F432373

General Info

Members Datasets Scaffolds Average Seq Length
392 231 784 296

Family's Representative Sequence

Representative Sequence 3300041997|Ga0439431_0032856|Ga0439431_0032856_102_1091
Length 329
Sequence LVVACAPLALFRSTSTADGGVRKKFVTGAIVLSAGLYMAAAPFAQQATPQRTLPPSTDGKLNIIAFGAHPDDCDQRAGGTAAKYAALGHRVRFVAVTNGDAGHQTEGGGALAARRRAEAQEAGRRIGVEYVVLDNHDGELVPSVDVRNQIIRQIRQWNADLVLAPRPNDYHPDHRYTGVLVQDAAYMVVVPNIAPDTPALRKNPVFMYFQDGFQRPNPFTPDVAISIDDVIEKKVDMLDAHVSQFYEWLPWVAGNLDTVPKGAAERKQWLRERRAGQPTAAVRAALIKWYGAAKGKEVRHAEAFEICEYGTRPDEALLRKLFPFLPKPE

Samples

Sample ID Description Type Environment
1 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
83 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
138 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
139 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
141 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
142 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
144 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
145 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
146 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
147 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
148 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
149 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
150 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
151 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
152 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
153 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
154 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
155 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
156 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
157 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
158 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
159 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
160 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
161 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
162 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
163 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
164 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
165 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
166 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
167 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
168 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
169 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
170 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
171 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
172 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
173 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
183 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
184 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
185 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
197 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
198 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
199 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
200 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
201 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
202 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
203 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
204 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
205 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
206 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
207 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
208 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
209 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
212 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
213 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
214 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
215 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
216 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
217 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
218 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
219 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
220 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
221 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
222 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
223 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
224 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
225 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
226 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
227 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
228 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
229 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
230 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
231 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.28
Nodule 0
Rhizoplane 5.61
Rhizosphere 92.6
Stem 0
Stem Tuber 0
Unclassified 12.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439431_0032856 3300041997 Bacteria 1295
2 MBSR1b_contig_2781697 2162886012 Unclassified 1532
3 Ga0065712_10000406 3300005290 Bacteria 16488
4 Ga0065715_10000400 3300005293 Bacteria 19183
5 Ga0065707_10016569 3300005295 Unclassified 2421
6 Ga0070676_10037243 3300005328 Bacteria 2805
7 Ga0070676_10051236 3300005328 Unclassified 2423
8 Ga0070683_100082066 3300005329 Bacteria 3019
9 Ga0070670_100006754 3300005331 Bacteria 9724
10 Ga0070680_100165054 3300005336 Bacteria 1862
11 Ga0070660_100021745 3300005339 Bacteria 4734
12 Ga0070660_100486398 3300005339 Bacteria 1026
13 Ga0070689_100024805 3300005340 Bacteria 4501
14 Ga0070668_100188840 3300005347 Bacteria 1687
15 Ga0070668_100307427 3300005347 Bacteria 1331
16 Ga0070671_100033753 3300005355 Bacteria 4235
17 Ga0070671_100122677 3300005355 Bacteria 2187
18 Ga0070673_100131561 3300005364 Bacteria 2100
19 Ga0070688_100014415 3300005365 Bacteria 4479
20 Ga0070659_100019211 3300005366 Bacteria 5173
21 Ga0070659_100399509 3300005366 Bacteria 1160
22 Ga0070714_100283022 3300005435 Bacteria 1541
23 Ga0070713_100204175 3300005436 Bacteria 1786
24 Ga0070711_100276598 3300005439 Bacteria 1327
25 Ga0070705_100095438 3300005440 Bacteria 1865
26 Ga0070708_100080396 3300005445 Bacteria 2950
27 Ga0070708_100113703 3300005445 Bacteria 2490
28 Ga0070708_100152613 3300005445 Bacteria 2149
29 Ga0070708_100678161 3300005445 Unclassified 970
30 Ga0070663_100193805 3300005455 Bacteria 1583
31 Ga0070662_100143288 3300005457 Bacteria 1854
32 Ga0070662_100482164 3300005457 Bacteria 1032
33 Ga0070681_10352358 3300005458 Bacteria 1382
34 Ga0068867_100306581 3300005459 Bacteria 1311
35 Ga0070685_10010271 3300005466 Bacteria 4859
36 Ga0070706_100010657 3300005467 Bacteria 8534
37 Ga0070706_100029590 3300005467 Bacteria 5046
38 Ga0070706_100289711 3300005467 Bacteria 1528
39 Ga0070698_100056246 3300005471 Bacteria 3987
40 Ga0070698_100250547 3300005471 Bacteria 1704
41 Ga0070699_100000569 3300005518 Bacteria 34871
42 Ga0070699_100001477 3300005518 Bacteria 21521
43 Ga0070699_100140032 3300005518 Bacteria 2136
44 Ga0070679_100326695 3300005530 Bacteria 1483
45 Ga0070679_100412435 3300005530 Bacteria 1296
46 Ga0070684_100000063 3300005535 Bacteria 70046
47 Ga0070684_100456700 3300005535 Unclassified 1181
48 Ga0070697_100252325 3300005536 Bacteria 1509
49 Ga0068853_100035984 3300005539 Bacteria 4207
50 Ga0068853_100039699 3300005539 Bacteria 4015
51 Ga0070695_100001445 3300005545 Bacteria 13184
52 Ga0070696_100064154 3300005546 Bacteria 2574
53 Ga0070665_100309707 3300005548 Bacteria 1582
54 Ga0070665_100464308 3300005548 Bacteria 1276
55 Ga0070704_100431201 3300005549 Bacteria 1131
56 Ga0068855_100054611 3300005563 Bacteria 4695
57 Ga0070664_100275826 3300005564 Bacteria 1515
58 Ga0068856_100022412 3300005614 Bacteria 6140
59 Ga0068856_100028045 3300005614 Bacteria 5495
60 Ga0068856_100214785 3300005614 Unclassified 1939
61 Ga0068864_100086260 3300005618 Bacteria 2761
62 Ga0068863_100016798 3300005841 Bacteria 7023
63 Ga0068862_100055168 3300005844 Bacteria 3403
64 Ga0070717_10039743 3300006028 Bacteria 3829
65 Ga0075367_10030635 3300006178 Bacteria 3085
66 Ga0097621_100039765 3300006237 Bacteria 3779
67 Ga0068871_100106956 3300006358 Bacteria 2349
68 Ga0075428_100001578 3300006844 Bacteria 24436
69 Ga0075428_100010828 3300006844 Bacteria 10137
70 Ga0075428_100028703 3300006844 Bacteria 6155
71 Ga0075428_100046768 3300006844 Unclassified 4753
72 Ga0075428_100542970 3300006844 Bacteria 1243
73 Ga0075430_100002903 3300006846 Bacteria 14344
74 Ga0075430_100006840 3300006846 Bacteria 9611
75 Ga0075430_100104629 3300006846 Bacteria 2363
76 Ga0075430_100133068 3300006846 Bacteria 2072
77 Ga0075431_100002919 3300006847 Bacteria 16550
78 Ga0075431_100028530 3300006847 Bacteria 5738
79 Ga0075431_100053228 3300006847 Bacteria 4173
80 Ga0075431_100055881 3300006847 Bacteria 4072
81 Ga0075431_100140636 3300006847 Bacteria 2488
82 Ga0075431_100333656 3300006847 Bacteria 1527
83 Ga0075431_100382684 3300006847 Bacteria 1411
84 Ga0075433_10004523 3300006852 Bacteria 10843
85 Ga0075433_10020725 3300006852 Bacteria 5501
86 Ga0075433_10047098 3300006852 Bacteria 3750
87 Ga0075433_10127183 3300006852 Bacteria 2263
88 Ga0075433_10200326 3300006852 Bacteria 1775
89 Ga0075434_100122987 3300006871 Bacteria 2611
90 Ga0075434_100263779 3300006871 Unclassified 1742
91 Ga0075434_100266427 3300006871 Bacteria 1732
92 Ga0075429_100004794 3300006880 Bacteria 11648
93 Ga0075429_100018767 3300006880 Bacteria 5990
94 Ga0068865_100179933 3300006881 Bacteria 1628
95 Ga0075436_100019011 3300006914 Bacteria 4706
96 Ga0075436_100056467 3300006914 Unclassified 2711
97 Ga0075435_100005334 3300007076 Bacteria 8958
98 Ga0075435_100007143 3300007076 Bacteria 7937
99 Ga0105240_10001381 3300009093 Bacteria 41732
100 Ga0105240_10111090 3300009093 Bacteria 3316
101 Ga0111539_10001022 3300009094 Bacteria 36697
102 Ga0105247_10013689 3300009101 Bacteria 4864
103 Ga0114129_10000746 3300009147 Bacteria 41323
104 Ga0114129_10001460 3300009147 Bacteria 31941
105 Ga0114129_10002263 3300009147 Bacteria 26626
106 Ga0114129_10018954 3300009147 Bacteria 9801
107 Ga0114129_10018996 3300009147 Bacteria 9791
108 Ga0114129_10060672 3300009147 Bacteria 5287
109 Ga0114129_10063992 3300009147 Bacteria 5133
110 Ga0114129_10090500 3300009147 Unclassified 4242
111 Ga0114129_10101919 3300009147 Bacteria 3970
112 Ga0114129_10104386 3300009147 Bacteria 3916
113 Ga0105241_10015193 3300009174 Bacteria 5638
114 Ga0105241_10312638 3300009174 Bacteria 1352
115 Ga0105242_10020556 3300009176 Bacteria 5179
116 Ga0105248_10006915 3300009177 Bacteria 12434
117 Ga0105248_10038402 3300009177 Bacteria 5358
118 Ga0105248_10546163 3300009177 Unclassified 1307
119 Ga0105237_10005689 3300009545 Bacteria 14024
120 Ga0105237_10074177 3300009545 Bacteria 3394
121 Ga0105237_10529301 3300009545 Bacteria 1185
122 Ga0105237_10719953 3300009545 Unclassified 1004
123 Ga0105238_10064451 3300009551 Bacteria 3664
124 Ga0105238_10074415 3300009551 Bacteria 3389
125 Ga0105249_10037988 3300009553 Bacteria 4369
126 Ga0105249_10064606 3300009553 Bacteria 3365
127 Ga0105239_10013061 3300010375 Bacteria 9230
128 Ga0105239_10202922 3300010375 Bacteria 2222
129 Ga0105239_10212217 3300010375 Bacteria 2170
130 Ga0105239_10326330 3300010375 Unclassified 1731
131 Ga0105239_10618559 3300010375 Bacteria 1236
132 Ga0105246_10495715 3300011119 Unclassified 1036
133 Ga0157373_10060583 3300013100 Bacteria 2681
134 Ga0157371_10026817 3300013102 Bacteria 4184
135 Ga0157370_10318707 3300013104 Unclassified 1434
136 Ga0157369_10018561 3300013105 Bacteria 7796
137 Ga0157369_10020521 3300013105 Bacteria 7387
138 Ga0157369_10170874 3300013105 Bacteria 2291
139 Ga0157374_10010832 3300013296 Bacteria 7868
140 Ga0157374_10011181 3300013296 Bacteria 7758
141 Ga0157374_10152471 3300013296 Bacteria 2247
142 Ga0157378_10344667 3300013297 Unclassified 1454
143 Ga0163162_10081317 3300013306 Bacteria 3310
144 Ga0163162_10171703 3300013306 Bacteria 2293
145 Ga0157372_10025802 3300013307 Bacteria 6391
146 Ga0157372_10051596 3300013307 Bacteria 4578
147 Ga0157372_10104115 3300013307 Bacteria 3244
148 Ga0157375_10050559 3300013308 Bacteria 4077
149 Ga0157375_10463396 3300013308 Bacteria 1433
150 Ga0163163_10005696 3300014325 Bacteria 10804
151 Ga0163163_10040622 3300014325 Bacteria 4543
152 Ga0157380_10657201 3300014326 Bacteria 1047
153 Ga0182008_10014050 3300014497 Bacteria 4199
154 Ga0182008_10019512 3300014497 Bacteria 3499
155 Ga0182008_10043262 3300014497 Bacteria 2243
156 Ga0157379_10517070 3300014968 Bacteria 1108
157 Ga0182006_1013835 3300015261 Bacteria 3490
158 Ga0182007_10006797 3300015262 Bacteria 4870
159 Ga0163161_10002891 3300017792 Bacteria 12154
160 Ga0213873_10001940 3300021358 Unclassified 3526
161 Ga0207697_10015692 3300025315 Bacteria 3127
162 Ga0207710_10084382 3300025900 Bacteria 1478
163 Ga0207688_10161162 3300025901 Bacteria 1330
164 Ga0207647_10105548 3300025904 Bacteria 1669
165 Ga0207699_10192592 3300025906 Bacteria 1377
166 Ga0207645_10066407 3300025907 Bacteria 2306
167 Ga0207684_10014671 3300025910 Bacteria 6750
168 Ga0207684_10359704 3300025910 Bacteria 1252
169 Ga0207695_10001481 3300025913 Bacteria 39284
170 Ga0207695_10064592 3300025913 Bacteria 3767
171 Ga0207663_10162175 3300025916 Bacteria 1579
172 Ga0207657_10401163 3300025919 Bacteria 1078
173 Ga0207649_10016068 3300025920 Bacteria 4214
174 Ga0207652_10352315 3300025921 Bacteria 1329
175 Ga0207646_10008676 3300025922 Bacteria 10153
176 Ga0207646_10286126 3300025922 Bacteria 1490
177 Ga0207659_10277191 3300025926 Bacteria 1370
178 Ga0207664_10328657 3300025929 Bacteria 1350
179 Ga0207664_10448049 3300025929 Bacteria 1152
180 Ga0207690_10054312 3300025932 Bacteria 2693
181 Ga0207706_10163739 3300025933 Bacteria 1955
182 Ga0207706_10171921 3300025933 Bacteria 1904
183 Ga0207706_10189702 3300025933 Bacteria 1804
184 Ga0207669_10099700 3300025937 Bacteria 1916
185 Ga0207704_10112544 3300025938 Bacteria 1844
186 Ga0207691_10059286 3300025940 Bacteria 3481
187 Ga0207711_10022519 3300025941 Bacteria 5269
188 Ga0207689_10301875 3300025942 Bacteria 1327
189 Ga0207661_10000011 3300025944 Bacteria 361200
190 Ga0207679_10256838 3300025945 Bacteria 1488
191 Ga0207667_10081737 3300025949 Bacteria 3347
192 Ga0207712_10028858 3300025961 Bacteria 3715
193 Ga0207712_10134261 3300025961 Unclassified 1890
194 Ga0207668_10083517 3300025972 Bacteria 2324
195 Ga0207668_10254521 3300025972 Bacteria 1428
196 Ga0207639_10097714 3300026041 Bacteria 2365
197 Ga0207678_10035167 3300026067 Bacteria 4362
198 Ga0207708_10107614 3300026075 Bacteria 2162
199 Ga0207702_10034242 3300026078 Bacteria 4246
200 Ga0207702_10113426 3300026078 Bacteria 2414
201 Ga0207641_10106311 3300026088 Unclassified 2480
202 Ga0207648_10064120 3300026089 Bacteria 3202
203 Ga0207676_10072073 3300026095 Bacteria 2775
204 Ga0207674_10316034 3300026116 Unclassified 1511
205 Ga0207675_100096191 3300026118 Bacteria 2787
206 Ga0207683_10026534 3300026121 Bacteria 4999
207 Ga0209971_1037151 3300027682 Bacteria 1172
208 Ga0207428_10003120 3300027907 Bacteria 16257
209 Ga0268266_10156859 3300028379 Bacteria 2057
210 Ga0268265_10024478 3300028380 Bacteria 4272
211 Ga0307408_100004013 3300031548 Bacteria 10036
212 Ga0307408_100006976 3300031548 Bacteria 7474
213 Ga0307408_100013183 3300031548 Bacteria 5487
214 Ga0307408_100058710 3300031548 Bacteria 2798
215 Ga0307408_100159451 3300031548 Bacteria 1790
216 Ga0307405_10033062 3300031731 Unclassified 3064
217 Ga0307413_10140641 3300031824 Bacteria 1667
218 Ga0307406_10194009 3300031901 Bacteria 1489
219 Ga0307407_10042293 3300031903 Bacteria 2554
220 Ga0307407_10193994 3300031903 Bacteria 1356
221 Ga0307412_10131292 3300031911 Bacteria 1820
222 Ga0307412_10148145 3300031911 Bacteria 1728
223 Ga0307412_10181094 3300031911 Unclassified 1585
224 Ga0307409_100016901 3300031995 Bacteria 4845
225 Ga0307409_100713762 3300031995 Unclassified 1003
226 Ga0307416_100004009 3300032002 Bacteria 8789
227 Ga0307416_100381950 3300032002 Bacteria 1439
228 Ga0307416_100403541 3300032002 Bacteria 1405
229 Ga0307411_10056241 3300032005 Bacteria 2592
230 Ga0307411_10154176 3300032005 Bacteria 1711
231 Ga0307411_10330872 3300032005 Bacteria 1234
232 Ga0307415_100031609 3300032126 Bacteria 3413
233 Ga0307415_100147445 3300032126 Bacteria 1806
234 Ga0373946_0002361 3300035171 Bacteria 6675
235 Ga0373931_0164516 3300035691 Bacteria 1303
236 Ga0373935_0039035 3300035692 Bacteria 2975
237 Ga0373927_0001822 3300035695 Bacteria 15836
238 Ga0373933_0339726 3300035724 Unclassified 975
239 Ga0373925_0008826 3300037068 Bacteria 7343
240 Ga0436364_0246145 3300037853 Bacteria 1006
241 Ga0436363_0395451 3300039450 Bacteria 5432
242 Ga0436362_1222843 3300039453 Bacteria 5866
243 Ga0436362_1281066 3300039453 Bacteria 3844
244 Ga0439453_0008077 3300041408 Unclassified 1683
245 Ga0439450_000611 3300042008 Bacteria 4745
246 Ga0439464_0000249 3300042439 Bacteria 9949
247 Ga0439460_0037888 3300042461 Unclassified 1404
248 Ga0451577_0028929 3300042876 Bacteria 5011
249 Ga0453683_0014493 3300044673 Bacteria 5114
250 Ga0466966_0223056 3300044684 Bacteria 1137
251 Ga0453684_0054950 3300044712 Bacteria 5181
252 Ga0466970_0184299 3300044765 Bacteria 1159
253 Ga0466960_0254028 3300044901 Bacteria 977
254 Ga0466959_0162755 3300045049 Bacteria 1568
255 Ga0466967_0654442 3300045976 Bacteria 1039
256 Ga0495638_0017870 3300046460 Bacteria 4720
257 Ga0495580_0009853 3300046472 Bacteria 7491
258 Ga0495630_0007692 3300046517 Bacteria 7705
259 Ga0495666_0072342 3300046526 Bacteria 1637
260 Ga0495652_0175411 3300046529 Bacteria 1650
261 Ga0495622_0088656 3300046557 Unclassified 1422
262 Ga0495667_0041409 3300046559 Bacteria 3055
263 Ga0495623_0102793 3300046679 Bacteria 1739
264 Ga0495674_0106959 3300047319 Unclassified 2375
265 Ga0495674_0126471 3300047319 Bacteria 2156
266 Ga0495674_0176923 3300047319 Bacteria 1778
267 Ga0495680_0163357 3300047322 Bacteria 1616
268 Ga0495675_0031097 3300047444 Bacteria 3408
269 Ga0495684_0001197 3300047471 Bacteria 20871
270 Ga0495684_0378027 3300047471 Unclassified 1000
271 Ga0495602_0007921 3300048088 Bacteria 11104
272 Ga0495614_0083649 3300048089 Bacteria 1384
273 Ga0496101_0159605 3300048904 Bacteria 1729
274 Ga0496103_0066534 3300048906 Unclassified 2249
275 Ga0496103_0175441 3300048906 Bacteria 1377
276 Ga0496104_0054918 3300048907 Bacteria 3765
277 Ga0496105_0134656 3300048908 Bacteria 2036
278 Ga0496105_0492142 3300048908 Unclassified 964
279 Ga0496106_0112104 3300048909 Bacteria 2125
280 Ga0496106_0152504 3300048909 Bacteria 1823
281 Ga0496108_0063859 3300048911 Bacteria 3101
282 Ga0496108_0091205 3300048911 Bacteria 2590
283 Ga0496109_0006423 3300048912 Bacteria 9902
284 Ga0496109_0092899 3300048912 Bacteria 2791
285 Ga0496110_0033128 3300048913 Bacteria 4467
286 Ga0496110_0035753 3300048913 Bacteria 4312
287 Ga0496110_0450184 3300048913 Bacteria 1173
288 Ga0496111_0033030 3300048914 Bacteria 3691
289 Ga0496112_0007910 3300048915 Bacteria 9470
290 Ga0496112_0127434 3300048915 Bacteria 2516
291 Ga0496112_0341915 3300048915 Bacteria 1440
292 Ga0496113_0031015 3300048916 Bacteria 3875
293 Ga0496113_0210870 3300048916 Bacteria 1546
294 Ga0496115_0176211 3300048918 Unclassified 1768
295 Ga0501299_008782 3300049522 Bacteria 1651
296 Ga0501031_0166864 3300049568 Bacteria 1439
297 Ga0501034_0030206 3300049571 Bacteria 5508
298 Ga0501036_0218326 3300049572 Bacteria 1601
299 Ga0501037_0105022 3300049573 Unclassified 2036
300 Ga0501039_0356784 3300049575 Unclassified 1149
301 Ga0501040_0148886 3300049576 Unclassified 1651
302 Ga0501041_0348404 3300049577 Unclassified 936
303 Ga0501043_0051929 3300049579 Unclassified 3221
304 Ga0501046_0182746 3300049580 Bacteria 1567
305 Ga0501047_0078818 3300049581 Unclassified 3168
306 Ga0501047_0435571 3300049581 Unclassified 1141
307 Ga0501048_0091122 3300049582 Bacteria 2151
308 Ga0501048_0321131 3300049582 Bacteria 1103
309 Ga0501067_0062282 3300049583 Bacteria 2065
310 Ga0501070_0014803 3300049586 Bacteria 6564
311 Ga0501070_0053838 3300049586 Unclassified 3337
312 Ga0501071_0017168 3300049587 Bacteria 4988
313 Ga0501072_0027823 3300049588 Bacteria 4411
314 Ga0501072_0103295 3300049588 Bacteria 2265
315 Ga0501072_0171552 3300049588 Unclassified 1731
316 Ga0501073_0338920 3300049589 Bacteria 1038
317 Ga0501075_0060455 3300049591 Bacteria 2855
318 Ga0501076_0024807 3300049592 Bacteria 4637
319 Ga0501076_0027809 3300049592 Bacteria 4386
320 Ga0501076_0141498 3300049592 Bacteria 1955
321 Ga0501076_0199664 3300049592 Bacteria 1633
322 Ga0501077_0055246 3300049593 Bacteria 2521
323 Ga0501202_020581 3300049652 Bacteria 1312
324 Ga0501249_016468 3300049679 Unclassified 1588
325 Ga0501079_0053000 3300049741 Bacteria 3130
326 Ga0501079_0214714 3300049741 Bacteria 1503
327 Ga0501080_0022012 3300049742 Bacteria 5905
328 Ga0501080_0322182 3300049742 Unclassified 1399
329 Ga0501081_0126111 3300049743 Bacteria 1826
330 Ga0501081_0185042 3300049743 Bacteria 1507
331 Ga0501035_0293501 3300049822 Bacteria 1372
332 Ga0501044_0000812 3300049823 Bacteria 37553
333 Ga0501044_0003382 3300049823 Bacteria 17981
334 Ga0501044_0088095 3300049823 Unclassified 3134
335 Ga0501044_0204402 3300049823 Bacteria 1932
336 Ga0501045_0066173 3300049824 Bacteria 2654
337 Ga0501045_0268143 3300049824 Bacteria 1271
338 nmdc:mga05p37_14482_c1 3300050507 Bacteria 9470
339 nmdc:mga05p37_17461_c1 3300050507 Bacteria 8661
340 nmdc:mga05p37_222288_c1 3300050507 Bacteria 2278
341 nmdc:mga05p37_2265_c1 3300050507 Bacteria 22432
342 nmdc:mga05p37_291407_c1 3300050507 Bacteria 1943
343 nmdc:mga05p37_64742_c1 3300050507 Bacteria 4498
344 nmdc:mga09592_2717_c1 3300050508 Bacteria 14300
345 nmdc:mga09592_2794_c1 3300050508 Bacteria 14141
346 nmdc:mga0qj67_117845_c1 3300050509 Bacteria 2146
347 nmdc:mga0qj67_124307_c1 3300050509 Bacteria 2088
348 nmdc:mga0qj67_39408_c1 3300050509 Unclassified 3710
349 nmdc:mga0qj67_73738_c1 3300050509 Unclassified 2726
350 nmdc:mga0qj67_78431_c1 3300050509 Bacteria 2644
351 nmdc:mga06r32_138203_c1 3300050510 Bacteria 2411
352 nmdc:mga06r32_223903_c1 3300050510 Unclassified 1869
353 nmdc:mga06r32_289862_c1 3300050510 Bacteria 1624
354 nmdc:mga06r32_749818_c1 3300050510 Bacteria 939
355 nmdc:mga08y16_457030_c1 3300050511 Bacteria 1302
356 nmdc:mga08y16_874_c1 3300050511 Bacteria 29065
357 nmdc:mga08y16_88111_c1 3300050511 Bacteria 3234
358 nmdc:mga0n895_18927_c1 3300050512 Bacteria 6387
359 nmdc:mga0n895_324030_c1 3300050512 Unclassified 1561
360 nmdc:mga0n895_39731_c1 3300050512 Bacteria 4567
361 nmdc:mga0n895_50663_c1 3300050512 Bacteria 4071
362 nmdc:mga0n895_730866_c1 3300050512 Bacteria 984
363 nmdc:mga0n895_748239_c1 3300050512 Bacteria 971
364 nmdc:mga0n895_794125_c1 3300050512 Bacteria 937
365 nmdc:mga0n895_92869_c1 3300050512 Bacteria 3021
366 nmdc:mga0rr50_242985_c1 3300050513 Bacteria 1493
367 nmdc:mga0rr50_33734_c1 3300050513 Bacteria 3659
368 nmdc:mga0rr50_40797_c1 3300050513 Bacteria 3377
369 nmdc:mga08x19_26972_c1 3300050514 Bacteria 3590
370 nmdc:mga0a205_13994_c1 3300050515 Bacteria 2746
371 nmdc:mga0a205_198088_c1 3300050515 Bacteria 1900
372 nmdc:mga0a205_27489_c1 3300050515 Bacteria 5432
373 nmdc:mga0a205_31516_c1 3300050515 Bacteria 5079
374 nmdc:mga0a205_38631_c1 3300050515 Bacteria 4593
375 nmdc:mga0a205_46332_c1 3300050515 Bacteria 4193
376 nmdc:mga0a205_64020_c1 3300050515 Unclassified 3552
377 nmdc:mga0a205_78341_c1 3300050515 Bacteria 3193
378 Ga0500555_000415 3300053103 Bacteria 17833
379 Ga0500568_0009589 3300053139 Bacteria 4586
380 Ga0500616_0000616 3300053153 Bacteria 43214
381 Ga0500645_000244 3300053730 Bacteria 40643
382 Ga0501084_0008493 3300054114 Bacteria 8491
383 Ga0590071_000075 3300059421 Bacteria 27013
384 Ga0590071_000330 3300059421 Bacteria 13903
385 Ga0590074_002680 3300059423 Bacteria 2928
386 Ga0590075_000725 3300059424 Bacteria 8757
387 Ga0590075_002544 3300059424 Bacteria 4360
388 Ga0590077_000500 3300059426 Bacteria 10916
389 Ga0590077_003372 3300059426 Unclassified 3312
390 Ga0501082_0244381 3300060353 Bacteria 1562
391 Ga0501082_0437129 3300060353 Bacteria 1143
392 Ga0530510_0059971 3300061734 Bacteria 2753
393 Ga0439431_0032856
394 MBSR1b_contig_2781697
395 Ga0065712_10000406
396 Ga0065715_10000400
397 Ga0065707_10016569
398 Ga0070676_10037243
399 Ga0070676_10051236
400 Ga0070683_100082066
401 Ga0070670_100006754
402 Ga0070680_100165054
403 Ga0070660_100021745
404 Ga0070660_100486398
405 Ga0070689_100024805
406 Ga0070668_100188840
407 Ga0070668_100307427
408 Ga0070671_100033753
409 Ga0070671_100122677
410 Ga0070673_100131561
411 Ga0070688_100014415
412 Ga0070659_100019211
413 Ga0070659_100399509
414 Ga0070714_100283022
415 Ga0070713_100204175
416 Ga0070711_100276598
417 Ga0070705_100095438
418 Ga0070708_100080396
419 Ga0070708_100113703
420 Ga0070708_100152613
421 Ga0070708_100678161
422 Ga0070663_100193805
423 Ga0070662_100143288
424 Ga0070662_100482164
425 Ga0070681_10352358
426 Ga0068867_100306581
427 Ga0070685_10010271
428 Ga0070706_100010657
429 Ga0070706_100029590
430 Ga0070706_100289711
431 Ga0070698_100056246
432 Ga0070698_100250547
433 Ga0070699_100000569
434 Ga0070699_100001477
435 Ga0070699_100140032
436 Ga0070679_100326695
437 Ga0070679_100412435
438 Ga0070684_100000063
439 Ga0070684_100456700
440 Ga0070697_100252325
441 Ga0068853_100035984
442 Ga0068853_100039699
443 Ga0070695_100001445
444 Ga0070696_100064154
445 Ga0070665_100309707
446 Ga0070665_100464308
447 Ga0070704_100431201
448 Ga0068855_100054611
449 Ga0070664_100275826
450 Ga0068856_100022412
451 Ga0068856_100028045
452 Ga0068856_100214785
453 Ga0068864_100086260
454 Ga0068863_100016798
455 Ga0068862_100055168
456 Ga0070717_10039743
457 Ga0075367_10030635
458 Ga0097621_100039765
459 Ga0068871_100106956
460 Ga0075428_100001578
461 Ga0075428_100010828
462 Ga0075428_100028703
463 Ga0075428_100046768
464 Ga0075428_100542970
465 Ga0075430_100002903
466 Ga0075430_100006840
467 Ga0075430_100104629
468 Ga0075430_100133068
469 Ga0075431_100002919
470 Ga0075431_100028530
471 Ga0075431_100053228
472 Ga0075431_100055881
473 Ga0075431_100140636
474 Ga0075431_100333656
475 Ga0075431_100382684
476 Ga0075433_10004523
477 Ga0075433_10020725
478 Ga0075433_10047098
479 Ga0075433_10127183
480 Ga0075433_10200326
481 Ga0075434_100122987
482 Ga0075434_100263779
483 Ga0075434_100266427
484 Ga0075429_100004794
485 Ga0075429_100018767
486 Ga0068865_100179933
487 Ga0075436_100019011
488 Ga0075436_100056467
489 Ga0075435_100005334
490 Ga0075435_100007143
491 Ga0105240_10001381
492 Ga0105240_10111090
493 Ga0111539_10001022
494 Ga0105247_10013689
495 Ga0114129_10000746
496 Ga0114129_10001460
497 Ga0114129_10002263
498 Ga0114129_10018954
499 Ga0114129_10018996
500 Ga0114129_10060672
501 Ga0114129_10063992
502 Ga0114129_10090500
503 Ga0114129_10101919
504 Ga0114129_10104386
505 Ga0105241_10015193
506 Ga0105241_10312638
507 Ga0105242_10020556
508 Ga0105248_10006915
509 Ga0105248_10038402
510 Ga0105248_10546163
511 Ga0105237_10005689
512 Ga0105237_10074177
513 Ga0105237_10529301
514 Ga0105237_10719953
515 Ga0105238_10064451
516 Ga0105238_10074415
517 Ga0105249_10037988
518 Ga0105249_10064606
519 Ga0105239_10013061
520 Ga0105239_10202922
521 Ga0105239_10212217
522 Ga0105239_10326330
523 Ga0105239_10618559
524 Ga0105246_10495715
525 Ga0157373_10060583
526 Ga0157371_10026817
527 Ga0157370_10318707
528 Ga0157369_10018561
529 Ga0157369_10020521
530 Ga0157369_10170874
531 Ga0157374_10010832
532 Ga0157374_10011181
533 Ga0157374_10152471
534 Ga0157378_10344667
535 Ga0163162_10081317
536 Ga0163162_10171703
537 Ga0157372_10025802
538 Ga0157372_10051596
539 Ga0157372_10104115
540 Ga0157375_10050559
541 Ga0157375_10463396
542 Ga0163163_10005696
543 Ga0163163_10040622
544 Ga0157380_10657201
545 Ga0182008_10014050
546 Ga0182008_10019512
547 Ga0182008_10043262
548 Ga0157379_10517070
549 Ga0182006_1013835
550 Ga0182007_10006797
551 Ga0163161_10002891
552 Ga0213873_10001940
553 Ga0207697_10015692
554 Ga0207710_10084382
555 Ga0207688_10161162
556 Ga0207647_10105548
557 Ga0207699_10192592
558 Ga0207645_10066407
559 Ga0207684_10014671
560 Ga0207684_10359704
561 Ga0207695_10001481
562 Ga0207695_10064592
563 Ga0207663_10162175
564 Ga0207657_10401163
565 Ga0207649_10016068
566 Ga0207652_10352315
567 Ga0207646_10008676
568 Ga0207646_10286126
569 Ga0207659_10277191
570 Ga0207664_10328657
571 Ga0207664_10448049
572 Ga0207690_10054312
573 Ga0207706_10163739
574 Ga0207706_10171921
575 Ga0207706_10189702
576 Ga0207669_10099700
577 Ga0207704_10112544
578 Ga0207691_10059286
579 Ga0207711_10022519
580 Ga0207689_10301875
581 Ga0207661_10000011
582 Ga0207679_10256838
583 Ga0207667_10081737
584 Ga0207712_10028858
585 Ga0207712_10134261
586 Ga0207668_10083517
587 Ga0207668_10254521
588 Ga0207639_10097714
589 Ga0207678_10035167
590 Ga0207708_10107614
591 Ga0207702_10034242
592 Ga0207702_10113426
593 Ga0207641_10106311
594 Ga0207648_10064120
595 Ga0207676_10072073
596 Ga0207674_10316034
597 Ga0207675_100096191
598 Ga0207683_10026534
599 Ga0209971_1037151
600 Ga0207428_10003120
601 Ga0268266_10156859
602 Ga0268265_10024478
603 Ga0307408_100004013
604 Ga0307408_100006976
605 Ga0307408_100013183
606 Ga0307408_100058710
607 Ga0307408_100159451
608 Ga0307405_10033062
609 Ga0307413_10140641
610 Ga0307406_10194009
611 Ga0307407_10042293
612 Ga0307407_10193994
613 Ga0307412_10131292
614 Ga0307412_10148145
615 Ga0307412_10181094
616 Ga0307409_100016901
617 Ga0307409_100713762
618 Ga0307416_100004009
619 Ga0307416_100381950
620 Ga0307416_100403541
621 Ga0307411_10056241
622 Ga0307411_10154176
623 Ga0307411_10330872
624 Ga0307415_100031609
625 Ga0307415_100147445
626 Ga0373946_0002361
627 Ga0373931_0164516
628 Ga0373935_0039035
629 Ga0373927_0001822
630 Ga0373933_0339726
631 Ga0373925_0008826
632 Ga0436364_0246145
633 Ga0436363_0395451
634 Ga0436362_1222843
635 Ga0436362_1281066
636 Ga0439453_0008077
637 Ga0439450_000611
638 Ga0439464_0000249
639 Ga0439460_0037888
640 Ga0451577_0028929
641 Ga0453683_0014493
642 Ga0466966_0223056
643 Ga0453684_0054950
644 Ga0466970_0184299
645 Ga0466960_0254028
646 Ga0466959_0162755
647 Ga0466967_0654442
648 Ga0495638_0017870
649 Ga0495580_0009853
650 Ga0495630_0007692
651 Ga0495666_0072342
652 Ga0495652_0175411
653 Ga0495622_0088656
654 Ga0495667_0041409
655 Ga0495623_0102793
656 Ga0495674_0106959
657 Ga0495674_0126471
658 Ga0495674_0176923
659 Ga0495680_0163357
660 Ga0495675_0031097
661 Ga0495684_0001197
662 Ga0495684_0378027
663 Ga0495602_0007921
664 Ga0495614_0083649
665 Ga0496101_0159605
666 Ga0496103_0066534
667 Ga0496103_0175441
668 Ga0496104_0054918
669 Ga0496105_0134656
670 Ga0496105_0492142
671 Ga0496106_0112104
672 Ga0496106_0152504
673 Ga0496108_0063859
674 Ga0496108_0091205
675 Ga0496109_0006423
676 Ga0496109_0092899
677 Ga0496110_0033128
678 Ga0496110_0035753
679 Ga0496110_0450184
680 Ga0496111_0033030
681 Ga0496112_0007910
682 Ga0496112_0127434
683 Ga0496112_0341915
684 Ga0496113_0031015
685 Ga0496113_0210870
686 Ga0496115_0176211
687 Ga0501299_008782
688 Ga0501031_0166864
689 Ga0501034_0030206
690 Ga0501036_0218326
691 Ga0501037_0105022
692 Ga0501039_0356784
693 Ga0501040_0148886
694 Ga0501041_0348404
695 Ga0501043_0051929
696 Ga0501046_0182746
697 Ga0501047_0078818
698 Ga0501047_0435571
699 Ga0501048_0091122
700 Ga0501048_0321131
701 Ga0501067_0062282
702 Ga0501070_0014803
703 Ga0501070_0053838
704 Ga0501071_0017168
705 Ga0501072_0027823
706 Ga0501072_0103295
707 Ga0501072_0171552
708 Ga0501073_0338920
709 Ga0501075_0060455
710 Ga0501076_0024807
711 Ga0501076_0027809
712 Ga0501076_0141498
713 Ga0501076_0199664
714 Ga0501077_0055246
715 Ga0501202_020581
716 Ga0501249_016468
717 Ga0501079_0053000
718 Ga0501079_0214714
719 Ga0501080_0022012
720 Ga0501080_0322182
721 Ga0501081_0126111
722 Ga0501081_0185042
723 Ga0501035_0293501
724 Ga0501044_0000812
725 Ga0501044_0003382
726 Ga0501044_0088095
727 Ga0501044_0204402
728 Ga0501045_0066173
729 Ga0501045_0268143
730 nmdc:mga05p37_14482_c1
731 nmdc:mga05p37_17461_c1
732 nmdc:mga05p37_222288_c1
733 nmdc:mga05p37_2265_c1
734 nmdc:mga05p37_291407_c1
735 nmdc:mga05p37_64742_c1
736 nmdc:mga09592_2717_c1
737 nmdc:mga09592_2794_c1
738 nmdc:mga0qj67_117845_c1
739 nmdc:mga0qj67_124307_c1
740 nmdc:mga0qj67_39408_c1
741 nmdc:mga0qj67_73738_c1
742 nmdc:mga0qj67_78431_c1
743 nmdc:mga06r32_138203_c1
744 nmdc:mga06r32_223903_c1
745 nmdc:mga06r32_289862_c1
746 nmdc:mga06r32_749818_c1
747 nmdc:mga08y16_457030_c1
748 nmdc:mga08y16_874_c1
749 nmdc:mga08y16_88111_c1
750 nmdc:mga0n895_18927_c1
751 nmdc:mga0n895_324030_c1
752 nmdc:mga0n895_39731_c1
753 nmdc:mga0n895_50663_c1
754 nmdc:mga0n895_730866_c1
755 nmdc:mga0n895_748239_c1
756 nmdc:mga0n895_794125_c1
757 nmdc:mga0n895_92869_c1
758 nmdc:mga0rr50_242985_c1
759 nmdc:mga0rr50_33734_c1
760 nmdc:mga0rr50_40797_c1
761 nmdc:mga08x19_26972_c1
762 nmdc:mga0a205_13994_c1
763 nmdc:mga0a205_198088_c1
764 nmdc:mga0a205_27489_c1
765 nmdc:mga0a205_31516_c1
766 nmdc:mga0a205_38631_c1
767 nmdc:mga0a205_46332_c1
768 nmdc:mga0a205_64020_c1
769 nmdc:mga0a205_78341_c1
770 Ga0500555_000415
771 Ga0500568_0009589
772 Ga0500616_0000616
773 Ga0500645_000244
774 Ga0501084_0008493
775 Ga0590071_000075
776 Ga0590071_000330
777 Ga0590074_002680
778 Ga0590075_000725
779 Ga0590075_002544
780 Ga0590077_000500
781 Ga0590077_003372
782 Ga0501082_0244381
783 Ga0501082_0437129
784 Ga0530510_0059971

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02585

PIG-L

GlcNAc-PI de-N-acetylase

64

185

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8bgo-assembly1.cif.gz_C n,n-diacetylchitobiose deacetylase from pyrococcus chitonophagus with substrate n,n-diacetylchitobiose 0.8111 13 261
4xm0-assembly1.cif.gz_C n,n'-diacetylchitobiose deacetylase (semet derivative) from pyrococcus furiosus in the absence of cadmium 0.8066 15 261
2ixd-assembly1.cif.gz_A crystal structure of the putative deacetylase bc1534 from bacillus cereus 0.8008 15 270
4ewl-assembly2.cif.gz_A crystal structure of mshb with glycerol and acetate bound in the active site 0.8006 14 198
1q74-assembly1.cif.gz_A the crystal structure of 1d-myo-inositol 2-acetamido-2-deoxy-alpha-d-glucopyranoside deacetylase (mshb) 0.798 14 198
ID Description Score Start End Superfamily
5bmoC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8014 18 261 3.40.50.10320
2ixdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8008 15 270 3.40.50.10320
1q74D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.7901 14 198 3.40.50.10320
af_P71311_1_185_3.40.50.10320 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.7823 5 196 3.40.50.10320
3we7B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.7793 7 261 3.40.50.10320
ID Description Score Start End GO Terms
AF-A0A3N6AUQ9-F1-model_v4 PIG-L family deacetylase 0.9952 14 132 GO:0016811
AF-A0A1Q7HJH9-F1-model_v4 GlcNAc-PI de-N-acetylase 0.9922 18 281 GO:0016811
AF-H5SCT9-F1-model_v4 Hypothetical conserved protein 0.9919 14 201 GO:0016811
AF-A0A0S8E943-F1-model_v4 GlcNAc-PI de-N-acetylase 0.9907 14 193 GO:0016811
AF-A0A7C5EYQ8-F1-model_v4 PIG-L family deacetylase 0.9885 14 199 GO:0016811

Map