F432307

General Info

Members Datasets Scaffolds Average Seq Length
392 241 378 259

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_10000021|Ga0163162_1000002169
Length 284
Sequence VPIASAVSFACGAGGAPAATRAGVGAVNIGALVVDDEPIARRAIVRLLRDDADIDVLAECGDGIAAVAAIRKHMPDLVFLDIQMPGMNGIEVVEAVGSERMPATVFVTAYEQYAVRAFEKNAVDYLVKPFSRERFLGTLKRVKERLAAAGAGDGANAQMLRALSELRQRRGFLERIAVRVDEHIVLVDVADIVWIKANRNTVELHLGDKTHELRETMTSLVEQLNPRDFVRVHRSAIVNVKRIDTIQPWFNGYHVLVMDTGARLRMSRYQHESFLKLVGRSSPA

Samples

Sample ID Description Type Environment
1 2643221559 Lysobacter sp. Root559 Isolate Unclassified
2 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
3 2643221586 Lysobacter sp. Root667 Isolate Unclassified
4 2643221593 Lysobacter sp. Root690 Isolate Unclassified
5 2643221612 Lysobacter sp. Root76 Isolate Unclassified
6 2643221727 Lysobacter sp. Root96 Isolate Unclassified
7 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
8 2734482264 Dyella sp. AD052 Isolate Unclassified
9 2738543009 Luteibacter sp. OK325 Isolate Unclassified
10 2739367700 Dyella sp. YR388 Isolate Unclassified
11 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
12 2928963466 Dyella japonica 1073 Isolate Unclassified
13 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
14 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
15 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
16 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
17 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
18 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
19 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
20 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
21 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
22 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
23 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
24 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
25 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
26 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
27 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
28 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
29 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
30 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
31 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
32 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
33 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
34 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
35 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
36 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
37 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
38 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
39 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
40 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
41 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
42 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
43 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
44 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
45 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
46 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
47 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
48 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
51 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
78 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
79 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
80 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
81 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
82 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
83 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
84 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
91 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
92 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
94 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
95 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
96 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
98 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
99 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
100 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
105 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
107 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
110 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
139 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
140 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
141 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
142 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
145 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
146 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
147 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
148 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
149 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
150 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
151 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
152 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
153 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
154 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
155 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
156 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
157 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
158 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
159 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
160 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
161 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
162 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
163 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
164 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
165 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
166 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
167 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
168 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
169 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
170 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
171 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
172 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
173 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
174 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
175 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
176 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
177 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
178 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
179 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
180 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
181 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
182 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
183 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
184 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
185 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
186 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
187 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
188 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
189 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
190 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
191 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
192 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
193 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
194 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
195 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
196 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
197 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
198 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
199 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
200 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
201 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
202 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
203 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
204 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
205 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
206 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
210 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
211 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
212 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
213 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
214 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
215 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
216 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
217 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
218 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
219 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
220 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
233 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
235 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
236 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
237 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
238 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
239 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
240 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
241 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.43
Metatranscriptomes 0
Isolates 3.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.13
Nodule 0
Rhizoplane 4.85
Rhizosphere 60.46
Stem 0
Stem Tuber 0
Unclassified 15.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000062 3300001979 Bacteria 34499
2 JGI24739J22299_10001107 3300001989 Bacteria 10046
3 JGI24735J21928_10004757 3300002067 Bacteria 4531
4 JGI25156J39149_1004166 3300002705 Bacteria 4480
5 JGI25162J39368_1000168 3300002737 Bacteria 72115
6 JGI25162J39368_1001157 3300002737 Bacteria 15700
7 JGI25162J39368_1002047 3300002737 Bacteria 8824
8 JGI25154J39366_1000002 3300002738 Bacteria 466942
9 JGI25157J39369_1000196 3300002741 Bacteria 51212
10 JGI25157J39369_1001230 3300002741 Bacteria 10621
11 JGI25163J39215_1001769 3300002771 Bacteria 2965
12 JGI25164J39214_1000132 3300002772 Bacteria 72064
13 JGI25151J46595_10000167 3300003187 Bacteria 85410
14 JGI25165J46597_1000242 3300003214 Bacteria 74940
15 JGI25153J46596_10000384 3300003215 Bacteria 30265
16 JGI25153J46596_10022431 3300003215 Bacteria 2327
17 rootH1_10116637 3300003316 Bacteria 3252
18 rootL2_10003424 3300003322 Bacteria 8429
19 rootL2_10181279 3300003322 Bacteria 1543
20 rootH1_10003055 3300003323 Bacteria 18939
21 rootH1_10035735 3300003323 Unclassified 4586
22 rootH1_10198447 3300003323 Unclassified 2670
23 JGI25160J50197_1001560 3300003354 Bacteria 11317
24 Ga0055533_1002722 3300003756 Bacteria 3884
25 Ga0055535_1000207 3300003761 Bacteria 62292
26 Ga0055542_1000207 3300003762 Bacteria 72115
27 Ga0055542_1001016 3300003762 Bacteria 17794
28 Ga0055529_1000225 3300003763 Bacteria 72635
29 Ga0055526_1000012 3300003771 Bacteria 234368
30 Ga0055526_1017333 3300003771 Bacteria 2757
31 Ga0055537_1000021 3300003773 Bacteria 116840
32 Ga0055524_1000037 3300003775 Bacteria 167140
33 Ga0055534_1000006 3300003784 Bacteria 234368
34 Ga0055528_1000006 3300003790 Bacteria 234368
35 Ga0055528_1000122 3300003790 Bacteria 61910
36 Ga0055530_10000192 3300003791 Bacteria 54681
37 Ga0055531_10000104 3300003794 Bacteria 92278
38 Ga0055531_10016932 3300003794 Bacteria 3110
39 Ga0065165_1000258 3300005262 Bacteria 91861
40 Ga0070658_10015779 3300005327 Bacteria 6039
41 Ga0070666_10000034 3300005335 Bacteria 121537
42 Ga0070689_100008702 3300005340 Bacteria 7163
43 Ga0070661_100005683 3300005344 Bacteria 8592
44 Ga0070661_100027207 3300005344 Bacteria 4117
45 Ga0070661_100071534 3300005344 Bacteria 2552
46 Ga0070661_100187138 3300005344 Bacteria 1578
47 Ga0070692_10024044 3300005345 Bacteria 2991
48 Ga0070668_100138954 3300005347 Bacteria 1956
49 Ga0070667_100000235 3300005367 Bacteria 63272
50 Ga0070667_100031747 3300005367 Bacteria 4403
51 Ga0070667_100730693 3300005367 Bacteria 917
52 Ga0070714_100000107 3300005435 Bacteria 69754
53 Ga0070714_100009239 3300005435 Bacteria 7744
54 Ga0070713_100003665 3300005436 Bacteria 10171
55 Ga0070663_100238247 3300005455 Bacteria 1435
56 Ga0070663_100456575 3300005455 Bacteria 1054
57 Ga0070678_100132395 3300005456 Bacteria 1983
58 Ga0070662_100063326 3300005457 Bacteria 2705
59 Ga0068853_100000285 3300005539 Bacteria 35791
60 Ga0068853_100043084 3300005539 Bacteria 3862
61 Ga0068853_100043115 3300005539 Unclassified 3860
62 Ga0070665_100040318 3300005548 Bacteria 4694
63 Ga0068855_100017853 3300005563 Bacteria 8527
64 Ga0068857_100063504 3300005577 Bacteria 3283
65 Ga0068857_100151003 3300005577 Bacteria 2104
66 Ga0068854_100028171 3300005578 Bacteria 3879
67 Ga0068854_100106879 3300005578 Bacteria 2106
68 Ga0068852_100022575 3300005616 Bacteria 5049
69 Ga0068859_100000400 3300005617 Bacteria 43086
70 Ga0068863_100058406 3300005841 Bacteria 3650
71 Ga0068860_100043674 3300005843 Bacteria 4275
72 Ga0068860_100546168 3300005843 Bacteria 1160
73 Ga0068862_100001117 3300005844 Bacteria 25464
74 Ga0068862_100136010 3300005844 Bacteria 2178
75 Ga0097620_100000400 3300006931 Bacteria 43086
76 Ga0105240_10000119 3300009093 Bacteria 163675
77 Ga0105240_10000127 3300009093 Bacteria 156461
78 Ga0105240_10223556 3300009093 Bacteria 2192
79 Ga0105247_10029899 3300009101 Bacteria 3303
80 Ga0105247_10034514 3300009101 Bacteria 3081
81 Ga0105237_10026613 3300009545 Bacteria 5912
82 Ga0105237_10079049 3300009545 Bacteria 3279
83 Ga0105237_10462038 3300009545 Bacteria 1275
84 Ga0105238_10001729 3300009551 Bacteria 22004
85 Ga0105238_10022911 3300009551 Bacteria 6366
86 Ga0105238_10026037 3300009551 Bacteria 5962
87 Ga0105238_10073071 3300009551 Bacteria 3425
88 Ga0105238_10142976 3300009551 Bacteria 2369
89 Ga0105238_10218792 3300009551 Bacteria 1880
90 Ga0105032_100578 3300009979 Bacteria 3624
91 Ga0105239_10000056 3300010375 Bacteria 157615
92 Ga0105239_10000097 3300010375 Bacteria 122808
93 Ga0105239_10011362 3300010375 Bacteria 9935
94 Ga0105239_10015927 3300010375 Bacteria 8320
95 Ga0105239_10087418 3300010375 Bacteria 3436
96 Ga0105239_10307131 3300010375 Bacteria 1787
97 Ga0105239_10470302 3300010375 Bacteria 1427
98 Ga0157373_10055609 3300013100 Bacteria 2811
99 Ga0157370_10260629 3300013104 Bacteria 1602
100 Ga0157374_10103955 3300013296 Bacteria 2726
101 Ga0163162_10000021 3300013306 Bacteria 214873
102 Ga0163162_10000106 3300013306 Bacteria 74934
103 Ga0163162_10097849 3300013306 Bacteria 3023
104 Ga0157372_10030498 3300013307 Bacteria 5900
105 Ga0157372_10327948 3300013307 Bacteria 1782
106 Ga0182008_10045469 3300014497 Bacteria 2183
107 Ga0182006_1000005 3300015261 Bacteria 621201
108 Ga0182007_10004066 3300015262 Bacteria 6734
109 Ga0182007_10011323 3300015262 Bacteria 3476
110 Ga0182005_1036220 3300015265 Bacteria 1341
111 Ga0183369_1006 3300015685 Bacteria 449058
112 Ga0183368_1002 3300015687 Bacteria 1865598
113 Ga0183360_10002 3300015689 Bacteria 953821
114 Ga0183361_10913 3300016635 Bacteria 1430
115 Ga0163161_10002397 3300017792 Bacteria 13434
116 Ga0163161_10201369 3300017792 Bacteria 1534
117 Ga0209760_100496 3300025207 Bacteria 8316
118 Ga0209784_100131 3300025224 Bacteria 75418
119 Ga0209674_100014 3300025226 Bacteria 704989
120 Ga0209674_101773 3300025226 Bacteria 5235
121 Ga0209672_100275 3300025228 Bacteria 37428
122 Ga0209672_106556 3300025228 Bacteria 1879
123 Ga0207427_100117 3300025231 Bacteria 102251
124 Ga0207427_100161 3300025231 Bacteria 75712
125 Ga0207427_100178 3300025231 Bacteria 67956
126 Ga0207427_100968 3300025231 Bacteria 12182
127 Ga0209437_100116 3300025233 Bacteria 209449
128 Ga0209437_100240 3300025233 Bacteria 89740
129 Ga0209437_100257 3300025233 Bacteria 82683
130 Ga0209437_100304 3300025233 Bacteria 67955
131 Ga0209258_100092 3300025242 Bacteria 226544
132 Ga0207425_1002024 3300025245 Bacteria 7552
133 Ga0209646_1000005 3300025246 Bacteria 717627
134 Ga0209646_1001845 3300025246 Bacteria 5229
135 Ga0209646_1004619 3300025246 Bacteria 2488
136 Ga0209026_1000093 3300025250 Bacteria 170393
137 Ga0209026_1000230 3300025250 Bacteria 75852
138 Ga0209026_1000232 3300025250 Bacteria 75219
139 Ga0209026_1002433 3300025250 Bacteria 7003
140 Ga0209148_1000002 3300025254 Bacteria 2399500
141 Ga0209148_1000047 3300025254 Bacteria 434369
142 Ga0209759_1000584 3300025256 Bacteria 35901
143 Ga0209759_1003838 3300025256 Bacteria 5825
144 Ga0209759_1005221 3300025256 Bacteria 4615
145 Ga0209129_1021887 3300025258 Unclassified 1164
146 Ga0209233_1000083 3300025261 Bacteria 336016
147 Ga0209233_1000100 3300025261 Bacteria 293905
148 Ga0209233_1000287 3300025261 Bacteria 67956
149 Ga0209565_1000002 3300025263 Bacteria 1423083
150 Ga0209565_1005810 3300025263 Bacteria 3543
151 Ga0209455_1000056 3300025272 Bacteria 349821
152 Ga0209455_1006013 3300025272 Bacteria 3651
153 Ga0209673_1000002 3300025273 Bacteria 1423083
154 Ga0209673_1000049 3300025273 Bacteria 286207
155 Ga0209675_1000002 3300025291 Bacteria 1423083
156 Ga0209025_1000021 3300025294 Bacteria 593083
157 Ga0209564_1000004 3300025295 Bacteria 1424639
158 Ga0209564_1014349 3300025295 Unclassified 3302
159 Ga0209564_1016356 3300025295 Bacteria 2957
160 Ga0209758_1000904 3300025297 Bacteria 40285
161 Ga0209758_1008520 3300025297 Bacteria 6614
162 Ga0209050_1000129 3300025298 Bacteria 186356
163 Ga0209256_1000004 3300025299 Bacteria 1424643
164 Ga0207426_1000600 3300025302 Bacteria 47121
165 Ga0207426_1000782 3300025302 Bacteria 34779
166 Ga0207426_1005673 3300025302 Bacteria 5637
167 Ga0209257_1000013 3300025304 Bacteria 1047305
168 Ga0209257_1001137 3300025304 Bacteria 34045
169 Ga0209257_1001473 3300025304 Bacteria 27678
170 Ga0207680_10000005 3300025903 Bacteria 660983
171 Ga0207647_10000234 3300025904 Bacteria 45343
172 Ga0207647_10005326 3300025904 Bacteria 9455
173 Ga0207647_10008671 3300025904 Bacteria 7263
174 Ga0207705_10000977 3300025909 Bacteria 23344
175 Ga0207705_10012465 3300025909 Bacteria 6141
176 Ga0207695_10000139 3300025913 Bacteria 216873
177 Ga0207695_10000243 3300025913 Bacteria 141682
178 Ga0207695_10026872 3300025913 Bacteria 6417
179 Ga0207671_10015892 3300025914 Bacteria 5871
180 Ga0207671_10041831 3300025914 Bacteria 3392
181 Ga0207671_10589160 3300025914 Bacteria 886
182 Ga0207657_10275310 3300025919 Bacteria 1337
183 Ga0207649_10010368 3300025920 Bacteria 5117
184 Ga0207649_10074283 3300025920 Bacteria 2181
185 Ga0207681_10094521 3300025923 Bacteria 2142
186 Ga0207694_10001399 3300025924 Bacteria 20718
187 Ga0207694_10021552 3300025924 Bacteria 4884
188 Ga0207694_10027444 3300025924 Bacteria 4337
189 Ga0207694_10105301 3300025924 Bacteria 2239
190 Ga0207694_10122692 3300025924 Bacteria 2076
191 Ga0207700_10001482 3300025928 Bacteria 13282
192 Ga0207664_10000036 3300025929 Bacteria 173396
193 Ga0207690_10254803 3300025932 Bacteria 1357
194 Ga0207706_10028398 3300025933 Bacteria 4996
195 Ga0207706_10306809 3300025933 Bacteria 1382
196 Ga0207670_10011408 3300025936 Bacteria 5158
197 Ga0207667_10012121 3300025949 Bacteria 9962
198 Ga0207667_10020745 3300025949 Bacteria 7300
199 Ga0207668_10019502 3300025972 Bacteria 4289
200 Ga0207640_10024206 3300025981 Bacteria 3661
201 Ga0207640_10078280 3300025981 Bacteria 2250
202 Ga0207658_10012344 3300025986 Bacteria 5832
203 Ga0207658_10232530 3300025986 Bacteria 1557
204 Ga0207639_10053898 3300026041 Bacteria 3071
205 Ga0207639_10068970 3300026041 Bacteria 2757
206 Ga0207678_10054468 3300026067 Bacteria 3445
207 Ga0207678_10321139 3300026067 Bacteria 1332
208 Ga0207702_10007655 3300026078 Bacteria 9184
209 Ga0207641_10273421 3300026088 Bacteria 1586
210 Ga0207674_10126140 3300026116 Bacteria 2525
211 Ga0207683_10232274 3300026121 Bacteria 1682
212 Ga0268266_10000004 3300028379 Bacteria 1495817
213 Ga0268265_10000150 3300028380 Bacteria 86326
214 Ga0268265_10113949 3300028380 Bacteria 2213
215 Ga0268264_10058372 3300028381 Bacteria 3231
216 Ga0307517_10105153 3300028786 Bacteria 2193
217 Ga0314311_1083627 3300030733 Bacteria 5712
218 Ga0316178_1014208 3300030735 Bacteria 2234
219 Ga0265316_10437650 3300031344 Bacteria 939
220 Ga0307513_10002077 3300031456 Bacteria 28129
221 Ga0307513_10108594 3300031456 Bacteria 2774
222 Ga0307408_100213308 3300031548 Unclassified 1570
223 Ga0307508_10014915 3300031616 Bacteria 7088
224 Ga0307411_10113086 3300032005 Bacteria 1947
225 Ga0307510_10000049 3300033180 Bacteria 91546
226 Ga0237816_00324 3300039145 Bacteria 4089
227 Ga0439436_0006551 3300041404 Bacteria 3577
228 Ga0439439_0000563 3300041406 Bacteria 6468
229 Ga0439465_0000192 3300041413 Bacteria 15978
230 Ga0439465_0000650 3300041413 Bacteria 10619
231 Ga0439465_0113368 3300041413 Bacteria 945
232 Ga0451787_413728 3300041441 Bacteria 876
233 Ga0451791_0018853 3300041451 Bacteria 1381
234 Ga0451793_0065178 3300041452 Bacteria 2236
235 Ga0451797_1383358 3300041453 Bacteria 1652
236 Ga0451795_0324568 3300041456 Bacteria 5254
237 Ga0451802_1525703 3300041460 Bacteria 1795
238 Ga0451837_0986631 3300041494 Bacteria 2155
239 Ga0451843_0002039 3300041509 Bacteria 2503
240 Ga0439445_0003727 3300042004 Bacteria 3422
241 Ga0439445_0042279 3300042004 Bacteria 1213
242 Ga0439432_005498 3300042006 Bacteria 4558
243 Ga0439432_022936 3300042006 Bacteria 2060
244 Ga0439432_071377 3300042006 Bacteria 1058
245 Ga0439449_0000347 3300042007 Bacteria 16890
246 Ga0439449_0006492 3300042007 Bacteria 4469
247 Ga0439462_0005794 3300042015 Bacteria 3059
248 Ga0439434_0054640 3300042435 Bacteria 1242
249 Ga0466982_0055652 3300044672 Unclassified 2429
250 Ga0466965_0015000 3300044683 Bacteria 3675
251 Ga0466961_0008140 3300044693 Bacteria 6678
252 Ga0466957_0021510 3300044842 Bacteria 3801
253 Ga0466959_0070013 3300045049 Bacteria 2541
254 Ga0451576_0353666 3300045051 Unclassified 1538
255 Ga0466958_0018727 3300045836 Bacteria 4022
256 Ga0466967_0110605 3300045976 Bacteria 2524
257 Ga0495617_000016 3300046452 Bacteria 253600
258 Ga0495638_0000044 3300046460 Bacteria 221595
259 Ga0495638_0000339 3300046460 Bacteria 59031
260 Ga0495638_0000670 3300046460 Bacteria 37267
261 Ga0495650_0000112 3300046471 Bacteria 197339
262 Ga0495650_0000378 3300046471 Bacteria 77220
263 Ga0495650_0006695 3300046471 Bacteria 7135
264 Ga0495650_0018643 3300046471 Bacteria 3443
265 Ga0495584_0000985 3300046491 Bacteria 17856
266 Ga0495585_0000007 3300046492 Bacteria 288113
267 Ga0495585_0005543 3300046492 Bacteria 7941
268 Ga0495607_0000030 3300046501 Bacteria 154557
269 Ga0495607_0000080 3300046501 Bacteria 97217
270 Ga0495606_0000073 3300046507 Bacteria 171657
271 Ga0495606_0000091 3300046507 Bacteria 153354
272 Ga0495606_0000662 3300046507 Bacteria 54138
273 Ga0495606_0034636 3300046507 Bacteria 3464
274 Ga0495606_0062297 3300046507 Bacteria 2382
275 Ga0495606_0073868 3300046507 Bacteria 2137
276 Ga0495616_0000001 3300046513 Bacteria 780061
277 Ga0495620_0000131 3300046515 Bacteria 60856
278 Ga0495620_0015919 3300046515 Bacteria 3786
279 Ga0495631_0000107 3300046518 Bacteria 55048
280 Ga0495631_0000708 3300046518 Bacteria 21517
281 Ga0495632_0014431 3300046519 Bacteria 4469
282 Ga0495637_0048403 3300046520 Bacteria 1790
283 Ga0495648_0001035 3300046524 Bacteria 28205
284 Ga0495648_0002855 3300046524 Bacteria 15557
285 Ga0495663_0000414 3300046525 Bacteria 15557
286 Ga0495663_0004110 3300046525 Bacteria 4120
287 Ga0495609_0004350 3300046538 Bacteria 7780
288 Ga0495622_0001888 3300046557 Bacteria 10308
289 Ga0495668_0009133 3300046616 Bacteria 6111
290 Ga0495611_0000001 3300046648 Bacteria 2628469
291 Ga0495611_0000006 3300046648 Bacteria 249842
292 Ga0495625_0000001 3300046660 Bacteria 1641829
293 Ga0495625_0020624 3300046660 Bacteria 5083
294 Ga0495625_0034650 3300046660 Bacteria 3725
295 Ga0495625_0086691 3300046660 Bacteria 2171
296 Ga0495661_0005301 3300046665 Bacteria 9166
297 Ga0495670_0000873 3300046691 Bacteria 14607
298 Ga0495670_0036233 3300046691 Bacteria 2458
299 Ga0495671_0000766 3300046692 Bacteria 23070
300 Ga0495671_0013589 3300046692 Bacteria 4402
301 Ga0495649_0002024 3300046694 Bacteria 14665
302 Ga0495649_0119676 3300046694 Bacteria 1393
303 Ga0495589_0000016 3300046794 Bacteria 209027
304 Ga0495660_0000018 3300046810 Bacteria 317061
305 Ga0495660_0000025 3300046810 Bacteria 260275
306 Ga0495683_0005270 3300047323 Bacteria 7186
307 Ga0495679_000001 3300047446 Bacteria 1607568
308 Ga0495673_0000001 3300047469 Bacteria 1630730
309 Ga0495673_0000018 3300047469 Bacteria 569190
310 Ga0495673_0000129 3300047469 Bacteria 139549
311 Ga0495686_0000037 3300047472 Bacteria 307937
312 Ga0495686_0009395 3300047472 Bacteria 7048
313 Ga0495686_0053133 3300047472 Bacteria 2539
314 Ga0496100_0001279 3300048903 Bacteria 12275
315 Ga0496101_0002692 3300048904 Bacteria 10896
316 Ga0496101_0298521 3300048904 Bacteria 1261
317 Ga0496102_0417512 3300048905 Bacteria 1260
318 Ga0496104_0582427 3300048907 Bacteria 1029
319 Ga0496105_0015574 3300048908 Bacteria 6064
320 Ga0496106_0003716 3300048909 Bacteria 11386
321 Ga0496113_0006135 3300048916 Bacteria 7586
322 Ga0496113_0047016 3300048916 Bacteria 3206
323 Ga0496115_0000260 3300048918 Bacteria 46993
324 Ga0496115_0002834 3300048918 Bacteria 12471
325 Ga0496115_0009282 3300048918 Bacteria 7311
326 Ga0496115_0013724 3300048918 Bacteria 6134
327 Ga0496117_0002285 3300048920 Bacteria 24728
328 Ga0496117_0068359 3300048920 Bacteria 2398
329 Ga0496118_0002466 3300048921 Bacteria 24851
330 Ga0496118_0004513 3300048921 Bacteria 16453
331 Ga0496119_0000158 3300048922 Bacteria 93884
332 Ga0496120_0000268 3300048923 Bacteria 86899
333 Ga0496121_0000169 3300048924 Bacteria 144577
334 Ga0496121_0000501 3300048924 Bacteria 74907
335 Ga0496121_0001054 3300048924 Bacteria 48888
336 Ga0496121_0001076 3300048924 Bacteria 48261
337 Ga0496121_0021269 3300048924 Bacteria 6365
338 Ga0496121_0217467 3300048924 Bacteria 1348
339 Ga0496122_0052914 3300048925 Bacteria 3066
340 Ga0496122_0103597 3300048925 Bacteria 1893
341 Ga0496123_0020439 3300048926 Bacteria 5179
342 Ga0496123_0044529 3300048926 Bacteria 3034
343 Ga0496123_0059925 3300048926 Bacteria 2457
344 Ga0496124_0023304 3300048927 Bacteria 5654
345 Ga0496126_0000988 3300048929 Bacteria 48494
346 Ga0496126_0022149 3300048929 Bacteria 6190
347 Ga0496126_0069917 3300048929 Bacteria 3129
348 Ga0495678_000183 3300049459 Bacteria 72503
349 Ga0495678_049224 3300049459 Bacteria 1639
350 Ga0495682_0001226 3300049460 Bacteria 14541
351 Ga0495682_0009299 3300049460 Bacteria 3840
352 Ga0501031_0023873 3300049568 Bacteria 3987
353 Ga0501032_0015897 3300049569 Bacteria 5301
354 Ga0501033_0047803 3300049570 Bacteria 3180
355 Ga0501034_0033801 3300049571 Bacteria 5184
356 Ga0501036_0093370 3300049572 Bacteria 2542
357 Ga0501037_0054927 3300049573 Bacteria 2912
358 Ga0501038_0000673 3300049574 Bacteria 30442
359 Ga0501039_0134828 3300049575 Bacteria 1938
360 Ga0501043_0039613 3300049579 Bacteria 3703
361 Ga0501046_0001293 3300049580 Bacteria 24252
362 Ga0501047_0039098 3300049581 Bacteria 4589
363 Ga0501047_0315217 3300049581 Bacteria 1404
364 Ga0501048_0031008 3300049582 Bacteria 3869
365 Ga0501048_0067089 3300049582 Bacteria 2537
366 Ga0501073_0004907 3300049589 Bacteria 10042
367 Ga0501035_0065146 3300049822 Bacteria 3236
368 Ga0501035_0106722 3300049822 Bacteria 2455
369 Ga0501044_0028553 3300049823 Bacteria 5888
370 Ga0501044_0086428 3300049823 Bacteria 3168
371 Ga0501044_0310312 3300049823 Bacteria 1504
372 Ga0500643_000002 3300053087 Bacteria 1277657
373 Ga0500646_0020916 3300053090 Bacteria 1741
374 Ga0500555_001656 3300053103 Bacteria 6727
375 Ga0500652_010545 3300053131 Bacteria 3171
376 Ga0500633_0002406 3300053160 Bacteria 3840
377 Ga0500645_001638 3300053730 Bacteria 11042
378 Ga0466962_0004210 3300061719 Bacteria 6891

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025923 Ga0207681_10094521 Ga0207681_100945212 212
2 3300049581 Ga0501047_0315217 Ga0501047_0315217_417_1205 215
3 iso_pu_bacteria 2643221559 2643817585 224
4 iso_pu_bacteria 2643221581 2643913993 224
5 iso_pu_bacteria 2643221586 2643940297 224
6 iso_pu_bacteria 2643221593 2643974842 224
7 iso_pu_bacteria 2643221612 2644079368 224
8 iso_pu_bacteria 2643221727 2644694812 224
9 iso_pu_bacteria 2718218334 2721027196 224
10 iso_pu_bacteria 2734482264 2735837207 224
11 iso_pu_bacteria 2738543009 2739226669 224
12 iso_pu_bacteria 2739367700 2739733366 224
13 iso_pu_bacteria 2923516293 2923516459 224
14 iso_pu_bacteria 2928963466 2928965470 224
15 iso_pu_bacteria 2939611941 2939614368 224
16 iso_pu_bacteria 2941489479 2941494188 224
17 3300010375 Ga0105239_10000097 Ga0105239_10000097109 225
18 3300003322 rootL2_10003424 rootL2_100034248 226
19 3300031344 Ga0265316_10437650 Ga0265316_104376501 226
20 3300045051 Ga0451576_0353666 Ga0451576_0353666_541_1284 226
21 3300005327 Ga0070658_10015779 Ga0070658_100157793 227
22 3300005335 Ga0070666_10000034 Ga0070666_1000003465 227
23 3300005344 Ga0070661_100187138 Ga0070661_1001871382 227
24 3300005367 Ga0070667_100031747 Ga0070667_1000317475 227
25 3300005456 Ga0070678_100132395 Ga0070678_1001323952 227
26 3300009551 Ga0105238_10001729 Ga0105238_1000172915 227
27 3300013306 Ga0163162_10000106 Ga0163162_1000010641 227
28 3300025231 Ga0207427_100178 Ga0207427_10017814 227
29 3300025233 Ga0209437_100304 Ga0209437_10030414 227
30 3300025261 Ga0209233_1000287 Ga0209233_100028764 227
31 3300025903 Ga0207680_10000005 Ga0207680_10000005293 227
32 3300025909 Ga0207705_10012465 Ga0207705_100124655 227
33 3300025924 Ga0207694_10001399 Ga0207694_1000139916 227
34 3300025986 Ga0207658_10012344 Ga0207658_100123445 227
35 3300026121 Ga0207683_10232274 Ga0207683_102322742 227
36 3300028379 Ga0268266_10000004 Ga0268266_100000041232 227
37 3300028786 Ga0307517_10105153 Ga0307517_101051532 227
38 3300033180 Ga0307510_10000049 Ga0307510_1000004928 227
39 3300041406 Ga0439439_0000563 Ga0439439_0000563_2516_3286 227
40 3300042015 Ga0439462_0005794 Ga0439462_0005794_438_1208 227
41 3300046471 Ga0495650_0000378 Ga0495650_0000378_18230_18994 227
42 3300046507 Ga0495606_0062297 Ga0495606_0062297_1483_2247 227
43 3300046660 Ga0495625_0034650 Ga0495625_0034650_712_1476 227
44 3300048929 Ga0496126_0069917 Ga0496126_0069917_1674_2438 227
45 3300053090 Ga0500646_0020916 Ga0500646_0020916_254_1018 227
46 3300002067 JGI24735J21928_10004757 JGI24735J21928_100047574 228
47 3300002705 JGI25156J39149_1004166 JGI25156J39149_10041661 228
48 3300002737 JGI25162J39368_1000168 JGI25162J39368_100016815 228
49 3300002737 JGI25162J39368_1001157 JGI25162J39368_100115714 228
50 3300002737 JGI25162J39368_1002047 JGI25162J39368_10020476 228
51 3300002741 JGI25157J39369_1000196 JGI25157J39369_100019613 228
52 3300002741 JGI25157J39369_1001230 JGI25157J39369_100123014 228
53 3300002771 JGI25163J39215_1001769 JGI25163J39215_10017691 228
54 3300002772 JGI25164J39214_1000132 JGI25164J39214_100013213 228
55 3300003187 JGI25151J46595_10000167 JGI25151J46595_1000016731 228
56 3300003214 JGI25165J46597_1000242 JGI25165J46597_100024215 228
57 3300003316 rootH1_10116637 rootH1_101166372 228
58 3300003756 Ga0055533_1002722 Ga0055533_10027224 228
59 3300003761 Ga0055535_1000207 Ga0055535_100020748 228
60 3300003762 Ga0055542_1000207 Ga0055542_100020715 228
61 3300003762 Ga0055542_1001016 Ga0055542_100101614 228
62 3300003763 Ga0055529_1000225 Ga0055529_100022550 228
63 3300003771 Ga0055526_1000012 Ga0055526_1000012169 228
64 3300003773 Ga0055537_1000021 Ga0055537_100002152 228
65 3300003775 Ga0055524_1000037 Ga0055524_1000037113 228
66 3300003784 Ga0055534_1000006 Ga0055534_1000006169 228
67 3300003790 Ga0055528_1000006 Ga0055528_1000006169 228
68 3300003794 Ga0055531_10016932 Ga0055531_100169322 228
69 3300005340 Ga0070689_100008702 Ga0070689_1000087024 228
70 3300005344 Ga0070661_100005683 Ga0070661_1000056838 228
71 3300005344 Ga0070661_100027207 Ga0070661_1000272072 228
72 3300005344 Ga0070661_100071534 Ga0070661_1000715341 228
73 3300005345 Ga0070692_10024044 Ga0070692_100240442 228
74 3300005347 Ga0070668_100138954 Ga0070668_1001389542 228
75 3300005367 Ga0070667_100000235 Ga0070667_10000023551 228
76 3300005367 Ga0070667_100730693 Ga0070667_1007306931 228
77 3300005435 Ga0070714_100000107 Ga0070714_10000010719 228
78 3300005435 Ga0070714_100009239 Ga0070714_1000092395 228
79 3300005436 Ga0070713_100003665 Ga0070713_10000366511 228
80 3300005455 Ga0070663_100238247 Ga0070663_1002382471 228
81 3300005455 Ga0070663_100456575 Ga0070663_1004565752 228
82 3300005457 Ga0070662_100063326 Ga0070662_1000633261 228
83 3300005539 Ga0068853_100000285 Ga0068853_10000028512 228
84 3300005539 Ga0068853_100043084 Ga0068853_1000430842 228
85 3300005548 Ga0070665_100040318 Ga0070665_1000403186 228
86 3300005563 Ga0068855_100017853 Ga0068855_1000178532 228
87 3300005577 Ga0068857_100063504 Ga0068857_1000635043 228
88 3300005577 Ga0068857_100151003 Ga0068857_1001510032 228
89 3300005578 Ga0068854_100028171 Ga0068854_1000281715 228
90 3300005578 Ga0068854_100106879 Ga0068854_1001068792 228
91 3300005617 Ga0068859_100000400 Ga0068859_10000040010 228
92 3300005841 Ga0068863_100058406 Ga0068863_1000584063 228
93 3300005843 Ga0068860_100043674 Ga0068860_1000436742 228
94 3300005843 Ga0068860_100546168 Ga0068860_1005461682 228
95 3300005844 Ga0068862_100001117 Ga0068862_10000111721 228
96 3300005844 Ga0068862_100136010 Ga0068862_1001360102 228
97 3300006931 Ga0097620_100000400 Ga0097620_10000040010 228
98 3300009093 Ga0105240_10000127 Ga0105240_1000012791 228
99 3300009093 Ga0105240_10223556 Ga0105240_102235564 228
100 3300009101 Ga0105247_10029899 Ga0105247_100298993 228
101 3300009101 Ga0105247_10034514 Ga0105247_100345142 228
102 3300009545 Ga0105237_10026613 Ga0105237_100266133 228
103 3300009545 Ga0105237_10079049 Ga0105237_100790492 228
104 3300009551 Ga0105238_10022911 Ga0105238_100229112 228
105 3300009551 Ga0105238_10026037 Ga0105238_100260372 228
106 3300009551 Ga0105238_10073071 Ga0105238_100730712 228
107 3300009551 Ga0105238_10142976 Ga0105238_101429762 228
108 3300009979 Ga0105032_100578 Ga0105032_1005783 228
109 3300010375 Ga0105239_10000056 Ga0105239_1000005687 228
110 3300010375 Ga0105239_10015927 Ga0105239_100159274 228
111 3300010375 Ga0105239_10307131 Ga0105239_103071312 228
112 3300013100 Ga0157373_10055609 Ga0157373_100556091 228
113 3300013104 Ga0157370_10260629 Ga0157370_102606292 228
114 3300013296 Ga0157374_10103955 Ga0157374_101039552 228
115 3300013306 Ga0163162_10000021 Ga0163162_1000002169 228
116 3300013306 Ga0163162_10097849 Ga0163162_100978493 228
117 3300013307 Ga0157372_10030498 Ga0157372_100304984 228
118 3300014497 Ga0182008_10045469 Ga0182008_100454692 228
119 3300015261 Ga0182006_1000005 Ga0182006_1000005303 228
120 3300015262 Ga0182007_10004066 Ga0182007_100040661 228
121 3300015262 Ga0182007_10011323 Ga0182007_100113233 228
122 3300015265 Ga0182005_1036220 Ga0182005_10362202 228
123 3300015685 Ga0183369_1006 Ga0183369_1006299 228
124 3300015687 Ga0183368_1002 Ga0183368_10021038 228
125 3300015689 Ga0183360_10002 Ga0183360_10002197 228
126 3300016635 Ga0183361_10913 Ga0183361_109132 228
127 3300017792 Ga0163161_10002397 Ga0163161_100023972 228
128 3300017792 Ga0163161_10201369 Ga0163161_102013691 228
129 3300025207 Ga0209760_100496 Ga0209760_1004964 228
130 3300025224 Ga0209784_100131 Ga0209784_10013149 228
131 3300025226 Ga0209674_100014 Ga0209674_100014422 228
132 3300025226 Ga0209674_101773 Ga0209674_1017732 228
133 3300025228 Ga0209672_100275 Ga0209672_10027514 228
134 3300025228 Ga0209672_106556 Ga0209672_1065562 228
135 3300025231 Ga0207427_100117 Ga0207427_10011746 228
136 3300025231 Ga0207427_100161 Ga0207427_10016149 228
137 3300025231 Ga0207427_100968 Ga0207427_1009685 228
138 3300025233 Ga0209437_100116 Ga0209437_100116143 228
139 3300025233 Ga0209437_100240 Ga0209437_10024066 228
140 3300025233 Ga0209437_100257 Ga0209437_10025723 228
141 3300025242 Ga0209258_100092 Ga0209258_10009222 228
142 3300025245 Ga0207425_1002024 Ga0207425_10020249 228
143 3300025246 Ga0209646_1001845 Ga0209646_10018452 228
144 3300025246 Ga0209646_1004619 Ga0209646_10046192 228
145 3300025250 Ga0209026_1000093 Ga0209026_100009374 228
146 3300025250 Ga0209026_1000230 Ga0209026_100023050 228
147 3300025250 Ga0209026_1002433 Ga0209026_10024335 228
148 3300025254 Ga0209148_1000002 Ga0209148_1000002602 228
149 3300025254 Ga0209148_1000047 Ga0209148_1000047219 228
150 3300025256 Ga0209759_1000584 Ga0209759_100058423 228
151 3300025256 Ga0209759_1003838 Ga0209759_10038386 228
152 3300025256 Ga0209759_1005221 Ga0209759_10052212 228
153 3300025261 Ga0209233_1000083 Ga0209233_1000083269 228
154 3300025261 Ga0209233_1000100 Ga0209233_100010051 228
155 3300025263 Ga0209565_1000002 Ga0209565_1000002776 228
156 3300025263 Ga0209565_1005810 Ga0209565_10058102 228
157 3300025272 Ga0209455_1000056 Ga0209455_1000056143 228
158 3300025272 Ga0209455_1006013 Ga0209455_10060134 228
159 3300025273 Ga0209673_1000002 Ga0209673_1000002776 228
160 3300025291 Ga0209675_1000002 Ga0209675_1000002776 228
161 3300025294 Ga0209025_1000021 Ga0209025_1000021252 228
162 3300025295 Ga0209564_1000004 Ga0209564_1000004777 228
163 3300025299 Ga0209256_1000004 Ga0209256_1000004777 228
164 3300025304 Ga0209257_1001473 Ga0209257_10014732 228
165 3300025904 Ga0207647_10000234 Ga0207647_1000023420 228
166 3300025904 Ga0207647_10005326 Ga0207647_100053262 228
167 3300025904 Ga0207647_10008671 Ga0207647_100086716 228
168 3300025909 Ga0207705_10000977 Ga0207705_100009774 228
169 3300025913 Ga0207695_10000243 Ga0207695_1000024349 228
170 3300025914 Ga0207671_10015892 Ga0207671_100158923 228
171 3300025914 Ga0207671_10041831 Ga0207671_100418313 228
172 3300025914 Ga0207671_10589160 Ga0207671_105891601 228
173 3300025919 Ga0207657_10275310 Ga0207657_102753102 228
174 3300025920 Ga0207649_10010368 Ga0207649_100103682 228
175 3300025920 Ga0207649_10074283 Ga0207649_100742832 228
176 3300025924 Ga0207694_10021552 Ga0207694_100215522 228
177 3300025924 Ga0207694_10027444 Ga0207694_100274442 228
178 3300025924 Ga0207694_10105301 Ga0207694_101053012 228
179 3300025928 Ga0207700_10001482 Ga0207700_1000148214 228
180 3300025929 Ga0207664_10000036 Ga0207664_1000003650 228
181 3300025932 Ga0207690_10254803 Ga0207690_102548032 228
182 3300025933 Ga0207706_10028398 Ga0207706_100283984 228
183 3300025933 Ga0207706_10306809 Ga0207706_103068092 228
184 3300025936 Ga0207670_10011408 Ga0207670_100114083 228
185 3300025949 Ga0207667_10012121 Ga0207667_100121214 228
186 3300025949 Ga0207667_10020745 Ga0207667_100207456 228
187 3300025972 Ga0207668_10019502 Ga0207668_100195024 228
188 3300025981 Ga0207640_10024206 Ga0207640_100242064 228
189 3300025981 Ga0207640_10078280 Ga0207640_100782802 228
190 3300025986 Ga0207658_10232530 Ga0207658_102325302 228
191 3300026041 Ga0207639_10053898 Ga0207639_100538982 228
192 3300026041 Ga0207639_10068970 Ga0207639_100689702 228
193 3300026067 Ga0207678_10054468 Ga0207678_100544683 228
194 3300026067 Ga0207678_10321139 Ga0207678_103211392 228
195 3300026078 Ga0207702_10007655 Ga0207702_100076555 228
196 3300026088 Ga0207641_10273421 Ga0207641_102734212 228
197 3300026116 Ga0207674_10126140 Ga0207674_101261403 228
198 3300028380 Ga0268265_10000150 Ga0268265_1000015049 228
199 3300028380 Ga0268265_10113949 Ga0268265_101139492 228
200 3300028381 Ga0268264_10058372 Ga0268264_100583722 228
201 3300030733 Ga0314311_1083627 Ga0314311_10836274 228
202 3300030735 Ga0316178_1014208 Ga0316178_10142082 228
203 3300031456 Ga0307513_10002077 Ga0307513_1000207723 228
204 3300031456 Ga0307513_10108594 Ga0307513_101085942 228
205 3300031548 Ga0307408_100213308 Ga0307408_1002133082 228
206 3300031616 Ga0307508_10014915 Ga0307508_100149156 228
207 3300032005 Ga0307411_10113086 Ga0307411_101130862 228
208 3300039145 Ga0237816_00324 Ga0237816_00324_1509_2288 228
209 3300041404 Ga0439436_0006551 Ga0439436_0006551_2265_3047 228
210 3300041413 Ga0439465_0000192 Ga0439465_0000192_7113_7892 228
211 3300041413 Ga0439465_0000650 Ga0439465_0000650_5693_6484 228
212 3300041413 Ga0439465_0113368 Ga0439465_0113368_13_792 228
213 3300041441 Ga0451787_413728 Ga0451787_413728_14_793 228
214 3300041451 Ga0451791_0018853 Ga0451791_0018853_508_1299 228
215 3300041452 Ga0451793_0065178 Ga0451793_0065178_321_1100 228
216 3300041453 Ga0451797_1383358 Ga0451797_1383358_640_1419 228
217 3300041456 Ga0451795_0324568 Ga0451795_0324568_2975_3754 228
218 3300041460 Ga0451802_1525703 Ga0451802_1525703_177_956 228
219 3300041494 Ga0451837_0986631 Ga0451837_0986631_522_1301 228
220 3300041509 Ga0451843_0002039 Ga0451843_0002039_1591_2370 228
221 3300042004 Ga0439445_0003727 Ga0439445_0003727_2485_3276 228
222 3300042004 Ga0439445_0042279 Ga0439445_0042279_65_856 228
223 3300042006 Ga0439432_005498 Ga0439432_005498_1953_2720 228
224 3300042006 Ga0439432_022936 Ga0439432_022936_358_1140 228
225 3300042006 Ga0439432_071377 Ga0439432_071377_140_943 228
226 3300042007 Ga0439449_0000347 Ga0439449_0000347_5316_6107 228
227 3300042007 Ga0439449_0006492 Ga0439449_0006492_1730_2509 228
228 3300042435 Ga0439434_0054640 Ga0439434_0054640_265_1044 228
229 3300044683 Ga0466965_0015000 Ga0466965_0015000_76_867 228
230 3300044693 Ga0466961_0008140 Ga0466961_0008140_1605_2396 228
231 3300044842 Ga0466957_0021510 Ga0466957_0021510_2328_3119 228
232 3300045049 Ga0466959_0070013 Ga0466959_0070013_696_1487 228
233 3300045836 Ga0466958_0018727 Ga0466958_0018727_1544_2335 228
234 3300045976 Ga0466967_0110605 Ga0466967_0110605_641_1423 228
235 3300046452 Ga0495617_000016 Ga0495617_000016_203642_204418 228
236 3300046460 Ga0495638_0000044 Ga0495638_0000044_202300_203085 228
237 3300046460 Ga0495638_0000339 Ga0495638_0000339_42603_43391 228
238 3300046460 Ga0495638_0000670 Ga0495638_0000670_12317_13105 228
239 3300046471 Ga0495650_0000112 Ga0495650_0000112_185036_185824 228
240 3300046471 Ga0495650_0006695 Ga0495650_0006695_127_900 228
241 3300046471 Ga0495650_0018643 Ga0495650_0018643_1425_2198 228
242 3300046491 Ga0495584_0000985 Ga0495584_0000985_9450_10223 228
243 3300046492 Ga0495585_0000007 Ga0495585_0000007_119159_119929 228
244 3300046492 Ga0495585_0005543 Ga0495585_0005543_6143_6916 228
245 3300046501 Ga0495607_0000030 Ga0495607_0000030_138005_138790 228
246 3300046501 Ga0495607_0000080 Ga0495607_0000080_38059_38835 228
247 3300046507 Ga0495606_0000073 Ga0495606_0000073_4683_5456 228
248 3300046507 Ga0495606_0000091 Ga0495606_0000091_48208_48984 228
249 3300046507 Ga0495606_0000662 Ga0495606_0000662_47078_47866 228
250 3300046507 Ga0495606_0034636 Ga0495606_0034636_2631_3404 228
251 3300046507 Ga0495606_0073868 Ga0495606_0073868_1030_1803 228
252 3300046513 Ga0495616_0000001 Ga0495616_0000001_665272_666045 228
253 3300046515 Ga0495620_0000131 Ga0495620_0000131_41993_42769 228
254 3300046515 Ga0495620_0015919 Ga0495620_0015919_574_1347 228
255 3300046518 Ga0495631_0000107 Ga0495631_0000107_46462_47235 228
256 3300046518 Ga0495631_0000708 Ga0495631_0000708_12958_13728 228
257 3300046519 Ga0495632_0014431 Ga0495632_0014431_3051_3824 228
258 3300046520 Ga0495637_0048403 Ga0495637_0048403_544_1329 228
259 3300046524 Ga0495648_0001035 Ga0495648_0001035_17788_18558 228
260 3300046524 Ga0495648_0002855 Ga0495648_0002855_2494_3267 228
261 3300046525 Ga0495663_0000414 Ga0495663_0000414_7684_8463 228
262 3300046525 Ga0495663_0004110 Ga0495663_0004110_3094_3873 228
263 3300046538 Ga0495609_0004350 Ga0495609_0004350_72_857 228
264 3300046557 Ga0495622_0001888 Ga0495622_0001888_5402_6190 228
265 3300046616 Ga0495668_0009133 Ga0495668_0009133_3487_4272 228
266 3300046648 Ga0495611_0000001 Ga0495611_0000001_1419070_1419855 228
267 3300046648 Ga0495611_0000006 Ga0495611_0000006_26664_27437 228
268 3300046660 Ga0495625_0000001 Ga0495625_0000001_496182_496967 228
269 3300046660 Ga0495625_0020624 Ga0495625_0020624_1476_2264 228
270 3300046660 Ga0495625_0086691 Ga0495625_0086691_1287_2060 228
271 3300046665 Ga0495661_0005301 Ga0495661_0005301_593_1363 228
272 3300046691 Ga0495670_0000873 Ga0495670_0000873_1257_2042 228
273 3300046691 Ga0495670_0036233 Ga0495670_0036233_280_1053 228
274 3300046692 Ga0495671_0000766 Ga0495671_0000766_10022_10807 228
275 3300046692 Ga0495671_0013589 Ga0495671_0013589_911_1690 228
276 3300046694 Ga0495649_0002024 Ga0495649_0002024_1411_2199 228
277 3300046694 Ga0495649_0119676 Ga0495649_0119676_204_971 228
278 3300046794 Ga0495589_0000016 Ga0495589_0000016_138400_139185 228
279 3300046810 Ga0495660_0000018 Ga0495660_0000018_264469_265254 228
280 3300046810 Ga0495660_0000025 Ga0495660_0000025_249089_249874 228
281 3300047323 Ga0495683_0005270 Ga0495683_0005270_3934_4707 228
282 3300047446 Ga0495679_000001 Ga0495679_000001_167100_167885 228
283 3300047469 Ga0495673_0000001 Ga0495673_0000001_490770_491555 228
284 3300047469 Ga0495673_0000018 Ga0495673_0000018_55193_55966 228
285 3300047469 Ga0495673_0000129 Ga0495673_0000129_133518_134303 228
286 3300047472 Ga0495686_0000037 Ga0495686_0000037_223692_224477 228
287 3300047472 Ga0495686_0009395 Ga0495686_0009395_5466_6239 228
288 3300047472 Ga0495686_0053133 Ga0495686_0053133_1132_1908 228
289 3300048903 Ga0496100_0001279 Ga0496100_0001279_7750_8526 228
290 3300048904 Ga0496101_0002692 Ga0496101_0002692_6395_7171 228
291 3300048904 Ga0496101_0298521 Ga0496101_0298521_63_851 228
292 3300048905 Ga0496102_0417512 Ga0496102_0417512_25_798 228
293 3300048907 Ga0496104_0582427 Ga0496104_0582427_163_951 228
294 3300048908 Ga0496105_0015574 Ga0496105_0015574_5185_5973 228
295 3300048909 Ga0496106_0003716 Ga0496106_0003716_8530_9303 228
296 3300048916 Ga0496113_0006135 Ga0496113_0006135_3826_4614 228
297 3300048916 Ga0496113_0047016 Ga0496113_0047016_616_1419 228
298 3300048918 Ga0496115_0000260 Ga0496115_0000260_42555_43343 228
299 3300048918 Ga0496115_0002834 Ga0496115_0002834_2741_3529 228
300 3300048918 Ga0496115_0009282 Ga0496115_0009282_3317_4105 228
301 3300048918 Ga0496115_0013724 Ga0496115_0013724_1403_2191 228
302 3300048920 Ga0496117_0002285 Ga0496117_0002285_21866_22654 228
303 3300048920 Ga0496117_0068359 Ga0496117_0068359_1378_2166 228
304 3300048921 Ga0496118_0002466 Ga0496118_0002466_1378_2166 228
305 3300048921 Ga0496118_0004513 Ga0496118_0004513_15602_16390 228
306 3300048922 Ga0496119_0000158 Ga0496119_0000158_91023_91811 228
307 3300048923 Ga0496120_0000268 Ga0496120_0000268_2074_2862 228
308 3300048924 Ga0496121_0000169 Ga0496121_0000169_62558_63346 228
309 3300048924 Ga0496121_0000501 Ga0496121_0000501_63987_64772 228
310 3300048924 Ga0496121_0001054 Ga0496121_0001054_24026_24799 228
311 3300048924 Ga0496121_0001076 Ga0496121_0001076_31688_32455 228
312 3300048924 Ga0496121_0021269 Ga0496121_0021269_4369_5157 228
313 3300048924 Ga0496121_0217467 Ga0496121_0217467_228_1004 228
314 3300048925 Ga0496122_0052914 Ga0496122_0052914_652_1428 228
315 3300048925 Ga0496122_0103597 Ga0496122_0103597_764_1552 228
316 3300048926 Ga0496123_0020439 Ga0496123_0020439_3626_4405 228
317 3300048926 Ga0496123_0044529 Ga0496123_0044529_1195_1971 228
318 3300048926 Ga0496123_0059925 Ga0496123_0059925_201_977 228
319 3300048927 Ga0496124_0023304 Ga0496124_0023304_1920_2699 228
320 3300048929 Ga0496126_0000988 Ga0496126_0000988_34630_35418 228
321 3300048929 Ga0496126_0022149 Ga0496126_0022149_2979_3767 228
322 3300049459 Ga0495678_000183 Ga0495678_000183_66220_67005 228
323 3300049459 Ga0495678_049224 Ga0495678_049224_559_1347 228
324 3300049460 Ga0495682_0001226 Ga0495682_0001226_5946_6716 228
325 3300049460 Ga0495682_0009299 Ga0495682_0009299_2915_3700 228
326 3300049568 Ga0501031_0023873 Ga0501031_0023873_2835_3629 228
327 3300049569 Ga0501032_0015897 Ga0501032_0015897_3189_3983 228
328 3300049570 Ga0501033_0047803 Ga0501033_0047803_859_1653 228
329 3300049571 Ga0501034_0033801 Ga0501034_0033801_1099_1893 228
330 3300049572 Ga0501036_0093370 Ga0501036_0093370_624_1418 228
331 3300049573 Ga0501037_0054927 Ga0501037_0054927_1331_2125 228
332 3300049574 Ga0501038_0000673 Ga0501038_0000673_8259_9053 228
333 3300049575 Ga0501039_0134828 Ga0501039_0134828_1023_1817 228
334 3300049579 Ga0501043_0039613 Ga0501043_0039613_2259_3053 228
335 3300049580 Ga0501046_0001293 Ga0501046_0001293_20731_21525 228
336 3300049581 Ga0501047_0039098 Ga0501047_0039098_1537_2331 228
337 3300049582 Ga0501048_0031008 Ga0501048_0031008_2429_3211 228
338 3300049582 Ga0501048_0067089 Ga0501048_0067089_93_887 228
339 3300049589 Ga0501073_0004907 Ga0501073_0004907_5980_6774 228
340 3300049822 Ga0501035_0065146 Ga0501035_0065146_859_1653 228
341 3300049822 Ga0501035_0106722 Ga0501035_0106722_1115_1891 228
342 3300049823 Ga0501044_0028553 Ga0501044_0028553_4307_5101 228
343 3300049823 Ga0501044_0086428 Ga0501044_0086428_1787_2563 228
344 3300049823 Ga0501044_0310312 Ga0501044_0310312_97_873 228
345 3300053087 Ga0500643_000002 Ga0500643_000002_394440_395225 228
346 3300053103 Ga0500555_001656 Ga0500555_001656_3065_3850 228
347 3300053160 Ga0500633_0002406 Ga0500633_0002406_1190_1963 228
348 3300053730 Ga0500645_001638 Ga0500645_001638_3035_3805 228
349 3300061719 Ga0466962_0004210 Ga0466962_0004210_2261_3052 228
350 3300009093 Ga0105240_10000119 Ga0105240_10000119132 234
351 3300009545 Ga0105237_10462038 Ga0105237_104620382 234
352 3300025913 Ga0207695_10000139 Ga0207695_1000013972 234
353 3300005616 Ga0068852_100022575 Ga0068852_1000225756 236
354 3300010375 Ga0105239_10011362 Ga0105239_100113627 236
355 3300013307 Ga0157372_10327948 Ga0157372_103279482 236
356 3300025913 Ga0207695_10026872 Ga0207695_100268728 236
357 3300001979 JGI24740J21852_10000062 JGI24740J21852_1000006240 238
358 3300001989 JGI24739J22299_10001107 JGI24739J22299_100011072 238
359 3300002738 JGI25154J39366_1000002 JGI25154J39366_1000002196 238
360 3300003215 JGI25153J46596_10000384 JGI25153J46596_1000038422 238
361 3300003215 JGI25153J46596_10022431 JGI25153J46596_100224312 238
362 3300003322 rootL2_10181279 rootL2_101812791 238
363 3300003323 rootH1_10003055 rootH1_100030558 238
364 3300003323 rootH1_10035735 rootH1_100357352 238
365 3300003323 rootH1_10198447 rootH1_101984472 238
366 3300003354 JGI25160J50197_1001560 JGI25160J50197_10015601 238
367 3300003771 Ga0055526_1017333 Ga0055526_10173332 238
368 3300003790 Ga0055528_1000122 Ga0055528_100012237 238
369 3300003791 Ga0055530_10000192 Ga0055530_1000019249 238
370 3300003794 Ga0055531_10000104 Ga0055531_1000010416 238
371 3300005262 Ga0065165_1000258 Ga0065165_100025812 238
372 3300005539 Ga0068853_100043115 Ga0068853_1000431155 238
373 3300009551 Ga0105238_10218792 Ga0105238_102187923 238
374 3300010375 Ga0105239_10087418 Ga0105239_100874182 238
375 3300010375 Ga0105239_10470302 Ga0105239_104703022 238
376 3300025246 Ga0209646_1000005 Ga0209646_1000005180 238
377 3300025250 Ga0209026_1000232 Ga0209026_100023229 238
378 3300025258 Ga0209129_1021887 Ga0209129_10218872 238
379 3300025273 Ga0209673_1000049 Ga0209673_100004995 238
380 3300025295 Ga0209564_1014349 Ga0209564_10143492 238
381 3300025295 Ga0209564_1016356 Ga0209564_10163562 238
382 3300025297 Ga0209758_1000904 Ga0209758_100090424 238
383 3300025297 Ga0209758_1008520 Ga0209758_10085202 238
384 3300025298 Ga0209050_1000129 Ga0209050_100012911 238
385 3300025302 Ga0207426_1000600 Ga0207426_100060031 238
386 3300025302 Ga0207426_1000782 Ga0207426_100078215 238
387 3300025302 Ga0207426_1005673 Ga0207426_10056737 238
388 3300025304 Ga0209257_1000013 Ga0209257_1000013237 238
389 3300025304 Ga0209257_1001137 Ga0209257_100113732 238
390 3300025924 Ga0207694_10122692 Ga0207694_101226923 238
391 3300044672 Ga0466982_0055652 Ga0466982_0055652_1143_1919 238
392 3300053131 Ga0500652_010545 Ga0500652_010545_792_1565 238

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04397

LytTR

LytTr DNA-binding domain

182

279

0.96

PF00072

Response_reg

Response regulator receiver domain

31

140

0.94

Feature Viewer

pLDDT pTM Quality
84.66 0.49 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map