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
168 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
169 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
170 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
171 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
172 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
173 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
174 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
175 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
176 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
177 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
178 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
179 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
183 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
184 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
185 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
192 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
193 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
194 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
195 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
196 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
197 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
198 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
199 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
200 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
201 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
202 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
203 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
204 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
205 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
206 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
207 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
208 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
209 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
210 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
211 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
212 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
213 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
214 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
215 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
216 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
217 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
218 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
219 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
221 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
224 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0
Isolates 0.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.25
Nodule 0
Rhizoplane 0.51
Rhizosphere 98.98
Stem 0
Stem Tuber 0
Unclassified 0.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10325136 3300003323 Bacteria 4537
2 Ga0065704_10144512 3300005289 Bacteria 1485
3 Ga0065712_10001366 3300005290 Bacteria 11529
4 Ga0065715_10094117 3300005293 Unclassified 4438
5 Ga0065707_10098430 3300005295 Bacteria 3086
6 Ga0065707_10195544 3300005295 Bacteria 1300
7 Ga0070676_10033270 3300005328 Unclassified 2957
8 Ga0070683_100002331 3300005329 Bacteria 15055
9 Ga0070683_100033730 3300005329 Bacteria 4669
10 Ga0070683_100475161 3300005329 Bacteria 1193
11 Ga0070690_100012506 3300005330 Bacteria 4994
12 Ga0070670_100063403 3300005331 Bacteria 3172
13 Ga0070670_100255438 3300005331 Bacteria 1527
14 Ga0070670_100276075 3300005331 Bacteria 1467
15 Ga0068869_100024707 3300005334 Bacteria 4164
16 Ga0068869_100044373 3300005334 Unclassified 3197
17 Ga0068869_100073087 3300005334 Bacteria 2542
18 Ga0068869_100208304 3300005334 Unclassified 1545
19 Ga0070666_10053892 3300005335 Bacteria 2713
20 Ga0070666_10240957 3300005335 Bacteria 1279
21 Ga0070680_100003060 3300005336 Bacteria 12409
22 Ga0070682_100032633 3300005337 Bacteria 3159
23 Ga0068868_100000427 3300005338 Bacteria 28309
24 Ga0068868_100027827 3300005338 Bacteria 4315
25 Ga0068868_100088309 3300005338 Bacteria 2495
26 Ga0068868_100128566 3300005338 Bacteria 2071
27 Ga0068868_100285406 3300005338 Bacteria 1398
28 Ga0070660_100060098 3300005339 Bacteria 2949
29 Ga0070689_100006534 3300005340 Bacteria 8082
30 Ga0070689_100044843 3300005340 Bacteria 3403
31 Ga0070689_100221382 3300005340 Bacteria 1552
32 Ga0070689_100302374 3300005340 Bacteria 1332
33 Ga0070689_100460890 3300005340 Bacteria 1083
34 Ga0070691_10006430 3300005341 Bacteria 5370
35 Ga0070661_100002315 3300005344 Bacteria 13085
36 Ga0070661_100019232 3300005344 Bacteria 4865
37 Ga0070661_100423302 3300005344 Unclassified 1056
38 Ga0070668_100033148 3300005347 Unclassified 3932
39 Ga0070669_100004146 3300005353 Bacteria 10519
40 Ga0070669_100086199 3300005353 Bacteria 2346
41 Ga0070669_100213552 3300005353 Bacteria 1523
42 Ga0070675_100007290 3300005354 Bacteria 8533
43 Ga0070675_100007796 3300005354 Bacteria 8292
44 Ga0070675_100015450 3300005354 Bacteria 6037
45 Ga0070675_100325163 3300005354 Unclassified 1359
46 Ga0070671_100357097 3300005355 Bacteria 1247
47 Ga0070674_100023098 3300005356 Bacteria 4019
48 Ga0070674_100296748 3300005356 Bacteria 1287
49 Ga0070673_100018619 3300005364 Bacteria 4966
50 Ga0070673_100022372 3300005364 Unclassified 4600
51 Ga0070673_100157159 3300005364 Bacteria 1931
52 Ga0070688_100021900 3300005365 Bacteria 3738
53 Ga0070688_100029818 3300005365 Unclassified 3269
54 Ga0070688_100069983 3300005365 Bacteria 2242
55 Ga0070688_100097812 3300005365 Bacteria 1930
56 Ga0070688_100540399 3300005365 Unclassified 884
57 Ga0070659_100003555 3300005366 Bacteria 11096
58 Ga0070659_100374223 3300005366 Bacteria 1199
59 Ga0070667_100053693 3300005367 Unclassified 3401
60 Ga0070667_100205143 3300005367 Bacteria 1750
61 Ga0070667_100392739 3300005367 Bacteria 1261
62 Ga0070701_10009204 3300005438 Unclassified 4319
63 Ga0070701_10131918 3300005438 Bacteria 1420
64 Ga0070700_100028611 3300005441 Unclassified 3317
65 Ga0070700_100250920 3300005441 Bacteria 1269
66 Ga0070663_100072891 3300005455 Bacteria 2503
67 Ga0070678_100064101 3300005456 Bacteria 2722
68 Ga0070662_100009734 3300005457 Bacteria 6292
69 Ga0070662_100011948 3300005457 Bacteria 5742
70 Ga0070662_100098587 3300005457 Bacteria 2208
71 Ga0070662_100149727 3300005457 Unclassified 1815
72 Ga0070662_100160369 3300005457 Bacteria 1759
73 Ga0070662_100347361 3300005457 Bacteria 1215
74 Ga0070681_10077245 3300005458 Bacteria 3288
75 Ga0068867_100077371 3300005459 Bacteria 2500
76 Ga0068867_100124049 3300005459 Bacteria 1999
77 Ga0068867_100480854 3300005459 Unclassified 1064
78 Ga0070685_10019938 3300005466 Bacteria 3625
79 Ga0070685_10043760 3300005466 Bacteria 2561
80 Ga0070679_100003309 3300005530 Bacteria 14759
81 Ga0070684_100001198 3300005535 Bacteria 18634
82 Ga0070684_100285128 3300005535 Bacteria 1513
83 Ga0070684_100360449 3300005535 Bacteria 1338
84 Ga0068853_100003735 3300005539 Bacteria 11682
85 Ga0068853_100030039 3300005539 Bacteria 4587
86 Ga0070672_100025639 3300005543 Bacteria 4376
87 Ga0070686_100001965 3300005544 Bacteria 11413
88 Ga0070686_100056093 3300005544 Unclassified 2526
89 Ga0070693_100004189 3300005547 Bacteria 6810
90 Ga0070665_100060341 3300005548 Bacteria 3802
91 Ga0070704_100320563 3300005549 Bacteria 1298
92 Ga0068855_100545673 3300005563 Unclassified 1255
93 Ga0070664_100006530 3300005564 Bacteria 9403
94 Ga0070664_100035871 3300005564 Bacteria 4164
95 Ga0070664_100055517 3300005564 Bacteria 3363
96 Ga0070664_100146218 3300005564 Bacteria 2085
97 Ga0070664_100458724 3300005564 Bacteria 1171
98 Ga0070664_100665056 3300005564 Bacteria 968
99 Ga0068857_100007841 3300005577 Bacteria 9207
100 Ga0068857_100011785 3300005577 Bacteria 7604
101 Ga0068857_100180416 3300005577 Bacteria 1922
102 Ga0068857_100219431 3300005577 Bacteria 1736
103 Ga0068857_100277037 3300005577 Bacteria 1542
104 Ga0068856_100248637 3300005614 Bacteria 1793
105 Ga0068852_100031520 3300005616 Bacteria 4376
106 Ga0068852_100145058 3300005616 Bacteria 2201
107 Ga0068852_100376189 3300005616 Bacteria 1392
108 Ga0068852_100744901 3300005616 Bacteria 992
109 Ga0068852_100814521 3300005616 Bacteria 948
110 Ga0068859_100017677 3300005617 Bacteria 7169
111 Ga0068859_100072364 3300005617 Bacteria 3484
112 Ga0068864_100124691 3300005618 Bacteria 2307
113 Ga0068861_100137959 3300005719 Bacteria 1987
114 Ga0068851_10354625 3300005834 Bacteria 854
115 Ga0068863_100498205 3300005841 Bacteria 1199
116 Ga0068863_100798416 3300005841 Bacteria 941
117 Ga0068858_100150503 3300005842 Unclassified 2188
118 Ga0068858_100689699 3300005842 Bacteria 993
119 Ga0068860_100015775 3300005843 Bacteria 7376
120 Ga0068862_100010142 3300005844 Bacteria 7775
121 Ga0081540_1017445 3300005983 Bacteria 4444
122 Ga0081539_10082117 3300005985 Bacteria 1691
123 Ga0097621_100011606 3300006237 Bacteria 6494
124 Ga0068871_100035949 3300006358 Bacteria 3940
125 Ga0068871_100561179 3300006358 Unclassified 1035
126 Ga0075428_100773546 3300006844 Bacteria 1021
127 Ga0075434_100009056 3300006871 Bacteria 9272
128 Ga0075434_100609300 3300006871 Bacteria 1111
129 Ga0068865_100013971 3300006881 Bacteria 5094
130 Ga0068865_100151747 3300006881 Bacteria 1758
131 Ga0097620_100017677 3300006931 Bacteria 7169
132 Ga0097620_100072356 3300006931 Bacteria 3484
133 Ga0105240_10009860 3300009093 Bacteria 13483
134 Ga0111539_10003835 3300009094 Bacteria 19797
135 Ga0111539_10073279 3300009094 Bacteria 4038
136 Ga0105241_10000985 3300009174 Bacteria 21588
137 Ga0105241_10292606 3300009174 Bacteria 1395
138 Ga0105242_10671098 3300009176 Bacteria 1010
139 Ga0105248_10038321 3300009177 Bacteria 5364
140 Ga0105237_10166614 3300009545 Bacteria 2202
141 Ga0105249_10089921 3300009553 Bacteria 2870
142 Ga0105239_11105282 3300010375 Unclassified 913
143 Ga0105246_10804515 3300011119 Unclassified 834
144 Ga0157373_10000699 3300013100 Bacteria 26275
145 Ga0157373_10033068 3300013100 Bacteria 3722
146 Ga0157371_10000284 3300013102 Bacteria 68549
147 Ga0157371_10000725 3300013102 Bacteria 38633
148 Ga0157371_10022134 3300013102 Bacteria 4662
149 Ga0157371_10467584 3300013102 Unclassified 929
150 Ga0157370_10004751 3300013104 Bacteria 15462
151 Ga0157370_10021147 3300013104 Bacteria 6488
152 Ga0157374_10000260 3300013296 Bacteria 48732
153 Ga0157374_10020690 3300013296 Bacteria 5842
154 Ga0157374_10117236 3300013296 Bacteria 2566
155 Ga0157374_10691605 3300013296 Bacteria 1033
156 Ga0157378_10023750 3300013297 Bacteria 5394
157 Ga0157378_10177241 3300013297 Bacteria 2003
158 Ga0157378_11022917 3300013297 Unclassified 861
159 Ga0163162_10002647 3300013306 Bacteria 16974
160 Ga0163162_10022439 3300013306 Bacteria 6218
161 Ga0163162_10069905 3300013306 Unclassified 3563
162 Ga0163162_10076787 3300013306 Unclassified 3403
163 Ga0157372_10137971 3300013307 Bacteria 2809
164 Ga0157372_10200636 3300013307 Bacteria 2310
165 Ga0157372_10739713 3300013307 Bacteria 1144
166 Ga0157375_10010009 3300013308 Bacteria 8337
167 Ga0157375_10027553 3300013308 Bacteria 5312
168 Ga0157375_10068834 3300013308 Bacteria 3543
169 Ga0157375_10115825 3300013308 Bacteria 2783
170 Ga0157375_10468921 3300013308 Bacteria 1424
171 Ga0163163_10000279 3300014325 Bacteria 50882
172 Ga0163163_10242762 3300014325 Bacteria 1851
173 Ga0163163_10405066 3300014325 Bacteria 1422
174 Ga0163163_10983103 3300014325 Bacteria 907
175 Ga0157380_10003974 3300014326 Bacteria 10206
176 Ga0157377_10001633 3300014745 Bacteria 9771
177 Ga0157377_10007473 3300014745 Bacteria 5280
178 Ga0157377_10008716 3300014745 Bacteria 4957
179 Ga0157377_10017063 3300014745 Unclassified 3750
180 Ga0157379_10121227 3300014968 Bacteria 2352
181 Ga0157376_10007029 3300014969 Bacteria 7989
182 Ga0157376_10053690 3300014969 Unclassified 3356
183 Ga0157376_10058402 3300014969 Bacteria 3231
184 Ga0157376_10267076 3300014969 Bacteria 1605
185 Ga0157376_10788046 3300014969 Bacteria 962
186 Ga0163161_10005088 3300017792 Bacteria 9153
187 Ga0163161_10087250 3300017792 Bacteria 2304
188 Ga0163161_10143677 3300017792 Bacteria 1808
189 Ga0163161_10221534 3300017792 Unclassified 1465
190 Ga0207688_10043312 3300025901 Bacteria 2506
191 Ga0207688_10065192 3300025901 Bacteria 2058
192 Ga0207680_10244092 3300025903 Bacteria 1238
193 Ga0207680_10447927 3300025903 Bacteria 916
194 Ga0207647_10046102 3300025904 Bacteria 2717
195 Ga0207645_10085980 3300025907 Bacteria 2020
196 Ga0207645_10137190 3300025907 Bacteria 1593
197 Ga0207705_10231104 3300025909 Bacteria 1407
198 Ga0207654_10006489 3300025911 Bacteria 5888
199 Ga0207707_10003504 3300025912 Bacteria 13893
200 Ga0207660_10005510 3300025917 Bacteria 8222
201 Ga0207662_10021541 3300025918 Bacteria 3686
202 Ga0207657_10084500 3300025919 Unclassified 2660
203 Ga0207649_10026846 3300025920 Bacteria 3372
204 Ga0207649_10145701 3300025920 Bacteria 1625
205 Ga0207652_10008710 3300025921 Bacteria 8165
206 Ga0207681_10011577 3300025923 Bacteria 5419
207 Ga0207650_10046246 3300025925 Bacteria 3205
208 Ga0207650_10401510 3300025925 Bacteria 1134
209 Ga0207659_10014724 3300025926 Bacteria 5053
210 Ga0207659_10056070 3300025926 Bacteria 2821
211 Ga0207659_10104544 3300025926 Bacteria 2141
212 Ga0207644_10071091 3300025931 Unclassified 2545
213 Ga0207644_10277021 3300025931 Bacteria 1346
214 Ga0207690_10066491 3300025932 Bacteria 2469
215 Ga0207706_10003994 3300025933 Bacteria 13976
216 Ga0207706_10069185 3300025933 Bacteria 3105
217 Ga0207706_10166603 3300025933 Bacteria 1936
218 Ga0207706_10305430 3300025933 Bacteria 1386
219 Ga0207706_10457955 3300025933 Bacteria 1103
220 Ga0207670_10006784 3300025936 Bacteria 6368
221 Ga0207670_10018759 3300025936 Bacteria 4213
222 Ga0207670_10318549 3300025936 Bacteria 1223
223 Ga0207670_10386755 3300025936 Bacteria 1115
224 Ga0207704_10187636 3300025938 Bacteria 1501
225 Ga0207691_10039568 3300025940 Bacteria 4361
226 Ga0207691_10049190 3300025940 Unclassified 3863
227 Ga0207691_10226098 3300025940 Bacteria 1621
228 Ga0207711_10412389 3300025941 Unclassified 1256
229 Ga0207689_10017516 3300025942 Bacteria 6060
230 Ga0207689_10041033 3300025942 Unclassified 3829
231 Ga0207689_10063876 3300025942 Unclassified 3029
232 Ga0207689_10090581 3300025942 Unclassified 2513
233 Ga0207661_10003108 3300025944 Bacteria 11489
234 Ga0207661_10034774 3300025944 Bacteria 3922
235 Ga0207661_10091117 3300025944 Bacteria 2540
236 Ga0207679_10004210 3300025945 Bacteria 8939
237 Ga0207679_10012502 3300025945 Bacteria 5535
238 Ga0207679_10017260 3300025945 Unclassified 4811
239 Ga0207679_10693363 3300025945 Bacteria 924
240 Ga0207667_10476205 3300025949 Bacteria 1268
241 Ga0207667_10521196 3300025949 Bacteria 1204
242 Ga0207651_10005231 3300025960 Bacteria 6633
243 Ga0207651_10136073 3300025960 Bacteria 1890
244 Ga0207668_10100331 3300025972 Bacteria 2149
245 Ga0207640_10212461 3300025981 Bacteria 1475
246 Ga0207658_10011371 3300025986 Bacteria 6057
247 Ga0207677_10018387 3300026023 Unclassified 4193
248 Ga0207677_10116904 3300026023 Bacteria 1998
249 Ga0207677_10165642 3300026023 Bacteria 1722
250 Ga0207703_10077261 3300026035 Bacteria 2764
251 Ga0207703_10176348 3300026035 Bacteria 1883
252 Ga0207639_10021770 3300026041 Bacteria 4608
253 Ga0207639_10257112 3300026041 Bacteria 1526
254 Ga0207678_10031808 3300026067 Unclassified 4601
255 Ga0207678_10043045 3300026067 Bacteria 3909
256 Ga0207708_10034032 3300026075 Unclassified 3875
257 Ga0207708_10190881 3300026075 Bacteria 1631
258 Ga0207641_10189811 3300026088 Bacteria 1888
259 Ga0207648_10020364 3300026089 Bacteria 5974
260 Ga0207648_10083158 3300026089 Bacteria 2792
261 Ga0207648_10122109 3300026089 Bacteria 2290
262 Ga0207676_10003591 3300026095 Bacteria 10965
263 Ga0207676_10162569 3300026095 Bacteria 1936
264 Ga0207674_10004031 3300026116 Bacteria 17828
265 Ga0207674_10006535 3300026116 Bacteria 13706
266 Ga0207674_10014867 3300026116 Bacteria 8583
267 Ga0207674_10310952 3300026116 Bacteria 1525
268 Ga0207675_100001183 3300026118 Bacteria 25978
269 Ga0207675_100034881 3300026118 Bacteria 4691
270 Ga0207675_100095057 3300026118 Bacteria 2803
271 Ga0207683_10017143 3300026121 Bacteria 6166
272 Ga0207683_10382478 3300026121 Bacteria 1294
273 Ga0207698_10117849 3300026142 Bacteria 2241
274 Ga0207698_10302537 3300026142 Bacteria 1489
275 Ga0207428_10012094 3300027907 Bacteria 7596
276 Ga0268266_10258885 3300028379 Bacteria 1612
277 Ga0268265_10011180 3300028380 Bacteria 6066
278 Ga0268264_10221905 3300028381 Bacteria 1740
279 Ga0307405_10005405 3300031731 Bacteria 6160
280 Ga0307413_10008468 3300031824 Bacteria 4858
281 Ga0307410_10159760 3300031852 Unclassified 1687
282 Ga0307410_10507770 3300031852 Bacteria 993
283 Ga0307406_10428828 3300031901 Unclassified 1055
284 Ga0307416_100032160 3300032002 Unclassified 3960
285 Ga0307414_10224660 3300032004 Bacteria 1544
286 Ga0307411_10061340 3300032005 Bacteria 2503
287 Ga0307415_100306277 3300032126 Unclassified 1318
288 Ga0373923_0277834 3300035111 Unclassified 789
289 Ga0373956_0124356 3300035119 Bacteria 1206
290 Ga0373924_0022664 3300035410 Unclassified 2456
291 Ga0373947_0055487 3300035725 Unclassified 2393
292 Ga0373937_0006671 3300036401 Bacteria 9965
293 Ga0373937_0214143 3300036401 Bacteria 1813
294 Ga0373937_0922084 3300036401 Bacteria 822
295 Ga0395899_0027278 3300037312 Bacteria 4306
296 Ga0395900_0067210 3300037418 Bacteria 3682
297 Ga0395900_0148341 3300037418 Bacteria 2397
298 Ga0395898_0031448 3300037466 Bacteria 5302
299 Ga0395905_0009765 3300037471 Bacteria 9359
300 Ga0395901_0045981 3300038443 Bacteria 4532
301 Ga0439433_0011416 3300041999 Bacteria 1946
302 Ga0450898_000889 3300042134 Bacteria 3737
303 Ga0451577_0278956 3300042876 Bacteria 1514
304 Ga0466966_0187066 3300044684 Bacteria 1255
305 Ga0466970_0245707 3300044765 Bacteria 1002
306 Ga0495592_0049965 3300046454 Unclassified 3108
307 Ga0495653_0060576 3300046463 Bacteria 2867
308 Ga0495580_0075482 3300046472 Unclassified 2352
309 Ga0495580_0522474 3300046472 Bacteria 791
310 Ga0495608_0163040 3300046511 Unclassified 1417
311 Ga0495618_0075906 3300046514 Unclassified 2141
312 Ga0495628_0022064 3300046516 Bacteria 5233
313 Ga0495630_0011846 3300046517 Bacteria 6319
314 Ga0495630_0111501 3300046517 Bacteria 2072
315 Ga0495642_0143845 3300046528 Bacteria 1030
316 Ga0495586_0009224 3300046535 Bacteria 5247
317 Ga0495587_0025753 3300046536 Bacteria 3594
318 Ga0495587_0146644 3300046536 Unclassified 1346
319 Ga0495645_0266115 3300046543 Bacteria 1133
320 Ga0495667_0034520 3300046559 Bacteria 3383
321 Ga0495634_0030013 3300046642 Bacteria 3759
322 Ga0495634_0341616 3300046642 Bacteria 898
323 Ga0495635_0098551 3300046663 Bacteria 1998
324 Ga0495635_0210652 3300046663 Unclassified 1316
325 Ga0495635_0225298 3300046663 Bacteria 1267
326 Ga0495657_0059670 3300046675 Unclassified 2530
327 Ga0495613_0278212 3300046689 Unclassified 1163
328 Ga0495581_0105348 3300047315 Unclassified 1639
329 Ga0495674_0034710 3300047319 Unclassified 4558
330 Ga0495672_0038837 3300047320 Unclassified 2900
331 Ga0495680_0037499 3300047322 Bacteria 3882
332 Ga0495684_0053521 3300047471 Unclassified 3080
333 Ga0495593_0097738 3300047673 Unclassified 1508
334 Ga0496104_0375822 3300048907 Bacteria 1334
335 Ga0496110_0019814 3300048913 Bacteria 5669
336 Ga0501290_001368 3300049513 Bacteria 3370
337 Ga0501292_012767 3300049515 Unclassified 1286
338 Ga0501292_033291 3300049515 Bacteria 872
339 Ga0501297_017887 3300049520 Bacteria 867
340 Ga0501032_0018512 3300049569 Bacteria 4878
341 Ga0501033_0190226 3300049570 Bacteria 1469
342 Ga0501034_0037661 3300049571 Bacteria 4898
343 Ga0501039_0029118 3300049575 Bacteria 4253
344 Ga0501043_0003072 3300049579 Bacteria 13875
345 Ga0501043_0240279 3300049579 Bacteria 1397
346 Ga0501047_0010118 3300049581 Bacteria 8917
347 Ga0501072_0101159 3300049588 Bacteria 2291
348 Ga0501198_001549 3300049649 Bacteria 3025
349 Ga0501198_003248 3300049649 Bacteria 2217
350 Ga0501198_044732 3300049649 Bacteria 775
351 Ga0501201_004221 3300049651 Bacteria 1328
352 Ga0501202_000471 3300049652 Bacteria 5744
353 Ga0501202_000819 3300049652 Bacteria 4691
354 Ga0501207_003097 3300049654 Bacteria 2189
355 Ga0501209_013399 3300049656 Bacteria 1774
356 Ga0501211_007377 3300049658 Bacteria 1080
357 Ga0501216_010200 3300049660 Bacteria 1506
358 Ga0501217_000662 3300049661 Bacteria 5835
359 Ga0501217_001989 3300049661 Unclassified 3942
360 Ga0501217_052829 3300049661 Bacteria 1067
361 Ga0501223_001850 3300049663 Bacteria 4780
362 Ga0501223_010007 3300049663 Unclassified 1912
363 Ga0501224_000573 3300049664 Bacteria 4517
364 Ga0501233_045898 3300049668 Bacteria 1043
365 Ga0501235_003342 3300049669 Bacteria 3468
366 Ga0501235_012282 3300049669 Bacteria 1883
367 Ga0501239_021082 3300049672 Unclassified 800
368 Ga0501240_012890 3300049673 Bacteria 1151
369 Ga0501242_010174 3300049674 Bacteria 1121
370 Ga0501243_002907 3300049675 Bacteria 2521
371 Ga0501249_012667 3300049679 Bacteria 1785
372 Ga0501251_001781 3300049681 Bacteria 2025
373 Ga0501257_007725 3300049686 Bacteria 2406
374 Ga0501259_000701 3300049688 Bacteria 5410
375 Ga0501259_005809 3300049688 Bacteria 1957
376 Ga0501261_000533 3300049690 Bacteria 4847
377 Ga0501221_000086 3300049704 Bacteria 10739
378 Ga0501221_039799 3300049704 Bacteria 1020
379 Ga0501225_0006624 3300049705 Bacteria 3379
380 Ga0501225_0007974 3300049705 Bacteria 3051
381 Ga0501245_000771 3300049708 Bacteria 3999
382 Ga0501268_002840 3300049765 Bacteria 2319
383 Ga0501279_002478 3300049775 Bacteria 2421
384 Ga0501280_016826 3300049776 Bacteria 1058
385 Ga0501035_0411751 3300049822 Bacteria 1123
386 Ga0501044_0016594 3300049823 Bacteria 7904
387 Ga0501044_0445611 3300049823 Bacteria 1202
388 nmdc:mga06r32_81629_c1 3300050510 Unclassified 3149
389 nmdc:mga08y16_1505_c1 3300050511 Bacteria 23452
390 nmdc:mga08y16_80441_c1 3300050511 Bacteria 3397
391 nmdc:mga0n895_10170_c1 3300050512 Bacteria 8285
392 Ga0500627_0147516 3300053158 Bacteria 1063

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035111 Ga0373923_0277834 Ga0373923_0277834_42_623 193
2 3300036401 Ga0373937_0214143 Ga0373937_0214143_1179_1760 193
3 3300049672 Ga0501239_021082 Ga0501239_021082_14_631 199
4 3300005354 Ga0070675_100325163 Ga0070675_1003251632 210
5 3300005456 Ga0070678_100064101 Ga0070678_1000641013 210
6 3300005457 Ga0070662_100160369 Ga0070662_1001603692 210
7 3300005543 Ga0070672_100025639 Ga0070672_1000256393 210
8 3300005544 Ga0070686_100001965 Ga0070686_1000019656 210
9 3300005564 Ga0070664_100035871 Ga0070664_1000358712 210
10 3300025901 Ga0207688_10043312 Ga0207688_100433123 210
11 3300025907 Ga0207645_10085980 Ga0207645_100859803 210
12 3300025940 Ga0207691_10039568 Ga0207691_100395683 210
13 3300025945 Ga0207679_10012502 Ga0207679_100125025 210
14 3300026142 Ga0207698_10117849 Ga0207698_101178492 210
15 3300005331 Ga0070670_100276075 Ga0070670_1002760752 217
16 3300005353 Ga0070669_100213552 Ga0070669_1002135522 217
17 3300005354 Ga0070675_100007290 Ga0070675_1000072904 217
18 3300005356 Ga0070674_100296748 Ga0070674_1002967482 217
19 3300005441 Ga0070700_100250920 Ga0070700_1002509202 217
20 3300025925 Ga0207650_10401510 Ga0207650_104015102 217
21 3300025926 Ga0207659_10056070 Ga0207659_100560702 217
22 3300005295 Ga0065707_10195544 Ga0065707_101955442 222
23 3300041999 Ga0439433_0011416 Ga0439433_0011416_151_846 222
24 3300042134 Ga0450898_000889 Ga0450898_000889_526_1221 222
25 3300005983 Ga0081540_1017445 Ga0081540_10174455 223
26 3300047320 Ga0495672_0038837 Ga0495672_0038837_2016_2849 223
27 3300005331 Ga0070670_100255438 Ga0070670_1002554382 228
28 3300049513 Ga0501290_001368 Ga0501290_001368_960_1646 228
29 3300049515 Ga0501292_033291 Ga0501292_033291_30_716 228
30 3300049520 Ga0501297_017887 Ga0501297_017887_156_842 228
31 3300049649 Ga0501198_001549 Ga0501198_001549_2179_2865 228
32 3300049651 Ga0501201_004221 Ga0501201_004221_477_1163 228
33 3300049652 Ga0501202_000819 Ga0501202_000819_1369_2055 228
34 3300049654 Ga0501207_003097 Ga0501207_003097_204_890 228
35 3300049661 Ga0501217_000662 Ga0501217_000662_3317_4003 228
36 3300049663 Ga0501223_001850 Ga0501223_001850_3393_4079 228
37 3300049664 Ga0501224_000573 Ga0501224_000573_2215_2901 228
38 3300049668 Ga0501233_045898 Ga0501233_045898_317_1003 228
39 3300049669 Ga0501235_003342 Ga0501235_003342_1844_2530 228
40 3300049673 Ga0501240_012890 Ga0501240_012890_309_995 228
41 3300049674 Ga0501242_010174 Ga0501242_010174_327_1013 228
42 3300049688 Ga0501259_000701 Ga0501259_000701_1479_2165 228
43 3300049690 Ga0501261_000533 Ga0501261_000533_1257_1943 228
44 3300049704 Ga0501221_000086 Ga0501221_000086_8226_8912 228
45 3300049705 Ga0501225_0007974 Ga0501225_0007974_1984_2670 228
46 3300049708 Ga0501245_000771 Ga0501245_000771_1862_2548 228
47 3300049765 Ga0501268_002840 Ga0501268_002840_1597_2283 228
48 3300049775 Ga0501279_002478 Ga0501279_002478_1431_2117 228
49 3300005289 Ga0065704_10144512 Ga0065704_101445122 229
50 3300005290 Ga0065712_10001366 Ga0065712_100013667 229
51 3300005293 Ga0065715_10094117 Ga0065715_100941174 229
52 3300005295 Ga0065707_10098430 Ga0065707_100984304 229
53 3300005336 Ga0070680_100003060 Ga0070680_1000030604 229
54 3300005337 Ga0070682_100032633 Ga0070682_1000326332 229
55 3300005338 Ga0068868_100285406 Ga0068868_1002854062 229
56 3300005340 Ga0070689_100006534 Ga0070689_1000065343 229
57 3300005341 Ga0070691_10006430 Ga0070691_100064304 229
58 3300005347 Ga0070668_100033148 Ga0070668_1000331484 229
59 3300005353 Ga0070669_100004146 Ga0070669_1000041464 229
60 3300005354 Ga0070675_100007796 Ga0070675_1000077967 229
61 3300005364 Ga0070673_100018619 Ga0070673_1000186193 229
62 3300005365 Ga0070688_100029818 Ga0070688_1000298182 229
63 3300005438 Ga0070701_10009204 Ga0070701_100092042 229
64 3300005441 Ga0070700_100028611 Ga0070700_1000286112 229
65 3300005457 Ga0070662_100098587 Ga0070662_1000985871 229
66 3300005458 Ga0070681_10077245 Ga0070681_100772452 229
67 3300005459 Ga0068867_100124049 Ga0068867_1001240492 229
68 3300005530 Ga0070679_100003309 Ga0070679_10000330912 229
69 3300005539 Ga0068853_100003735 Ga0068853_1000037353 229
70 3300005547 Ga0070693_100004189 Ga0070693_1000041895 229
71 3300005549 Ga0070704_100320563 Ga0070704_1003205632 229
72 3300005563 Ga0068855_100545673 Ga0068855_1005456731 229
73 3300005577 Ga0068857_100219431 Ga0068857_1002194312 229
74 3300005844 Ga0068862_100010142 Ga0068862_1000101427 229
75 3300006881 Ga0068865_100013971 Ga0068865_1000139714 229
76 3300009093 Ga0105240_10009860 Ga0105240_100098606 229
77 3300009094 Ga0111539_10003835 Ga0111539_100038354 229
78 3300009174 Ga0105241_10000985 Ga0105241_100009856 229
79 3300009545 Ga0105237_10166614 Ga0105237_101666142 229
80 3300013102 Ga0157371_10000284 Ga0157371_1000028432 229
81 3300013104 Ga0157370_10004751 Ga0157370_100047517 229
82 3300013296 Ga0157374_10691605 Ga0157374_106916052 229
83 3300013306 Ga0163162_10076787 Ga0163162_100767874 229
84 3300013308 Ga0157375_10468921 Ga0157375_104689212 229
85 3300014326 Ga0157380_10003974 Ga0157380_100039744 229
86 3300014745 Ga0157377_10001633 Ga0157377_100016335 229
87 3300025911 Ga0207654_10006489 Ga0207654_100064893 229
88 3300025912 Ga0207707_10003504 Ga0207707_100035043 229
89 3300025917 Ga0207660_10005510 Ga0207660_100055105 229
90 3300025921 Ga0207652_10008710 Ga0207652_100087104 229
91 3300025926 Ga0207659_10014724 Ga0207659_100147242 229
92 3300025936 Ga0207670_10018759 Ga0207670_100187594 229
93 3300025940 Ga0207691_10049190 Ga0207691_100491904 229
94 3300025949 Ga0207667_10476205 Ga0207667_104762052 229
95 3300025960 Ga0207651_10005231 Ga0207651_100052316 229
96 3300025972 Ga0207668_10100331 Ga0207668_101003312 229
97 3300026075 Ga0207708_10034032 Ga0207708_100340324 229
98 3300026089 Ga0207648_10122109 Ga0207648_101221092 229
99 3300026116 Ga0207674_10006535 Ga0207674_100065352 229
100 3300026116 Ga0207674_10310952 Ga0207674_103109522 229
101 3300026118 Ga0207675_100001183 Ga0207675_1000011836 229
102 3300027907 Ga0207428_10012094 Ga0207428_100120948 229
103 3300028380 Ga0268265_10011180 Ga0268265_100111802 229
104 3300035119 Ga0373956_0124356 Ga0373956_0124356_475_1164 229
105 3300042876 Ga0451577_0278956 Ga0451577_0278956_10_702 229
106 3300046472 Ga0495580_0075482 Ga0495580_0075482_1572_2261 229
107 3300046472 Ga0495580_0522474 Ga0495580_0522474_41_730 229
108 3300046511 Ga0495608_0163040 Ga0495608_0163040_285_974 229
109 3300046517 Ga0495630_0111501 Ga0495630_0111501_296_985 229
110 3300046528 Ga0495642_0143845 Ga0495642_0143845_297_1019 229
111 3300046536 Ga0495587_0146644 Ga0495587_0146644_162_851 229
112 3300046663 Ga0495635_0225298 Ga0495635_0225298_159_848 229
113 3300047315 Ga0495581_0105348 Ga0495581_0105348_273_962 229
114 3300047319 Ga0495674_0034710 Ga0495674_0034710_1913_2602 229
115 3300047471 Ga0495684_0053521 Ga0495684_0053521_690_1379 229
116 3300047673 Ga0495593_0097738 Ga0495593_0097738_321_1010 229
117 3300050511 nmdc:mga08y16_1505_c1 nmdc:mga08y16_1505_c1_3300_3995 229
118 iso_pu_bacteria 2896317667 2896319559 229
119 3300013100 Ga0157373_10000699 Ga0157373_100006997 230
120 3300013102 Ga0157371_10000725 Ga0157371_1000072516 230
121 3300013102 Ga0157371_10022134 Ga0157371_100221342 230
122 3300013104 Ga0157370_10021147 Ga0157370_100211473 230
123 3300037312 Ga0395899_0027278 Ga0395899_0027278_3070_3768 230
124 3300037418 Ga0395900_0067210 Ga0395900_0067210_539_1237 230
125 3300037418 Ga0395900_0148341 Ga0395900_0148341_1155_1853 230
126 3300037466 Ga0395898_0031448 Ga0395898_0031448_674_1372 230
127 3300037471 Ga0395905_0009765 Ga0395905_0009765_1279_1977 230
128 3300038443 Ga0395901_0045981 Ga0395901_0045981_1261_1959 230
129 3300006237 Ga0097621_100011606 Ga0097621_1000116066 231
130 3300006358 Ga0068871_100035949 Ga0068871_1000359494 231
131 3300013306 Ga0163162_10002647 Ga0163162_100026475 231
132 3300014969 Ga0157376_10053690 Ga0157376_100536903 231
133 3300014969 Ga0157376_10058402 Ga0157376_100584023 231
134 3300053158 Ga0500627_0147516 Ga0500627_0147516_276_974 231
135 3300005339 Ga0070660_100060098 Ga0070660_1000600982 232
136 3300005354 Ga0070675_100015450 Ga0070675_1000154503 232
137 3300005459 Ga0068867_100480854 Ga0068867_1004808542 232
138 3300005843 Ga0068860_100015775 Ga0068860_1000157752 232
139 3300006844 Ga0075428_100773546 Ga0075428_1007735462 232
140 3300009176 Ga0105242_10671098 Ga0105242_106710981 232
141 3300013307 Ga0157372_10200636 Ga0157372_102006362 232
142 3300013307 Ga0157372_10739713 Ga0157372_107397132 232
143 3300014969 Ga0157376_10267076 Ga0157376_102670761 232
144 3300025909 Ga0207705_10231104 Ga0207705_102311042 232
145 3300026089 Ga0207648_10083158 Ga0207648_100831582 232
146 3300031852 Ga0307410_10507770 Ga0307410_105077702 232
147 3300032004 Ga0307414_10224660 Ga0307414_102246602 232
148 3300036401 Ga0373937_0922084 Ga0373937_0922084_107_808 232
149 3300044684 Ga0466966_0187066 Ga0466966_0187066_225_956 232
150 3300050510 nmdc:mga06r32_81629_c1 nmdc:mga06r32_81629_c1_1692_2393 232
151 3300005455 Ga0070663_100072891 Ga0070663_1000728912 233
152 3300026067 Ga0207678_10043045 Ga0207678_100430454 233
153 3300049569 Ga0501032_0018512 Ga0501032_0018512_3264_3983 233
154 3300049570 Ga0501033_0190226 Ga0501033_0190226_558_1277 233
155 3300049571 Ga0501034_0037661 Ga0501034_0037661_2281_3000 233
156 3300049575 Ga0501039_0029118 Ga0501039_0029118_1417_2136 233
157 3300049579 Ga0501043_0003072 Ga0501043_0003072_4593_5312 233
158 3300049579 Ga0501043_0240279 Ga0501043_0240279_538_1257 233
159 3300049581 Ga0501047_0010118 Ga0501047_0010118_6716_7435 233
160 3300049822 Ga0501035_0411751 Ga0501035_0411751_374_1093 233
161 3300049823 Ga0501044_0016594 Ga0501044_0016594_1822_2541 233
162 3300049823 Ga0501044_0445611 Ga0501044_0445611_449_1168 233
163 3300005328 Ga0070676_10033270 Ga0070676_100332702 234
164 3300005329 Ga0070683_100033730 Ga0070683_1000337303 234
165 3300005331 Ga0070670_100063403 Ga0070670_1000634034 234
166 3300005334 Ga0068869_100044373 Ga0068869_1000443733 234
167 3300005338 Ga0068868_100088309 Ga0068868_1000883092 234
168 3300005340 Ga0070689_100221382 Ga0070689_1002213822 234
169 3300005344 Ga0070661_100019232 Ga0070661_1000192323 234
170 3300005365 Ga0070688_100097812 Ga0070688_1000978122 234
171 3300005457 Ga0070662_100347361 Ga0070662_1003473611 234
172 3300005466 Ga0070685_10043760 Ga0070685_100437602 234
173 3300005564 Ga0070664_100055517 Ga0070664_1000555172 234
174 3300005577 Ga0068857_100007841 Ga0068857_1000078415 234
175 3300005616 Ga0068852_100744901 Ga0068852_1007449011 234
176 3300013296 Ga0157374_10000260 Ga0157374_1000026036 234
177 3300013308 Ga0157375_10115825 Ga0157375_101158252 234
178 3300014325 Ga0163163_10000279 Ga0163163_1000027910 234
179 3300014745 Ga0157377_10008716 Ga0157377_100087163 234
180 3300025907 Ga0207645_10137190 Ga0207645_101371902 234
181 3300025925 Ga0207650_10046246 Ga0207650_100462462 234
182 3300025933 Ga0207706_10457955 Ga0207706_104579552 234
183 3300025936 Ga0207670_10006784 Ga0207670_100067847 234
184 3300025940 Ga0207691_10226098 Ga0207691_102260982 234
185 3300025942 Ga0207689_10063876 Ga0207689_100638762 234
186 3300025944 Ga0207661_10034774 Ga0207661_100347742 234
187 3300025945 Ga0207679_10017260 Ga0207679_100172603 234
188 3300026023 Ga0207677_10018387 Ga0207677_100183873 234
189 3300026095 Ga0207676_10003591 Ga0207676_100035912 234
190 3300026116 Ga0207674_10014867 Ga0207674_100148673 234
191 3300026121 Ga0207683_10382478 Ga0207683_103824781 234
192 3300028381 Ga0268264_10221905 Ga0268264_102219052 234
193 3300044765 Ga0466970_0245707 Ga0466970_0245707_26_733 234
194 3300048907 Ga0496104_0375822 Ga0496104_0375822_608_1315 234
195 3300049515 Ga0501292_012767 Ga0501292_012767_414_1139 234
196 3300005329 Ga0070683_100002331 Ga0070683_10000233111 235
197 3300005329 Ga0070683_100475161 Ga0070683_1004751611 235
198 3300005330 Ga0070690_100012506 Ga0070690_1000125064 235
199 3300005334 Ga0068869_100073087 Ga0068869_1000730872 235
200 3300005334 Ga0068869_100208304 Ga0068869_1002083041 235
201 3300005335 Ga0070666_10053892 Ga0070666_100538922 235
202 3300005335 Ga0070666_10240957 Ga0070666_102409572 235
203 3300005338 Ga0068868_100000427 Ga0068868_10000042714 235
204 3300005338 Ga0068868_100027827 Ga0068868_1000278277 235
205 3300005338 Ga0068868_100128566 Ga0068868_1001285661 235
206 3300005340 Ga0070689_100044843 Ga0070689_1000448432 235
207 3300005340 Ga0070689_100302374 Ga0070689_1003023742 235
208 3300005340 Ga0070689_100460890 Ga0070689_1004608901 235
209 3300005344 Ga0070661_100002315 Ga0070661_1000023152 235
210 3300005353 Ga0070669_100086199 Ga0070669_1000861992 235
211 3300005356 Ga0070674_100023098 Ga0070674_1000230983 235
212 3300005364 Ga0070673_100022372 Ga0070673_1000223724 235
213 3300005364 Ga0070673_100157159 Ga0070673_1001571592 235
214 3300005365 Ga0070688_100021900 Ga0070688_1000219001 235
215 3300005365 Ga0070688_100540399 Ga0070688_1005403992 235
216 3300005366 Ga0070659_100003555 Ga0070659_1000035556 235
217 3300005366 Ga0070659_100374223 Ga0070659_1003742232 235
218 3300005367 Ga0070667_100053693 Ga0070667_1000536932 235
219 3300005367 Ga0070667_100205143 Ga0070667_1002051432 235
220 3300005367 Ga0070667_100392739 Ga0070667_1003927392 235
221 3300005438 Ga0070701_10131918 Ga0070701_101319182 235
222 3300005457 Ga0070662_100009734 Ga0070662_1000097345 235
223 3300005457 Ga0070662_100011948 Ga0070662_1000119483 235
224 3300005457 Ga0070662_100149727 Ga0070662_1001497272 235
225 3300005459 Ga0068867_100077371 Ga0068867_1000773712 235
226 3300005466 Ga0070685_10019938 Ga0070685_100199384 235
227 3300005535 Ga0070684_100001198 Ga0070684_10000119814 235
228 3300005535 Ga0070684_100285128 Ga0070684_1002851282 235
229 3300005535 Ga0070684_100360449 Ga0070684_1003604491 235
230 3300005539 Ga0068853_100030039 Ga0068853_1000300395 235
231 3300005544 Ga0070686_100056093 Ga0070686_1000560931 235
232 3300005548 Ga0070665_100060341 Ga0070665_1000603412 235
233 3300005564 Ga0070664_100006530 Ga0070664_1000065305 235
234 3300005564 Ga0070664_100146218 Ga0070664_1001462182 235
235 3300005564 Ga0070664_100458724 Ga0070664_1004587242 235
236 3300005564 Ga0070664_100665056 Ga0070664_1006650561 235
237 3300005577 Ga0068857_100011785 Ga0068857_1000117853 235
238 3300005577 Ga0068857_100180416 Ga0068857_1001804162 235
239 3300005614 Ga0068856_100248637 Ga0068856_1002486372 235
240 3300005616 Ga0068852_100031520 Ga0068852_1000315202 235
241 3300005616 Ga0068852_100376189 Ga0068852_1003761892 235
242 3300005616 Ga0068852_100814521 Ga0068852_1008145211 235
243 3300005617 Ga0068859_100017677 Ga0068859_1000176779 235
244 3300005617 Ga0068859_100072364 Ga0068859_1000723646 235
245 3300005618 Ga0068864_100124691 Ga0068864_1001246912 235
246 3300005719 Ga0068861_100137959 Ga0068861_1001379592 235
247 3300005834 Ga0068851_10354625 Ga0068851_103546251 235
248 3300005841 Ga0068863_100498205 Ga0068863_1004982052 235
249 3300005842 Ga0068858_100150503 Ga0068858_1001505032 235
250 3300005985 Ga0081539_10082117 Ga0081539_100821173 235
251 3300006358 Ga0068871_100561179 Ga0068871_1005611792 235
252 3300006871 Ga0075434_100009056 Ga0075434_1000090564 235
253 3300006871 Ga0075434_100609300 Ga0075434_1006093002 235
254 3300006881 Ga0068865_100151747 Ga0068865_1001517472 235
255 3300006931 Ga0097620_100017677 Ga0097620_1000176779 235
256 3300006931 Ga0097620_100072356 Ga0097620_1000723561 235
257 3300009094 Ga0111539_10073279 Ga0111539_100732792 235
258 3300009174 Ga0105241_10292606 Ga0105241_102926062 235
259 3300009177 Ga0105248_10038321 Ga0105248_100383216 235
260 3300009553 Ga0105249_10089921 Ga0105249_100899212 235
261 3300010375 Ga0105239_11105282 Ga0105239_111052822 235
262 3300011119 Ga0105246_10804515 Ga0105246_108045151 235
263 3300013100 Ga0157373_10033068 Ga0157373_100330683 235
264 3300013102 Ga0157371_10467584 Ga0157371_104675841 235
265 3300013296 Ga0157374_10020690 Ga0157374_100206902 235
266 3300013296 Ga0157374_10117236 Ga0157374_101172362 235
267 3300013297 Ga0157378_10177241 Ga0157378_101772412 235
268 3300013297 Ga0157378_11022917 Ga0157378_110229172 235
269 3300013306 Ga0163162_10022439 Ga0163162_100224394 235
270 3300013306 Ga0163162_10069905 Ga0163162_100699052 235
271 3300013307 Ga0157372_10137971 Ga0157372_101379713 235
272 3300013308 Ga0157375_10010009 Ga0157375_100100095 235
273 3300013308 Ga0157375_10027553 Ga0157375_100275537 235
274 3300013308 Ga0157375_10068834 Ga0157375_100688342 235
275 3300014325 Ga0163163_10242762 Ga0163163_102427622 235
276 3300014325 Ga0163163_10405066 Ga0163163_104050662 235
277 3300014325 Ga0163163_10983103 Ga0163163_109831031 235
278 3300014745 Ga0157377_10017063 Ga0157377_100170632 235
279 3300014968 Ga0157379_10121227 Ga0157379_101212272 235
280 3300014969 Ga0157376_10007029 Ga0157376_100070297 235
281 3300017792 Ga0163161_10005088 Ga0163161_100050888 235
282 3300017792 Ga0163161_10087250 Ga0163161_100872502 235
283 3300017792 Ga0163161_10143677 Ga0163161_101436772 235
284 3300017792 Ga0163161_10221534 Ga0163161_102215342 235
285 3300025901 Ga0207688_10065192 Ga0207688_100651922 235
286 3300025903 Ga0207680_10244092 Ga0207680_102440922 235
287 3300025903 Ga0207680_10447927 Ga0207680_104479271 235
288 3300025904 Ga0207647_10046102 Ga0207647_100461022 235
289 3300025919 Ga0207657_10084500 Ga0207657_100845001 235
290 3300025920 Ga0207649_10026846 Ga0207649_100268462 235
291 3300025920 Ga0207649_10145701 Ga0207649_101457012 235
292 3300025923 Ga0207681_10011577 Ga0207681_100115772 235
293 3300025931 Ga0207644_10071091 Ga0207644_100710912 235
294 3300025932 Ga0207690_10066491 Ga0207690_100664912 235
295 3300025933 Ga0207706_10003994 Ga0207706_100039947 235
296 3300025933 Ga0207706_10069185 Ga0207706_100691853 235
297 3300025933 Ga0207706_10305430 Ga0207706_103054302 235
298 3300025936 Ga0207670_10318549 Ga0207670_103185492 235
299 3300025936 Ga0207670_10386755 Ga0207670_103867551 235
300 3300025938 Ga0207704_10187636 Ga0207704_101876362 235
301 3300025941 Ga0207711_10412389 Ga0207711_104123892 235
302 3300025942 Ga0207689_10017516 Ga0207689_100175163 235
303 3300025942 Ga0207689_10090581 Ga0207689_100905812 235
304 3300025944 Ga0207661_10003108 Ga0207661_100031085 235
305 3300025944 Ga0207661_10091117 Ga0207661_100911172 235
306 3300025945 Ga0207679_10004210 Ga0207679_100042103 235
307 3300025945 Ga0207679_10693363 Ga0207679_106933631 235
308 3300025949 Ga0207667_10521196 Ga0207667_105211961 235
309 3300025960 Ga0207651_10136073 Ga0207651_101360732 235
310 3300025981 Ga0207640_10212461 Ga0207640_102124612 235
311 3300025986 Ga0207658_10011371 Ga0207658_100113718 235
312 3300026023 Ga0207677_10116904 Ga0207677_101169041 235
313 3300026035 Ga0207703_10077261 Ga0207703_100772612 235
314 3300026035 Ga0207703_10176348 Ga0207703_101763482 235
315 3300026041 Ga0207639_10021770 Ga0207639_100217705 235
316 3300026041 Ga0207639_10257112 Ga0207639_102571122 235
317 3300026067 Ga0207678_10031808 Ga0207678_100318083 235
318 3300026075 Ga0207708_10190881 Ga0207708_101908812 235
319 3300026088 Ga0207641_10189811 Ga0207641_101898112 235
320 3300026089 Ga0207648_10020364 Ga0207648_100203643 235
321 3300026095 Ga0207676_10162569 Ga0207676_101625692 235
322 3300026116 Ga0207674_10004031 Ga0207674_1000403113 235
323 3300026118 Ga0207675_100034881 Ga0207675_1000348813 235
324 3300026118 Ga0207675_100095057 Ga0207675_1000950572 235
325 3300026121 Ga0207683_10017143 Ga0207683_100171431 235
326 3300026142 Ga0207698_10302537 Ga0207698_103025372 235
327 3300028379 Ga0268266_10258885 Ga0268266_102588852 235
328 3300031731 Ga0307405_10005405 Ga0307405_100054056 235
329 3300031824 Ga0307413_10008468 Ga0307413_100084683 235
330 3300031852 Ga0307410_10159760 Ga0307410_101597602 235
331 3300031901 Ga0307406_10428828 Ga0307406_104288282 235
332 3300032002 Ga0307416_100032160 Ga0307416_1000321602 235
333 3300032005 Ga0307411_10061340 Ga0307411_100613403 235
334 3300032126 Ga0307415_100306277 Ga0307415_1003062772 235
335 3300035410 Ga0373924_0022664 Ga0373924_0022664_258_974 235
336 3300035725 Ga0373947_0055487 Ga0373947_0055487_1489_2205 235
337 3300036401 Ga0373937_0006671 Ga0373937_0006671_3028_3744 235
338 3300046454 Ga0495592_0049965 Ga0495592_0049965_979_1695 235
339 3300046463 Ga0495653_0060576 Ga0495653_0060576_1603_2319 235
340 3300046514 Ga0495618_0075906 Ga0495618_0075906_917_1633 235
341 3300046516 Ga0495628_0022064 Ga0495628_0022064_2001_2717 235
342 3300046517 Ga0495630_0011846 Ga0495630_0011846_576_1292 235
343 3300046535 Ga0495586_0009224 Ga0495586_0009224_3647_4363 235
344 3300046536 Ga0495587_0025753 Ga0495587_0025753_1637_2353 235
345 3300046543 Ga0495645_0266115 Ga0495645_0266115_383_1099 235
346 3300046559 Ga0495667_0034520 Ga0495667_0034520_1052_1768 235
347 3300046642 Ga0495634_0030013 Ga0495634_0030013_599_1315 235
348 3300046663 Ga0495635_0210652 Ga0495635_0210652_565_1281 235
349 3300046675 Ga0495657_0059670 Ga0495657_0059670_14_730 235
350 3300046689 Ga0495613_0278212 Ga0495613_0278212_377_1093 235
351 3300047322 Ga0495680_0037499 Ga0495680_0037499_915_1631 235
352 3300048913 Ga0496110_0019814 Ga0496110_0019814_4457_5173 235
353 3300049649 Ga0501198_003248 Ga0501198_003248_75_803 235
354 3300049649 Ga0501198_044732 Ga0501198_044732_41_763 235
355 3300049652 Ga0501202_000471 Ga0501202_000471_4325_5053 235
356 3300049656 Ga0501209_013399 Ga0501209_013399_68_796 235
357 3300049658 Ga0501211_007377 Ga0501211_007377_319_1047 235
358 3300049660 Ga0501216_010200 Ga0501216_010200_390_1118 235
359 3300049661 Ga0501217_001989 Ga0501217_001989_2967_3695 235
360 3300049661 Ga0501217_052829 Ga0501217_052829_200_922 235
361 3300049663 Ga0501223_010007 Ga0501223_010007_424_1152 235
362 3300049669 Ga0501235_012282 Ga0501235_012282_954_1682 235
363 3300049675 Ga0501243_002907 Ga0501243_002907_417_1139 235
364 3300049679 Ga0501249_012667 Ga0501249_012667_944_1666 235
365 3300049681 Ga0501251_001781 Ga0501251_001781_229_951 235
366 3300049686 Ga0501257_007725 Ga0501257_007725_1316_2038 235
367 3300049688 Ga0501259_005809 Ga0501259_005809_673_1395 235
368 3300049704 Ga0501221_039799 Ga0501221_039799_148_870 235
369 3300049705 Ga0501225_0006624 Ga0501225_0006624_1847_2575 235
370 3300049776 Ga0501280_016826 Ga0501280_016826_299_1027 235
371 3300050511 nmdc:mga08y16_80441_c1 nmdc:mga08y16_80441_c1_889_1599 235
372 3300050512 nmdc:mga0n895_10170_c1 nmdc:mga0n895_10170_c1_6997_7713 235
373 3300005334 Ga0068869_100024707 Ga0068869_1000247074 236
374 3300005344 Ga0070661_100423302 Ga0070661_1004233021 236
375 3300005355 Ga0070671_100357097 Ga0070671_1003570972 236
376 3300005365 Ga0070688_100069983 Ga0070688_1000699831 236
377 3300005577 Ga0068857_100277037 Ga0068857_1002770372 236
378 3300005616 Ga0068852_100145058 Ga0068852_1001450582 236
379 3300005841 Ga0068863_100798416 Ga0068863_1007984162 236
380 3300005842 Ga0068858_100689699 Ga0068858_1006896991 236
381 3300013297 Ga0157378_10023750 Ga0157378_100237506 236
382 3300014745 Ga0157377_10007473 Ga0157377_100074736 236
383 3300025918 Ga0207662_10021541 Ga0207662_100215412 236
384 3300025926 Ga0207659_10104544 Ga0207659_101045442 236
385 3300025931 Ga0207644_10277021 Ga0207644_102770212 236
386 3300025933 Ga0207706_10166603 Ga0207706_101666032 236
387 3300025942 Ga0207689_10041033 Ga0207689_100410332 236
388 3300026023 Ga0207677_10165642 Ga0207677_101656422 236
389 3300046642 Ga0495634_0341616 Ga0495634_0341616_91_801 236
390 3300046663 Ga0495635_0098551 Ga0495635_0098551_1253_1963 236
391 3300014969 Ga0157376_10788046 Ga0157376_107880462 237
392 3300049588 Ga0501072_0101159 Ga0501072_0101159_13_735 237
393 3300003323 rootH1_10325136 rootH1_103251364 238

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

102

193

0.88

PF13649

Methyltransf_25

Methyltransferase domain

101

197

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vz8-assembly1.cif.gz_A crystal structure of mammalian fatty acid synthase 0.7947 62 238
3dh0-assembly1.cif.gz_A crystal structure of a sam dependent methyltransferase from aquifex aeolicus 0.7684 17 233
2pjd-assembly1.cif.gz_A crystal structure of 16s rrna methyltransferase rsmc 0.768 63 235
3dh0-assembly1.cif.gz_A crystal structure of a sam dependent methyltransferase from aquifex aeolicus 0.755 17 233
5m58-assembly1.cif.gz_B crystal structure of couo, a c-methyltransferase from streptomyces rishiriensis 0.7494 47 234
ID Description Score Start End Superfamily
af_I1K0P7_74_216_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8265 61 137 3.40.50.150
3dtnB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7996 28 233 3.40.50.150
af_A0A2R8Q1A0_7_169_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.787 47 150 3.40.50.150
3dtnB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7756 28 233 3.40.50.150
1af7A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7729 62 173 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A3D1XMV8-F1-model_v4 Methyltransferase type 11 0.9763 131 236 GO:0008168
GO:0032259
AF-A0A286IJL0-F1-model_v4 Methyltransferase domain-containing protein 0.9692 1 235 GO:0008168
GO:0032259
AF-A0A3C1TG83-F1-model_v4 SAM-dependent methyltransferase 0.9692 130 238 GO:0008168
GO:0032259
AF-A0A2M7G745-F1-model_v4 SAM-dependent methyltransferase 0.9674 1 235 GO:0010420
GO:0032259
AF-A0A3D1XMV8-F1-model_v4 Methyltransferase type 11 0.9673 131 236 GO:0008168
GO:0032259

Feature Viewer

pLDDT pTM Quality
93.09 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map