F431951

General Info

Members Datasets Scaffolds Average Seq Length
391 224 391 215

Family's Representative Sequence

Representative Sequence 3300005439|Ga0070711_100100576|Ga0070711_1001005761
Length 254
Sequence MESATVQSQAAPPPRLRERYEQEVLPELTAKFGYTTPMEAPRLQKITLNMGLGEAKQNAKMLEAAQEQLATIAGQQPNVRRARKSIASFKVREGMPVGLSVTLRRAHMWEFLDRLCAIAVPRIRDFRGLNPRSFDGRGNYSMGVREQLIFPEIDYDSVDEVRGLDVTITTSAKTDEEAFELLLGLGMPFAKEGRPGSRTDAEAAQLKEENPEAYAKPEAPEPAGPVAEDGAPAHPPEDASSTPPAGEAAEKEDS

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
125 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
126 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
127 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
128 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
129 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
130 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
131 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
137 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
143 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
144 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
145 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
146 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
147 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
148 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
149 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
150 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
151 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
152 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
153 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
154 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
155 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
156 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
157 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
158 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
159 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
160 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
161 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
162 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
163 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
164 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
165 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
166 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
167 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
168 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
169 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
170 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
171 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
172 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
173 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
174 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
175 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
176 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
177 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
178 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
179 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
180 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
181 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
182 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
183 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
184 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
185 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
186 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
187 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
188 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
189 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
190 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
203 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
204 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
205 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
206 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
208 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
209 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
210 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
211 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
212 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
213 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
216 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
217 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
218 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
219 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
220 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
221 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
222 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
223 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
224 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.02
Nodule 0
Rhizoplane 13.81
Rhizosphere 84.4
Stem 0
Stem Tuber 0
Unclassified 0.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000007 3300001977 Bacteria 20037
2 JGI24748J21848_1001781 3300002074 Bacteria 2388
3 JGI24034J26672_10000068 3300002239 Bacteria 28347
4 JGI25404J52841_10003670 3300003659 Bacteria 3050
5 Ga0070683_100002370 3300005329 Bacteria 14968
6 Ga0070683_100011264 3300005329 Bacteria 7719
7 Ga0070683_100029181 3300005329 Bacteria 4992
8 Ga0070683_100057365 3300005329 Bacteria 3617
9 Ga0070683_100111442 3300005329 Bacteria 2581
10 Ga0070683_100314791 3300005329 Bacteria 1489
11 Ga0070677_10001062 3300005333 Bacteria 8863
12 Ga0070666_10373661 3300005335 Bacteria 1022
13 Ga0070680_100052802 3300005336 Bacteria 3317
14 Ga0070680_100720111 3300005336 Bacteria 859
15 Ga0070682_100000009 3300005337 Bacteria 291635
16 Ga0070682_100000032 3300005337 Bacteria 155141
17 Ga0068868_100003492 3300005338 Bacteria 10940
18 Ga0068868_100008360 3300005338 Bacteria 7408
19 Ga0070691_10270252 3300005341 Bacteria 918
20 Ga0070687_100153253 3300005343 Bacteria 1355
21 Ga0070661_100000236 3300005344 Bacteria 45535
22 Ga0070675_100003153 3300005354 Bacteria 12477
23 Ga0070671_100342260 3300005355 Bacteria 1276
24 Ga0070674_100000021 3300005356 Bacteria 87134
25 Ga0070674_100028843 3300005356 Bacteria 3648
26 Ga0070673_100003060 3300005364 Bacteria 10351
27 Ga0070673_100153513 3300005364 Bacteria 1952
28 Ga0070688_100001088 3300005365 Bacteria 13570
29 Ga0070688_100257062 3300005365 Bacteria 1246
30 Ga0070659_100020922 3300005366 Bacteria 4975
31 Ga0070713_100000171 3300005436 Bacteria 43503
32 Ga0070701_10037759 3300005438 Bacteria 2440
33 Ga0070711_100015775 3300005439 Bacteria 4785
34 Ga0070711_100100576 3300005439 Bacteria 2103
35 Ga0070663_100016523 3300005455 Bacteria 4797
36 Ga0070663_100108315 3300005455 Bacteria 2084
37 Ga0070678_100160159 3300005456 Bacteria 1822
38 Ga0070678_100355501 3300005456 Bacteria 1261
39 Ga0070662_100000007 3300005457 Bacteria 168761
40 Ga0070681_10087446 3300005458 Bacteria 3069
41 Ga0070685_10010414 3300005466 Bacteria 4831
42 Ga0070707_100624608 3300005468 Bacteria 1040
43 Ga0070679_100000190 3300005530 Bacteria 49809
44 Ga0070679_100000832 3300005530 Bacteria 26815
45 Ga0070684_100010065 3300005535 Bacteria 7476
46 Ga0070684_100250525 3300005535 Bacteria 1619
47 Ga0068853_100011462 3300005539 Bacteria 7206
48 Ga0070693_100136368 3300005547 Bacteria 1540
49 Ga0070665_100000022 3300005548 Bacteria 379286
50 Ga0070665_100015972 3300005548 Bacteria 7536
51 Ga0070704_100056970 3300005549 Bacteria 2777
52 Ga0070664_100057724 3300005564 Bacteria 3300
53 Ga0068857_100258206 3300005577 Bacteria 1599
54 Ga0068854_100000939 3300005578 Bacteria 17543
55 Ga0068854_100101542 3300005578 Bacteria 2157
56 Ga0068856_100190874 3300005614 Bacteria 2062
57 Ga0068856_100898167 3300005614 Bacteria 905
58 Ga0068852_100001042 3300005616 Bacteria 18249
59 Ga0068852_100082661 3300005616 Bacteria 2854
60 Ga0068866_10000007 3300005718 Bacteria 121729
61 Ga0068851_10012553 3300005834 Bacteria 3996
62 Ga0068870_10182399 3300005840 Bacteria 1261
63 Ga0068858_100000150 3300005842 Bacteria 73075
64 Ga0068858_100000287 3300005842 Bacteria 54456
65 Ga0068860_100020469 3300005843 Bacteria 6408
66 Ga0081455_10042541 3300005937 Bacteria 3983
67 Ga0081455_10084872 3300005937 Bacteria 2583
68 Ga0081455_10190979 3300005937 Bacteria 1542
69 Ga0081538_10000208 3300005981 Bacteria 65347
70 Ga0081540_1000281 3300005983 Bacteria 52990
71 Ga0081540_1000553 3300005983 Bacteria 36267
72 Ga0081539_10015309 3300005985 Bacteria 5584
73 Ga0075365_10013680 3300006038 Bacteria 4864
74 Ga0075364_10022923 3300006051 Bacteria 3948
75 Ga0070715_10000003 3300006163 Bacteria 345282
76 Ga0070712_100003252 3300006175 Bacteria 10001
77 Ga0070712_100015964 3300006175 Bacteria 4843
78 Ga0070712_100022193 3300006175 Bacteria 4178
79 Ga0075428_100046826 3300006844 Bacteria 4750
80 Ga0075431_100008449 3300006847 Bacteria 10310
81 Ga0075433_10004429 3300006852 Bacteria 10932
82 Ga0075433_10050753 3300006852 Bacteria 3612
83 Ga0075433_10072875 3300006852 Bacteria 3020
84 Ga0075434_100394740 3300006871 Bacteria 1404
85 Ga0068865_100000056 3300006881 Bacteria 62122
86 Ga0075436_100335086 3300006914 Bacteria 1089
87 Ga0105240_10006736 3300009093 Bacteria 16822
88 Ga0111539_10042463 3300009094 Bacteria 5460
89 Ga0105245_10000022 3300009098 Bacteria 181225
90 Ga0105245_10006370 3300009098 Bacteria 10387
91 Ga0105245_10015882 3300009098 Bacteria 6559
92 Ga0105245_10028801 3300009098 Bacteria 4901
93 Ga0114129_10007041 3300009147 Bacteria 16012
94 Ga0114129_10234549 3300009147 Bacteria 2470
95 Ga0105243_10157495 3300009148 Bacteria 1955
96 Ga0105243_10595401 3300009148 Bacteria 1064
97 Ga0105241_10137178 3300009174 Bacteria 1988
98 Ga0105242_10058287 3300009176 Bacteria 3165
99 Ga0105242_10066186 3300009176 Bacteria 2983
100 Ga0105248_10001735 3300009177 Bacteria 24226
101 Ga0105249_10000181 3300009553 Bacteria 73946
102 Ga0105249_10752656 3300009553 Bacteria 1036
103 Ga0105239_10142086 3300010375 Bacteria 2675
104 Ga0105239_10458491 3300010375 Bacteria 1447
105 Ga0105239_10519462 3300010375 Bacteria 1355
106 Ga0157371_10017630 3300013102 Bacteria 5298
107 Ga0157371_10186859 3300013102 Bacteria 1483
108 Ga0157374_10015098 3300013296 Bacteria 6772
109 Ga0157378_10026190 3300013297 Bacteria 5140
110 Ga0157378_10027572 3300013297 Bacteria 5010
111 Ga0157372_10000809 3300013307 Bacteria 33940
112 Ga0157372_10085083 3300013307 Bacteria 3586
113 Ga0157375_10216680 3300013308 Bacteria 2072
114 Ga0157375_10243844 3300013308 Bacteria 1957
115 Ga0157380_10000560 3300014326 Bacteria 22835
116 Ga0157380_10000808 3300014326 Bacteria 19608
117 Ga0163161_10000013 3300017792 Bacteria 258747
118 Ga0163161_10217529 3300017792 Bacteria 1478
119 Ga0207656_10001048 3300025321 Bacteria 9048
120 Ga0207682_10000008 3300025893 Bacteria 87020
121 Ga0207642_10000008 3300025899 Bacteria 132651
122 Ga0207688_10023171 3300025901 Bacteria 3399
123 Ga0207688_10098651 3300025901 Bacteria 1684
124 Ga0207685_10000003 3300025905 Bacteria 344527
125 Ga0207643_10078853 3300025908 Bacteria 1905
126 Ga0207684_10565102 3300025910 Bacteria 973
127 Ga0207707_10410384 3300025912 Bacteria 1162
128 Ga0207695_10024364 3300025913 Bacteria 6812
129 Ga0207693_10001647 3300025915 Bacteria 19699
130 Ga0207693_10009704 3300025915 Bacteria 7836
131 Ga0207693_10026245 3300025915 Bacteria 4611
132 Ga0207663_10030357 3300025916 Bacteria 3188
133 Ga0207663_10043259 3300025916 Bacteria 2757
134 Ga0207663_10068382 3300025916 Bacteria 2281
135 Ga0207660_10367449 3300025917 Bacteria 1155
136 Ga0207657_10175735 3300025919 Bacteria 1733
137 Ga0207652_10000242 3300025921 Bacteria 56966
138 Ga0207652_10000666 3300025921 Bacteria 33621
139 Ga0207652_10067327 3300025921 Bacteria 3105
140 Ga0207659_10000138 3300025926 Bacteria 42755
141 Ga0207687_10000039 3300025927 Bacteria 114303
142 Ga0207687_10000132 3300025927 Bacteria 50024
143 Ga0207687_10002690 3300025927 Bacteria 12023
144 Ga0207687_10154525 3300025927 Bacteria 1754
145 Ga0207700_10000019 3300025928 Bacteria 183117
146 Ga0207664_10301840 3300025929 Bacteria 1409
147 Ga0207690_10012718 3300025932 Bacteria 5044
148 Ga0207706_10000018 3300025933 Bacteria 168729
149 Ga0207686_10007328 3300025934 Bacteria 5936
150 Ga0207686_10040728 3300025934 Bacteria 2827
151 Ga0207709_10018859 3300025935 Bacteria 3869
152 Ga0207670_10043686 3300025936 Bacteria 2961
153 Ga0207669_10000032 3300025937 Bacteria 82757
154 Ga0207704_10000308 3300025938 Bacteria 22892
155 Ga0207665_10150128 3300025939 Bacteria 1669
156 Ga0207711_10000011 3300025941 Bacteria 518817
157 Ga0207661_10000518 3300025944 Bacteria 24943
158 Ga0207661_10000616 3300025944 Bacteria 22858
159 Ga0207661_10007648 3300025944 Bacteria 7686
160 Ga0207661_10039225 3300025944 Bacteria 3716
161 Ga0207661_10147618 3300025944 Bacteria 2030
162 Ga0207679_10014248 3300025945 Bacteria 5223
163 Ga0207667_10065417 3300025949 Bacteria 3792
164 Ga0207651_10000746 3300025960 Bacteria 13950
165 Ga0207712_10000067 3300025961 Bacteria 130079
166 Ga0207640_10000821 3300025981 Bacteria 17670
167 Ga0207640_10080579 3300025981 Bacteria 2223
168 Ga0207658_10075552 3300025986 Bacteria 2564
169 Ga0207677_10001476 3300026023 Bacteria 12436
170 Ga0207703_10000122 3300026035 Bacteria 92656
171 Ga0207703_10001133 3300026035 Bacteria 25156
172 Ga0207639_10004642 3300026041 Bacteria 9250
173 Ga0207639_10230219 3300026041 Bacteria 1606
174 Ga0207678_10008293 3300026067 Bacteria 9157
175 Ga0207678_10085906 3300026067 Bacteria 2689
176 Ga0207678_10255190 3300026067 Bacteria 1502
177 Ga0207708_10198641 3300026075 Bacteria 1599
178 Ga0207702_10037725 3300026078 Bacteria 4046
179 Ga0207702_10180549 3300026078 Bacteria 1943
180 Ga0207648_10143527 3300026089 Bacteria 2105
181 Ga0207676_10000025 3300026095 Bacteria 261714
182 Ga0207674_10276526 3300026116 Bacteria 1627
183 Ga0207674_10328636 3300026116 Bacteria 1479
184 Ga0207683_10033041 3300026121 Bacteria 4494
185 Ga0207683_10075636 3300026121 Bacteria 2981
186 Ga0207698_10000014 3300026142 Bacteria 240703
187 Ga0207428_10027915 3300027907 Bacteria 4695
188 Ga0268266_10000029 3300028379 Bacteria 424015
189 Ga0268266_10005543 3300028379 Bacteria 11749
190 Ga0268264_10005453 3300028381 Bacteria 10779
191 Ga0265326_10012350 3300028558 Bacteria 2513
192 Ga0265319_1000863 3300028563 Bacteria 19261
193 Ga0265318_10000275 3300028577 Bacteria 43186
194 Ga0265336_10000043 3300028666 Bacteria 132135
195 Ga0265338_10000142 3300028800 Bacteria 132135
196 Ga0265338_10059335 3300028800 Bacteria 3371
197 Ga0265324_10008340 3300029957 Bacteria 4123
198 Ga0265340_10000006 3300031247 Bacteria 132135
199 Ga0265316_10172975 3300031344 Bacteria 1610
200 Ga0307409_100000912 3300031995 Bacteria 13722
201 Ga0307416_100019770 3300032002 Bacteria 4785
202 Ga0307416_100624781 3300032002 Bacteria 1159
203 Ga0307414_10102973 3300032004 Bacteria 2153
204 Ga0307411_10021729 3300032005 Bacteria 3762
205 Ga0316583_10049480 3300032133 Bacteria 1480
206 Ga0373937_0018657 3300036401 Bacteria 6198
207 Ga0373937_0046449 3300036401 Bacteria 3971
208 Ga0395899_0017947 3300037312 Bacteria 5385
209 Ga0395900_0026501 3300037418 Bacteria 5935
210 Ga0395898_0009239 3300037466 Bacteria 10370
211 Ga0395898_0146259 3300037466 Bacteria 2262
212 Ga0395905_0009415 3300037471 Bacteria 9550
213 Ga0395905_0306166 3300037471 Bacteria 1477
214 Ga0395901_0035304 3300038443 Bacteria 5165
215 Ga0395901_0107084 3300038443 Bacteria 2934
216 Ga0395901_0438821 3300038443 Bacteria 1337
217 Ga0436365_1259255 3300039437 Bacteria 1555
218 Ga0451839_1226846 3300041496 Bacteria 1660
219 Ga0466963_0000325 3300044694 Bacteria 21618
220 Ga0466963_0022656 3300044694 Bacteria 3981
221 Ga0466963_0143393 3300044694 Bacteria 1656
222 Ga0466957_0004792 3300044842 Bacteria 7572
223 Ga0466967_0055664 3300045976 Bacteria 3485
224 Ga0495592_0001496 3300046454 Bacteria 16278
225 Ga0495592_0050759 3300046454 Bacteria 3082
226 Ga0495603_0000323 3300046455 Bacteria 25798
227 Ga0495603_0000641 3300046455 Bacteria 19699
228 Ga0495603_0001557 3300046455 Bacteria 13416
229 Ga0495629_0000543 3300046459 Bacteria 31107
230 Ga0495629_0304411 3300046459 Bacteria 1091
231 Ga0495641_0000400 3300046461 Bacteria 36235
232 Ga0495641_0036780 3300046461 Bacteria 2298
233 Ga0495653_0048075 3300046463 Bacteria 3296
234 Ga0495653_0270106 3300046463 Bacteria 1120
235 Ga0495582_0000006 3300046473 Bacteria 140434
236 Ga0495582_0049289 3300046473 Bacteria 2319
237 Ga0495662_0000236 3300046476 Bacteria 23206
238 Ga0495664_0068230 3300046477 Bacteria 2122
239 Ga0495594_0058797 3300046499 Bacteria 2125
240 Ga0495608_0000010 3300046511 Bacteria 258660
241 Ga0495608_0001727 3300046511 Bacteria 15654
242 Ga0495608_0029074 3300046511 Bacteria 3752
243 Ga0495618_0000037 3300046514 Bacteria 99735
244 Ga0495620_0000668 3300046515 Bacteria 21158
245 Ga0495628_0054541 3300046516 Bacteria 3151
246 Ga0495630_0000148 3300046517 Bacteria 54619
247 Ga0495630_0010153 3300046517 Bacteria 6787
248 Ga0495652_0561348 3300046529 Bacteria 784
249 Ga0495640_0007615 3300046533 Bacteria 8511
250 Ga0495586_0001318 3300046535 Bacteria 13783
251 Ga0495621_0006342 3300046539 Bacteria 3446
252 Ga0495667_0000067 3300046559 Bacteria 81751
253 Ga0495668_0039064 3300046616 Bacteria 2650
254 Ga0495634_0000021 3300046642 Bacteria 120521
255 Ga0495634_0000993 3300046642 Bacteria 26739
256 Ga0495634_0078117 3300046642 Bacteria 2169
257 Ga0495634_0113898 3300046642 Bacteria 1737
258 Ga0495635_0000006 3300046663 Bacteria 301820
259 Ga0495657_0000005 3300046675 Bacteria 254860
260 Ga0495657_0001760 3300046675 Bacteria 18520
261 Ga0495646_0149435 3300046680 Bacteria 1300
262 Ga0495647_0000010 3300046681 Bacteria 94696
263 Ga0495647_0000114 3300046681 Bacteria 20349
264 Ga0495658_0000094 3300046683 Bacteria 46061
265 Ga0495658_0009022 3300046683 Bacteria 4957
266 Ga0495669_0000189 3300046684 Bacteria 38286
267 Ga0495669_0029938 3300046684 Bacteria 2389
268 Ga0495613_0000947 3300046689 Bacteria 22179
269 Ga0495624_0000767 3300046690 Bacteria 25280
270 Ga0495624_0033558 3300046690 Bacteria 3324
271 Ga0495670_0001585 3300046691 Bacteria 11108
272 Ga0495649_0004973 3300046694 Bacteria 8555
273 Ga0495600_0002223 3300046809 Bacteria 11043
274 Ga0495600_0006577 3300046809 Bacteria 7076
275 Ga0495600_0049377 3300046809 Bacteria 2745
276 Ga0495600_0065764 3300046809 Bacteria 2371
277 Ga0495600_0075764 3300046809 Bacteria 2197
278 Ga0495600_0098647 3300046809 Bacteria 1904
279 Ga0495604_0000294 3300047317 Bacteria 44723
280 Ga0495604_0158897 3300047317 Bacteria 1598
281 Ga0495604_0245774 3300047317 Bacteria 1221
282 Ga0495674_0057094 3300047319 Bacteria 3417
283 Ga0495674_0418409 3300047319 Bacteria 1080
284 Ga0495676_0001315 3300047321 Bacteria 21280
285 Ga0495676_0019700 3300047321 Bacteria 5931
286 Ga0495676_0108302 3300047321 Bacteria 2044
287 Ga0495680_0001684 3300047322 Bacteria 23470
288 Ga0495680_0001951 3300047322 Bacteria 21721
289 Ga0495680_0009089 3300047322 Bacteria 8968
290 Ga0495680_0090508 3300047322 Bacteria 2295
291 Ga0495675_0000398 3300047444 Bacteria 30075
292 Ga0495685_007837 3300047447 Bacteria 3533
293 Ga0495684_0357114 3300047471 Bacteria 1036
294 Ga0495593_0082616 3300047673 Bacteria 1660
295 Ga0495602_0083773 3300048088 Bacteria 2670
296 Ga0496100_0000004 3300048903 Bacteria 321778
297 Ga0496100_0001215 3300048903 Bacteria 12520
298 Ga0496101_0000007 3300048904 Bacteria 321778
299 Ga0496101_0054045 3300048904 Bacteria 2899
300 Ga0496101_0192405 3300048904 Bacteria 1575
301 Ga0496102_0000002 3300048905 Bacteria 814588
302 Ga0496102_0040338 3300048905 Bacteria 4222
303 Ga0496103_0000017 3300048906 Bacteria 244768
304 Ga0496103_0028536 3300048906 Bacteria 3387
305 Ga0496104_0000008 3300048907 Bacteria 516976
306 Ga0496104_0007889 3300048907 Bacteria 9440
307 Ga0496104_0043241 3300048907 Bacteria 4231
308 Ga0496105_0000003 3300048908 Bacteria 713251
309 Ga0496105_0000070 3300048908 Bacteria 80117
310 Ga0496105_0048654 3300048908 Bacteria 3499
311 Ga0496106_0000004 3300048909 Bacteria 279896
312 Ga0496106_0001451 3300048909 Bacteria 17805
313 Ga0496106_0269599 3300048909 Bacteria 1363
314 Ga0496107_0000001 3300048910 Bacteria 321778
315 Ga0496107_0017651 3300048910 Bacteria 5019
316 Ga0496108_0000004 3300048911 Bacteria 545055
317 Ga0496108_0000042 3300048911 Bacteria 146397
318 Ga0496108_0002451 3300048911 Bacteria 14838
319 Ga0496108_0029525 3300048911 Bacteria 4541
320 Ga0496108_0426708 3300048911 Bacteria 1158
321 Ga0496109_0000034 3300048912 Bacteria 160397
322 Ga0496109_0000036 3300048912 Bacteria 153972
323 Ga0496109_0000062 3300048912 Bacteria 112843
324 Ga0496109_0000550 3300048912 Bacteria 31748
325 Ga0496109_0023509 3300048912 Bacteria 5472
326 Ga0496109_0098120 3300048912 Bacteria 2716
327 Ga0496109_0337822 3300048912 Bacteria 1422
328 Ga0496110_0022729 3300048913 Bacteria 5328
329 Ga0496110_0032342 3300048913 Bacteria 4516
330 Ga0496110_0035533 3300048913 Bacteria 4324
331 Ga0496110_0084697 3300048913 Bacteria 2830
332 Ga0496110_0317783 3300048913 Bacteria 1418
333 Ga0496110_0755861 3300048913 Bacteria 875
334 Ga0496111_0011147 3300048914 Bacteria 6052
335 Ga0496111_0031645 3300048914 Bacteria 3769
336 Ga0496111_0103249 3300048914 Bacteria 2096
337 Ga0496111_0313388 3300048914 Bacteria 1162
338 Ga0496112_0007934 3300048915 Bacteria 9463
339 Ga0496112_0129231 3300048915 Bacteria 2497
340 Ga0496112_0797237 3300048915 Bacteria 869
341 Ga0496113_0000002 3300048916 Bacteria 220193
342 Ga0496113_0005100 3300048916 Bacteria 8158
343 Ga0496113_0056501 3300048916 Bacteria 2947
344 Ga0496113_0109492 3300048916 Bacteria 2148
345 Ga0496113_0128661 3300048916 Bacteria 1985
346 Ga0496114_0002329 3300048917 Bacteria 14462
347 Ga0496115_0000552 3300048918 Bacteria 29009
348 Ga0496115_0002589 3300048918 Bacteria 12979
349 Ga0496115_0003352 3300048918 Bacteria 11494
350 Ga0496125_0152399 3300048928 Bacteria 1585
351 Ga0501042_0034432 3300049578 Bacteria 3592
352 Ga0501067_0032866 3300049583 Bacteria 2879
353 Ga0501067_0187074 3300049583 Bacteria 1153
354 Ga0501068_0031944 3300049584 Bacteria 3129
355 Ga0501068_0239796 3300049584 Bacteria 1154
356 Ga0501069_0075522 3300049585 Bacteria 1893
357 Ga0501072_0108676 3300049588 Bacteria 2207
358 Ga0501072_0152471 3300049588 Bacteria 1843
359 Ga0501072_0264781 3300049588 Bacteria 1368
360 Ga0501073_0229684 3300049589 Bacteria 1282
361 Ga0501075_0006489 3300049591 Bacteria 8054
362 nmdc:mga0yw44_19837_c1 3300050492 Bacteria 3716
363 nmdc:mga05p37_278637_c1 3300050507 Bacteria 1995
364 nmdc:mga05p37_48909_c1 3300050507 Bacteria 5200
365 nmdc:mga06r32_32833_c1 3300050510 Bacteria 4887
366 nmdc:mga08y16_20917_c1 3300050511 Bacteria 6908
367 nmdc:mga0rr50_157804_c1 3300050513 Bacteria 1839
368 nmdc:mga0rr50_187141_c1 3300050513 Bacteria 1695
369 nmdc:mga0a205_15_c2 3300050515 Bacteria 75060
370 nmdc:mga0a205_6812_c1 3300050515 Bacteria 10339
371 Ga0495601_0003864 3300053077 Bacteria 8624
372 Ga0495601_0023616 3300053077 Bacteria 3779
373 Ga0495601_0023893 3300053077 Bacteria 3759
374 Ga0495601_0051156 3300053077 Bacteria 2608
375 Ga0495601_0085697 3300053077 Bacteria 2024
376 Ga0495612_0000820 3300053078 Bacteria 12636
377 Ga0495612_0006879 3300053078 Bacteria 4653
378 Ga0495612_0010046 3300053078 Bacteria 3829
379 Ga0495595_0000005 3300053084 Bacteria 258660
380 Ga0495595_0000422 3300053084 Bacteria 16030
381 Ga0495619_0000036 3300053085 Bacteria 125188
382 Ga0495619_0000069 3300053085 Bacteria 82755
383 Ga0495619_0000489 3300053085 Bacteria 26595
384 Ga0495619_0003847 3300053085 Bacteria 9666
385 Ga0495619_0005994 3300053085 Bacteria 7695
386 Ga0495619_0007307 3300053085 Bacteria 6996
387 Ga0495619_0014132 3300053085 Bacteria 5040
388 Ga0495619_0202458 3300053085 Bacteria 1374
389 Ga0495619_0335171 3300053085 Bacteria 1047
390 Ga0500614_004542 3300053123 Bacteria 2928
391 Ga0587075_001551 3300059644 Bacteria 2248

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048913 Ga0496110_0755861 Ga0496110_0755861_85_858 170
2 3300046461 Ga0495641_0036780 Ga0495641_0036780_1155_1976 194
3 3300009553 Ga0105249_10752656 Ga0105249_107526561 195
4 3300005329 Ga0070683_100314791 Ga0070683_1003147912 196
5 3300025917 Ga0207660_10367449 Ga0207660_103674491 196
6 3300025921 Ga0207652_10067327 Ga0207652_100673276 196
7 3300048918 Ga0496115_0002589 Ga0496115_0002589_2821_3645 196
8 3300053085 Ga0495619_0014132 Ga0495619_0014132_1138_1983 196
9 3300047322 Ga0495680_0001684 Ga0495680_0001684_8427_9308 197
10 3300009093 Ga0105240_10006736 Ga0105240_1000673614 199
11 3300025913 Ga0207695_10024364 Ga0207695_100243642 199
12 3300025916 Ga0207663_10043259 Ga0207663_100432592 199
13 3300003659 JGI25404J52841_10003670 JGI25404J52841_100036701 200
14 3300005344 Ga0070661_100000236 Ga0070661_10000023628 200
15 3300005983 Ga0081540_1000281 Ga0081540_100028155 200
16 3300013307 Ga0157372_10085083 Ga0157372_100850837 200
17 3300048912 Ga0496109_0098120 Ga0496109_0098120_422_1336 200
18 3300005337 Ga0070682_100000032 Ga0070682_100000032162 201
19 3300005338 Ga0068868_100008360 Ga0068868_1000083603 201
20 3300005354 Ga0070675_100003153 Ga0070675_1000031531 201
21 3300026078 Ga0207702_10037725 Ga0207702_100377259 201
22 3300028800 Ga0265338_10059335 Ga0265338_100593355 201
23 3300037312 Ga0395899_0017947 Ga0395899_0017947_4126_4929 201
24 3300037418 Ga0395900_0026501 Ga0395900_0026501_3883_4686 201
25 3300037466 Ga0395898_0009239 Ga0395898_0009239_6928_7731 201
26 3300037471 Ga0395905_0009415 Ga0395905_0009415_6882_7685 201
27 3300046454 Ga0495592_0001496 Ga0495592_0001496_8542_9417 201
28 3300046529 Ga0495652_0561348 Ga0495652_0561348_23_649 201
29 3300046809 Ga0495600_0049377 Ga0495600_0049377_1212_1838 201
30 3300048905 Ga0496102_0000002 Ga0496102_0000002_641664_642290 201
31 3300048906 Ga0496103_0000017 Ga0496103_0000017_234881_235507 201
32 3300053077 Ga0495601_0051156 Ga0495601_0051156_1173_1799 201
33 3300059644 Ga0587075_001551 Ga0587075_001551_297_923 201
34 3300005329 Ga0070683_100011264 Ga0070683_10001126412 202
35 3300005329 Ga0070683_100029181 Ga0070683_1000291816 202
36 3300005338 Ga0068868_100003492 Ga0068868_1000034926 202
37 3300005365 Ga0070688_100001088 Ga0070688_10000108817 202
38 3300005366 Ga0070659_100020922 Ga0070659_1000209229 202
39 3300005466 Ga0070685_10010414 Ga0070685_100104147 202
40 3300005548 Ga0070665_100015972 Ga0070665_1000159728 202
41 3300005842 Ga0068858_100000287 Ga0068858_10000028723 202
42 3300005985 Ga0081539_10015309 Ga0081539_100153096 202
43 3300006852 Ga0075433_10004429 Ga0075433_100044296 202
44 3300009098 Ga0105245_10028801 Ga0105245_100288017 202
45 3300025919 Ga0207657_10175735 Ga0207657_101757353 202
46 3300025926 Ga0207659_10000138 Ga0207659_1000013842 202
47 3300025927 Ga0207687_10002690 Ga0207687_100026909 202
48 3300025932 Ga0207690_10012718 Ga0207690_100127183 202
49 3300025939 Ga0207665_10150128 Ga0207665_101501282 202
50 3300025941 Ga0207711_10000011 Ga0207711_1000001135 202
51 3300025944 Ga0207661_10000616 Ga0207661_1000061626 202
52 3300025945 Ga0207679_10014248 Ga0207679_100142482 202
53 3300026035 Ga0207703_10000122 Ga0207703_1000012288 202
54 3300028379 Ga0268266_10005543 Ga0268266_100055439 202
55 3300041496 Ga0451839_1226846 Ga0451839_1226846_700_1521 202
56 3300046463 Ga0495653_0048075 Ga0495653_0048075_372_1187 202
57 3300046511 Ga0495608_0029074 Ga0495608_0029074_1326_2141 202
58 3300048903 Ga0496100_0001215 Ga0496100_0001215_2727_3740 202
59 3300048907 Ga0496104_0043241 Ga0496104_0043241_801_1622 202
60 3300048908 Ga0496105_0000070 Ga0496105_0000070_60436_61257 202
61 3300048918 Ga0496115_0003352 Ga0496115_0003352_7522_8514 202
62 3300050515 nmdc:mga0a205_15_c2 nmdc:mga0a205_15_c2_21794_22621 202
63 3300053077 Ga0495601_0023893 Ga0495601_0023893_2881_3702 202
64 3300053085 Ga0495619_0003847 Ga0495619_0003847_1630_2442 202
65 3300053085 Ga0495619_0005994 Ga0495619_0005994_6011_6820 202
66 3300005336 Ga0070680_100720111 Ga0070680_1007201111 203
67 3300005356 Ga0070674_100000021 Ga0070674_10000002177 203
68 3300005718 Ga0068866_10000007 Ga0068866_1000000725 203
69 3300025899 Ga0207642_10000008 Ga0207642_1000000834 203
70 3300025937 Ga0207669_10000032 Ga0207669_1000003277 203
71 3300046642 Ga0495634_0078117 Ga0495634_0078117_231_1040 203
72 3300047319 Ga0495674_0418409 Ga0495674_0418409_112_921 203
73 3300047471 Ga0495684_0357114 Ga0495684_0357114_39_848 203
74 3300053077 Ga0495601_0023616 Ga0495601_0023616_1822_2631 203
75 3300053085 Ga0495619_0007307 Ga0495619_0007307_2309_3118 203
76 3300053085 Ga0495619_0202458 Ga0495619_0202458_213_1022 203
77 3300005329 Ga0070683_100057365 Ga0070683_1000573655 204
78 3300005343 Ga0070687_100153253 Ga0070687_1001532533 204
79 3300005455 Ga0070663_100016523 Ga0070663_1000165236 204
80 3300005458 Ga0070681_10087446 Ga0070681_100874464 204
81 3300005530 Ga0070679_100000832 Ga0070679_10000083224 204
82 3300005577 Ga0068857_100258206 Ga0068857_1002582061 204
83 3300005578 Ga0068854_100000939 Ga0068854_10000093924 204
84 3300005616 Ga0068852_100082661 Ga0068852_1000826616 204
85 3300010375 Ga0105239_10519462 Ga0105239_105194621 204
86 3300013102 Ga0157371_10017630 Ga0157371_100176302 204
87 3300013102 Ga0157371_10186859 Ga0157371_101868592 204
88 3300013297 Ga0157378_10027572 Ga0157378_100275729 204
89 3300013307 Ga0157372_10000809 Ga0157372_1000080915 204
90 3300025912 Ga0207707_10410384 Ga0207707_104103843 204
91 3300025921 Ga0207652_10000242 Ga0207652_1000024216 204
92 3300025921 Ga0207652_10000666 Ga0207652_1000066638 204
93 3300025929 Ga0207664_10301840 Ga0207664_103018401 204
94 3300025944 Ga0207661_10039225 Ga0207661_100392255 204
95 3300025981 Ga0207640_10000821 Ga0207640_100008213 204
96 3300026023 Ga0207677_10001476 Ga0207677_1000147613 204
97 3300026067 Ga0207678_10008293 Ga0207678_1000829310 204
98 3300026067 Ga0207678_10255190 Ga0207678_102551903 204
99 3300038443 Ga0395901_0035304 Ga0395901_0035304_1016_1864 204
100 3300044842 Ga0466957_0004792 Ga0466957_0004792_6360_7169 204
101 3300046459 Ga0495629_0000543 Ga0495629_0000543_12062_12871 204
102 3300047673 Ga0495593_0082616 Ga0495593_0082616_19_825 204
103 3300048913 Ga0496110_0317783 Ga0496110_0317783_130_945 204
104 3300049588 Ga0501072_0152471 Ga0501072_0152471_240_1016 204
105 3300002074 JGI24748J21848_1001781 JGI24748J21848_10017814 205
106 3300002239 JGI24034J26672_10000068 JGI24034J26672_1000006815 205
107 3300005335 Ga0070666_10373661 Ga0070666_103736612 205
108 3300005341 Ga0070691_10270252 Ga0070691_102702521 205
109 3300005436 Ga0070713_100000171 Ga0070713_10000017146 205
110 3300005535 Ga0070684_100010065 Ga0070684_1000100657 205
111 3300005535 Ga0070684_100250525 Ga0070684_1002505252 205
112 3300005564 Ga0070664_100057724 Ga0070664_1000577246 205
113 3300005616 Ga0068852_100001042 Ga0068852_1000010426 205
114 3300005840 Ga0068870_10182399 Ga0068870_101823993 205
115 3300006163 Ga0070715_10000003 Ga0070715_10000003251 205
116 3300006175 Ga0070712_100003252 Ga0070712_1000032528 205
117 3300006881 Ga0068865_100000056 Ga0068865_1000000566 205
118 3300009148 Ga0105243_10157495 Ga0105243_101574954 205
119 3300009177 Ga0105248_10001735 Ga0105248_1000173514 205
120 3300010375 Ga0105239_10142086 Ga0105239_101420862 205
121 3300014326 Ga0157380_10000560 Ga0157380_100005609 205
122 3300025905 Ga0207685_10000003 Ga0207685_10000003248 205
123 3300025908 Ga0207643_10078853 Ga0207643_100788532 205
124 3300025915 Ga0207693_10001647 Ga0207693_100016476 205
125 3300025928 Ga0207700_10000019 Ga0207700_10000019184 205
126 3300025935 Ga0207709_10018859 Ga0207709_100188594 205
127 3300025938 Ga0207704_10000308 Ga0207704_1000030823 205
128 3300025944 Ga0207661_10000518 Ga0207661_100005187 205
129 3300025944 Ga0207661_10147618 Ga0207661_101476183 205
130 3300025949 Ga0207667_10065417 Ga0207667_100654173 205
131 3300026041 Ga0207639_10004642 Ga0207639_100046424 205
132 3300026041 Ga0207639_10230219 Ga0207639_102302193 205
133 3300026116 Ga0207674_10276526 Ga0207674_102765262 205
134 3300026142 Ga0207698_10000014 Ga0207698_1000001453 205
135 3300044694 Ga0466963_0143393 Ga0466963_0143393_477_1286 205
136 3300046511 Ga0495608_0000010 Ga0495608_0000010_241259_242062 205
137 3300046642 Ga0495634_0000993 Ga0495634_0000993_11160_11981 205
138 3300046675 Ga0495657_0000005 Ga0495657_0000005_12799_13602 205
139 3300046683 Ga0495658_0009022 Ga0495658_0009022_1926_2735 205
140 3300046809 Ga0495600_0006577 Ga0495600_0006577_3992_4798 205
141 3300047444 Ga0495675_0000398 Ga0495675_0000398_8977_9780 205
142 3300048911 Ga0496108_0002451 Ga0496108_0002451_12060_12866 205
143 3300048911 Ga0496108_0426708 Ga0496108_0426708_313_1131 205
144 3300048912 Ga0496109_0000062 Ga0496109_0000062_14625_15431 205
145 3300048912 Ga0496109_0000550 Ga0496109_0000550_15922_16770 205
146 3300048912 Ga0496109_0337822 Ga0496109_0337822_471_1289 205
147 3300048913 Ga0496110_0035533 Ga0496110_0035533_725_1543 205
148 3300048914 Ga0496111_0011147 Ga0496111_0011147_1732_2550 205
149 3300048914 Ga0496111_0313388 Ga0496111_0313388_197_1012 205
150 3300048915 Ga0496112_0007934 Ga0496112_0007934_6703_7509 205
151 3300048915 Ga0496112_0797237 Ga0496112_0797237_10_828 205
152 3300048916 Ga0496113_0000002 Ga0496113_0000002_17975_18781 205
153 3300048916 Ga0496113_0128661 Ga0496113_0128661_898_1707 205
154 3300049588 Ga0501072_0108676 Ga0501072_0108676_1354_2169 205
155 3300053078 Ga0495612_0010046 Ga0495612_0010046_1940_2746 205
156 3300053084 Ga0495595_0000005 Ga0495595_0000005_16599_17402 205
157 3300053085 Ga0495619_0000069 Ga0495619_0000069_66668_67471 205
158 3300053085 Ga0495619_0000489 Ga0495619_0000489_16818_17621 205
159 3300053085 Ga0495619_0335171 Ga0495619_0335171_186_1007 205
160 3300005329 Ga0070683_100111442 Ga0070683_1001114425 206
161 3300005456 Ga0070678_100355501 Ga0070678_1003555012 206
162 3300005614 Ga0068856_100190874 Ga0068856_1001908744 206
163 3300005834 Ga0068851_10012553 Ga0068851_100125536 206
164 3300006038 Ga0075365_10013680 Ga0075365_100136807 206
165 3300009094 Ga0111539_10042463 Ga0111539_1004246310 206
166 3300009147 Ga0114129_10007041 Ga0114129_1000704116 206
167 3300009147 Ga0114129_10234549 Ga0114129_102345493 206
168 3300009174 Ga0105241_10137178 Ga0105241_101371784 206
169 3300010375 Ga0105239_10458491 Ga0105239_104584911 206
170 3300013297 Ga0157378_10026190 Ga0157378_100261909 206
171 3300014326 Ga0157380_10000808 Ga0157380_1000080823 206
172 3300017792 Ga0163161_10217529 Ga0163161_102175292 206
173 3300025321 Ga0207656_10001048 Ga0207656_1000104812 206
174 3300025915 Ga0207693_10009704 Ga0207693_1000970411 206
175 3300025916 Ga0207663_10030357 Ga0207663_100303573 206
176 3300026078 Ga0207702_10180549 Ga0207702_101805494 206
177 3300026095 Ga0207676_10000025 Ga0207676_1000002536 206
178 3300026116 Ga0207674_10328636 Ga0207674_103286362 206
179 3300027907 Ga0207428_10027915 Ga0207428_100279153 206
180 3300028558 Ga0265326_10012350 Ga0265326_100123504 206
181 3300028563 Ga0265319_1000863 Ga0265319_100086316 206
182 3300028577 Ga0265318_10000275 Ga0265318_1000027522 206
183 3300028666 Ga0265336_10000043 Ga0265336_10000043113 206
184 3300028800 Ga0265338_10000142 Ga0265338_1000014236 206
185 3300029957 Ga0265324_10008340 Ga0265324_100083404 206
186 3300031247 Ga0265340_10000006 Ga0265340_10000006113 206
187 3300031344 Ga0265316_10172975 Ga0265316_101729753 206
188 3300032002 Ga0307416_100019770 Ga0307416_10001977010 206
189 3300044694 Ga0466963_0022656 Ga0466963_0022656_907_1713 206
190 3300045976 Ga0466967_0055664 Ga0466967_0055664_627_1433 206
191 3300046454 Ga0495592_0050759 Ga0495592_0050759_717_1532 206
192 3300046476 Ga0495662_0000236 Ga0495662_0000236_8529_9347 206
193 3300046477 Ga0495664_0068230 Ga0495664_0068230_1056_1862 206
194 3300046517 Ga0495630_0000148 Ga0495630_0000148_46241_47050 206
195 3300046533 Ga0495640_0007615 Ga0495640_0007615_2162_2980 206
196 3300046680 Ga0495646_0149435 Ga0495646_0149435_69_872 206
197 3300046681 Ga0495647_0000114 Ga0495647_0000114_12464_13273 206
198 3300047317 Ga0495604_0000294 Ga0495604_0000294_16029_16862 206
199 3300047319 Ga0495674_0057094 Ga0495674_0057094_1829_2632 206
200 3300048911 Ga0496108_0000042 Ga0496108_0000042_120582_121391 206
201 3300048912 Ga0496109_0000034 Ga0496109_0000034_153221_154030 206
202 3300048913 Ga0496110_0022729 Ga0496110_0022729_1831_2637 206
203 3300048914 Ga0496111_0103249 Ga0496111_0103249_370_1176 206
204 3300048928 Ga0496125_0152399 Ga0496125_0152399_58_867 206
205 3300050492 nmdc:mga0yw44_19837_c1 nmdc:mga0yw44_19837_c1_1693_2505 206
206 3300050507 nmdc:mga05p37_278637_c1 nmdc:mga05p37_278637_c1_256_1059 206
207 3300050507 nmdc:mga05p37_48909_c1 nmdc:mga05p37_48909_c1_42_827 206
208 3300050511 nmdc:mga08y16_20917_c1 nmdc:mga08y16_20917_c1_4838_5623 206
209 3300053077 Ga0495601_0085697 Ga0495601_0085697_797_1600 206
210 3300053078 Ga0495612_0000820 Ga0495612_0000820_4178_4981 206
211 3300005457 Ga0070662_100000007 Ga0070662_10000000738 207
212 3300005843 Ga0068860_100020469 Ga0068860_1000204698 207
213 3300009176 Ga0105242_10066186 Ga0105242_100661865 207
214 3300013296 Ga0157374_10015098 Ga0157374_100150986 207
215 3300017792 Ga0163161_10000013 Ga0163161_10000013163 207
216 3300025901 Ga0207688_10098651 Ga0207688_100986512 207
217 3300025933 Ga0207706_10000018 Ga0207706_10000018147 207
218 3300025934 Ga0207686_10007328 Ga0207686_100073285 207
219 3300028381 Ga0268264_10005453 Ga0268264_1000545315 207
220 3300037471 Ga0395905_0306166 Ga0395905_0306166_497_1327 207
221 3300046681 Ga0495647_0000010 Ga0495647_0000010_85364_86185 207
222 3300046684 Ga0495669_0029938 Ga0495669_0029938_567_1385 207
223 3300049588 Ga0501072_0264781 Ga0501072_0264781_313_1125 207
224 3300005455 Ga0070663_100108315 Ga0070663_1001083151 208
225 3300005981 Ga0081538_10000208 Ga0081538_1000020853 208
226 3300006051 Ga0075364_10022923 Ga0075364_100229236 208
227 3300006175 Ga0070712_100015964 Ga0070712_1000159647 208
228 3300009098 Ga0105245_10006370 Ga0105245_1000637013 208
229 3300009553 Ga0105249_10000181 Ga0105249_1000018183 208
230 3300025927 Ga0207687_10000132 Ga0207687_1000013241 208
231 3300025961 Ga0207712_10000067 Ga0207712_1000006763 208
232 3300026067 Ga0207678_10085906 Ga0207678_100859064 208
233 3300031995 Ga0307409_100000912 Ga0307409_10000091215 208
234 3300032002 Ga0307416_100624781 Ga0307416_1006247812 208
235 3300032004 Ga0307414_10102973 Ga0307414_101029733 208
236 3300032005 Ga0307411_10021729 Ga0307411_100217296 208
237 3300036401 Ga0373937_0018657 Ga0373937_0018657_5082_5909 208
238 3300038443 Ga0395901_0107084 Ga0395901_0107084_388_1221 208
239 3300038443 Ga0395901_0438821 Ga0395901_0438821_307_1110 208
240 3300046455 Ga0495603_0000323 Ga0495603_0000323_10000_10818 208
241 3300046515 Ga0495620_0000668 Ga0495620_0000668_5835_6665 208
242 3300046516 Ga0495628_0054541 Ga0495628_0054541_1277_2101 208
243 3300046616 Ga0495668_0039064 Ga0495668_0039064_1358_2179 208
244 3300046642 Ga0495634_0000021 Ga0495634_0000021_100718_101575 208
245 3300046642 Ga0495634_0113898 Ga0495634_0113898_77_901 208
246 3300046809 Ga0495600_0002223 Ga0495600_0002223_826_1650 208
247 3300046809 Ga0495600_0075764 Ga0495600_0075764_647_1465 208
248 3300046809 Ga0495600_0098647 Ga0495600_0098647_32_856 208
249 3300047321 Ga0495676_0108302 Ga0495676_0108302_905_1723 208
250 3300048903 Ga0496100_0000004 Ga0496100_0000004_311657_312481 208
251 3300048904 Ga0496101_0000007 Ga0496101_0000007_311657_312481 208
252 3300048909 Ga0496106_0000004 Ga0496106_0000004_273071_273895 208
253 3300048909 Ga0496106_0269599 Ga0496106_0269599_181_981 208
254 3300048910 Ga0496107_0000001 Ga0496107_0000001_311657_312481 208
255 3300048913 Ga0496110_0084697 Ga0496110_0084697_1342_2166 208
256 3300005336 Ga0070680_100052802 Ga0070680_1000528024 209
257 3300005530 Ga0070679_100000190 Ga0070679_1000001907 209
258 3300005614 Ga0068856_100898167 Ga0068856_1008981672 209
259 3300013308 Ga0157375_10216680 Ga0157375_102166802 209
260 3300026121 Ga0207683_10075636 Ga0207683_100756363 209
261 3300046455 Ga0495603_0000641 Ga0495603_0000641_2013_2831 209
262 3300046514 Ga0495618_0000037 Ga0495618_0000037_34607_35431 209
263 3300046663 Ga0495635_0000006 Ga0495635_0000006_76626_77483 209
264 3300046690 Ga0495624_0000767 Ga0495624_0000767_16061_16882 209
265 3300046694 Ga0495649_0004973 Ga0495649_0004973_1839_2663 209
266 3300047322 Ga0495680_0001951 Ga0495680_0001951_5851_6675 209
267 3300047447 Ga0495685_007837 Ga0495685_007837_777_1607 209
268 3300048916 Ga0496113_0056501 Ga0496113_0056501_310_1134 209
269 3300053078 Ga0495612_0006879 Ga0495612_0006879_1741_2565 209
270 3300005337 Ga0070682_100000009 Ga0070682_100000009286 210
271 3300005355 Ga0070671_100342260 Ga0070671_1003422601 210
272 3300005356 Ga0070674_100028843 Ga0070674_1000288436 210
273 3300005364 Ga0070673_100153513 Ga0070673_1001535134 210
274 3300005365 Ga0070688_100257062 Ga0070688_1002570622 210
275 3300005438 Ga0070701_10037759 Ga0070701_100377592 210
276 3300005439 Ga0070711_100015775 Ga0070711_1000157754 210
277 3300005456 Ga0070678_100160159 Ga0070678_1001601594 210
278 3300005468 Ga0070707_100624608 Ga0070707_1006246082 210
279 3300005539 Ga0068853_100011462 Ga0068853_1000114623 210
280 3300005547 Ga0070693_100136368 Ga0070693_1001363682 210
281 3300005549 Ga0070704_100056970 Ga0070704_1000569702 210
282 3300005983 Ga0081540_1000553 Ga0081540_100055333 210
283 3300006175 Ga0070712_100022193 Ga0070712_1000221937 210
284 3300009098 Ga0105245_10015882 Ga0105245_100158829 210
285 3300009148 Ga0105243_10595401 Ga0105243_105954011 210
286 3300009176 Ga0105242_10058287 Ga0105242_100582874 210
287 3300013308 Ga0157375_10243844 Ga0157375_102438443 210
288 3300025901 Ga0207688_10023171 Ga0207688_100231714 210
289 3300025910 Ga0207684_10565102 Ga0207684_105651022 210
290 3300025915 Ga0207693_10026245 Ga0207693_100262458 210
291 3300025916 Ga0207663_10068382 Ga0207663_100683823 210
292 3300025927 Ga0207687_10154525 Ga0207687_101545252 210
293 3300025934 Ga0207686_10040728 Ga0207686_100407285 210
294 3300025936 Ga0207670_10043686 Ga0207670_100436864 210
295 3300026075 Ga0207708_10198641 Ga0207708_101986412 210
296 3300026089 Ga0207648_10143527 Ga0207648_101435273 210
297 3300026121 Ga0207683_10033041 Ga0207683_100330413 210
298 3300032133 Ga0316583_10049480 Ga0316583_100494803 210
299 3300036401 Ga0373937_0046449 Ga0373937_0046449_2759_3574 210
300 3300037466 Ga0395898_0146259 Ga0395898_0146259_1004_1834 210
301 3300044694 Ga0466963_0000325 Ga0466963_0000325_6020_6886 210
302 3300046455 Ga0495603_0001557 Ga0495603_0001557_11942_12748 210
303 3300046459 Ga0495629_0304411 Ga0495629_0304411_11_832 210
304 3300046461 Ga0495641_0000400 Ga0495641_0000400_6217_7044 210
305 3300046473 Ga0495582_0049289 Ga0495582_0049289_202_1008 210
306 3300046499 Ga0495594_0058797 Ga0495594_0058797_425_1231 210
307 3300046535 Ga0495586_0001318 Ga0495586_0001318_2269_3093 210
308 3300046675 Ga0495657_0001760 Ga0495657_0001760_8413_9279 210
309 3300046689 Ga0495613_0000947 Ga0495613_0000947_12439_13305 210
310 3300046809 Ga0495600_0065764 Ga0495600_0065764_12_827 210
311 3300047317 Ga0495604_0158897 Ga0495604_0158897_714_1529 210
312 3300047317 Ga0495604_0245774 Ga0495604_0245774_286_1110 210
313 3300047321 Ga0495676_0001315 Ga0495676_0001315_5915_6742 210
314 3300047321 Ga0495676_0019700 Ga0495676_0019700_3997_4803 210
315 3300047322 Ga0495680_0090508 Ga0495680_0090508_1265_2080 210
316 3300048904 Ga0496101_0054045 Ga0496101_0054045_1198_2004 210
317 3300048905 Ga0496102_0040338 Ga0496102_0040338_2120_2926 210
318 3300048906 Ga0496103_0028536 Ga0496103_0028536_602_1408 210
319 3300048907 Ga0496104_0000008 Ga0496104_0000008_485539_486366 210
320 3300048907 Ga0496104_0007889 Ga0496104_0007889_7690_8496 210
321 3300048908 Ga0496105_0000003 Ga0496105_0000003_485539_486366 210
322 3300048908 Ga0496105_0048654 Ga0496105_0048654_2398_3204 210
323 3300048909 Ga0496106_0001451 Ga0496106_0001451_6690_7496 210
324 3300048910 Ga0496107_0017651 Ga0496107_0017651_781_1587 210
325 3300048911 Ga0496108_0000004 Ga0496108_0000004_71415_72242 210
326 3300048911 Ga0496108_0029525 Ga0496108_0029525_12_818 210
327 3300048912 Ga0496109_0000036 Ga0496109_0000036_81731_82558 210
328 3300048912 Ga0496109_0023509 Ga0496109_0023509_3452_4258 210
329 3300048913 Ga0496110_0032342 Ga0496110_0032342_1288_2094 210
330 3300048914 Ga0496111_0031645 Ga0496111_0031645_2019_2825 210
331 3300048915 Ga0496112_0129231 Ga0496112_0129231_1370_2176 210
332 3300048916 Ga0496113_0005100 Ga0496113_0005100_1360_2223 210
333 3300048916 Ga0496113_0109492 Ga0496113_0109492_1173_1979 210
334 3300048917 Ga0496114_0002329 Ga0496114_0002329_3332_4138 210
335 3300048918 Ga0496115_0000552 Ga0496115_0000552_22874_23680 210
336 3300049578 Ga0501042_0034432 Ga0501042_0034432_1410_2210 210
337 3300049589 Ga0501073_0229684 Ga0501073_0229684_456_1262 210
338 3300053077 Ga0495601_0003864 Ga0495601_0003864_5821_6645 210
339 3300053085 Ga0495619_0000036 Ga0495619_0000036_87094_87909 210
340 3300053123 Ga0500614_004542 Ga0500614_004542_843_1670 210
341 3300005333 Ga0070677_10001062 Ga0070677_100010623 211
342 3300005364 Ga0070673_100003060 Ga0070673_10000306011 211
343 3300005439 Ga0070711_100100576 Ga0070711_1001005761 211
344 3300005548 Ga0070665_100000022 Ga0070665_100000022394 211
345 3300005578 Ga0068854_100101542 Ga0068854_1001015423 211
346 3300005842 Ga0068858_100000150 Ga0068858_10000015023 211
347 3300005937 Ga0081455_10084872 Ga0081455_100848724 211
348 3300005937 Ga0081455_10190979 Ga0081455_101909793 211
349 3300006844 Ga0075428_100046826 Ga0075428_1000468263 211
350 3300006847 Ga0075431_100008449 Ga0075431_1000084499 211
351 3300006852 Ga0075433_10050753 Ga0075433_100507536 211
352 3300006871 Ga0075434_100394740 Ga0075434_1003947402 211
353 3300006914 Ga0075436_100335086 Ga0075436_1003350862 211
354 3300009098 Ga0105245_10000022 Ga0105245_10000022177 211
355 3300025893 Ga0207682_10000008 Ga0207682_1000000814 211
356 3300025927 Ga0207687_10000039 Ga0207687_1000003957 211
357 3300025960 Ga0207651_10000746 Ga0207651_1000074613 211
358 3300025981 Ga0207640_10080579 Ga0207640_100805794 211
359 3300026035 Ga0207703_10001133 Ga0207703_1000113323 211
360 3300028379 Ga0268266_10000029 Ga0268266_1000002961 211
361 3300039437 Ga0436365_1259255 Ga0436365_1259255_399_1214 211
362 3300046463 Ga0495653_0270106 Ga0495653_0270106_128_988 211
363 3300046511 Ga0495608_0001727 Ga0495608_0001727_8489_9313 211
364 3300046517 Ga0495630_0010153 Ga0495630_0010153_2177_3037 211
365 3300046539 Ga0495621_0006342 Ga0495621_0006342_1220_2092 211
366 3300046559 Ga0495667_0000067 Ga0495667_0000067_47072_47914 211
367 3300046684 Ga0495669_0000189 Ga0495669_0000189_6425_7255 211
368 3300047322 Ga0495680_0009089 Ga0495680_0009089_6396_7238 211
369 3300048904 Ga0496101_0192405 Ga0496101_0192405_172_969 211
370 3300049583 Ga0501067_0187074 Ga0501067_0187074_12_809 211
371 3300049584 Ga0501068_0239796 Ga0501068_0239796_184_981 211
372 3300050510 nmdc:mga06r32_32833_c1 nmdc:mga06r32_32833_c1_1719_2537 211
373 3300050513 nmdc:mga0rr50_157804_c1 nmdc:mga0rr50_157804_c1_309_1106 211
374 3300050513 nmdc:mga0rr50_187141_c1 nmdc:mga0rr50_187141_c1_196_996 211
375 3300053084 Ga0495595_0000422 Ga0495595_0000422_8670_9494 211
376 3300001977 JGI24746J21847_1000007 JGI24746J21847_100000717 212
377 3300005329 Ga0070683_100002370 Ga0070683_1000023703 212
378 3300005937 Ga0081455_10042541 Ga0081455_100425414 212
379 3300006852 Ga0075433_10072875 Ga0075433_100728752 212
380 3300025944 Ga0207661_10007648 Ga0207661_100076483 212
381 3300025986 Ga0207658_10075552 Ga0207658_100755525 212
382 3300046473 Ga0495582_0000006 Ga0495582_0000006_37399_38265 212
383 3300046683 Ga0495658_0000094 Ga0495658_0000094_8473_9339 212
384 3300046690 Ga0495624_0033558 Ga0495624_0033558_1096_1956 212
385 3300046691 Ga0495670_0001585 Ga0495670_0001585_1459_2322 212
386 3300048088 Ga0495602_0083773 Ga0495602_0083773_31_912 212
387 3300049583 Ga0501067_0032866 Ga0501067_0032866_1191_2021 212
388 3300049584 Ga0501068_0031944 Ga0501068_0031944_377_1207 212
389 3300049585 Ga0501069_0075522 Ga0501069_0075522_343_1173 212
390 3300049591 Ga0501075_0006489 Ga0501075_0006489_4874_5698 212
391 3300050515 nmdc:mga0a205_6812_c1 nmdc:mga0a205_6812_c1_7470_8288 212

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00281

Ribosomal_L5

Ribosomal protein L5

36

92

0.99

PF00673

Ribosomal_L5_C

ribosomal L5P family C-terminus

96

189

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ns4-assembly1.cif.gz_A crystal structures of cy3 cyanine fluorophores stacked onto the end of double-stranded rna 0.9697 15 189
5ns3-assembly1.cif.gz_A crystal structures of cy5 cyanine fluorophores stacked onto the end of double-stranded rna 0.9606 15 189
5ns3-assembly1.cif.gz_B crystal structures of cy5 cyanine fluorophores stacked onto the end of double-stranded rna 0.9535 15 189
5ns4-assembly2.cif.gz_B crystal structures of cy3 cyanine fluorophores stacked onto the end of double-stranded rna 0.9443 15 189
5ns4-assembly1.cif.gz_A crystal structures of cy3 cyanine fluorophores stacked onto the end of double-stranded rna 0.9421 15 189
ID Description Score Start End Superfamily
4warF00 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.8669 15 189 3.30.1440.10
4warF00 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.8529 15 189 3.30.1440.10
af_P36519_120_288_3.30.1440.10 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.834 34 189 3.30.1440.10
af_A0A1D8PHY2_119_286_3.30.1440.10 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.8335 34 191 3.30.1440.10
1vx7G00 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.8095 38 171 3.30.1440.10
ID Description Score Start End GO Terms
AF-A0A538J4T4-F1-model_v4 50S ribosomal protein L5 0.9009 8 195 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A1Q6V1V9-F1-model_v4 Large ribosomal subunit protein uL5 0.8934 16 191 GO:0000049
GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A3A4NVN9-F1-model_v4 Large ribosomal subunit protein uL5 0.8925 15 190 GO:0000049
GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A0S8H7H6-F1-model_v4 Large ribosomal subunit protein uL5 0.8913 14 191 GO:0000049
GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A7C3Z6P9-F1-model_v4 Large ribosomal subunit protein uL5 0.8908 14 191 GO:0000049
GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Feature Viewer

pLDDT pTM Quality
74.66 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map