F431935

General Info

Members Datasets Scaffolds Average Seq Length
391 185 782 129

Family's Representative Sequence

Representative Sequence 3300005340|Ga0070689_100000752|Ga0070689_1000007527
Length 136
Sequence VTARIEHVALWARDIEAVAAFYARWFGARVGERYENARKGFASRFLEFGDGARLEVMSRTDVGARGAPNPQGSEQLGFAHVAIAVGDEAAVDALAARLRAAGIELADGPRRTGDGYYECVVRDPEGNRVEVTAGRI

Samples

Sample ID Description Type Environment
1 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
79 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
121 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
122 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
125 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
126 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
127 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
128 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
129 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
137 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
139 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
140 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
141 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
142 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
143 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
144 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
145 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
146 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
147 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
148 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
149 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
150 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
151 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
152 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
153 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
154 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
155 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
156 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
157 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
158 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
159 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
160 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
161 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
162 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
163 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
164 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
165 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
166 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
167 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
168 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
169 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
170 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
171 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
172 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
173 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
174 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
182 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
183 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.51
Nodule 0
Rhizoplane 3.32
Rhizosphere 92.84
Stem 0
Stem Tuber 0
Unclassified 22.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070689_100000752 3300005340 Bacteria 19801
2 rootL2_10027230 3300003322 Unclassified 1270
3 rootL2_10030789 3300003322 Bacteria 3452
4 rootL2_10041458 3300003322 Unclassified 1269
5 rootH1_10033307 3300003323 Bacteria 1064
6 Ga0070676_10011401 3300005328 Bacteria 4834
7 Ga0070676_10377113 3300005328 Bacteria 981
8 Ga0070676_10386966 3300005328 Bacteria 970
9 Ga0070676_11067368 3300005328 Bacteria 609
10 Ga0070690_100998869 3300005330 Unclassified 659
11 Ga0070670_100080631 3300005331 Bacteria 2797
12 Ga0070670_100116765 3300005331 Unclassified 2301
13 Ga0070670_100531512 3300005331 Bacteria 1048
14 Ga0070670_101916625 3300005331 Unclassified 546
15 Ga0070677_10002267 3300005333 Bacteria 6132
16 Ga0070677_10038911 3300005333 Unclassified 1863
17 Ga0070677_10397963 3300005333 Bacteria 725
18 Ga0068869_100101258 3300005334 Unclassified 2179
19 Ga0070682_100243057 3300005337 Bacteria 1293
20 Ga0068868_100273525 3300005338 Bacteria 1427
21 Ga0068868_100440225 3300005338 Bacteria 1132
22 Ga0070691_10127786 3300005341 Bacteria 1285
23 Ga0070691_10475302 3300005341 Bacteria 718
24 Ga0070687_100250441 3300005343 Bacteria 1100
25 Ga0070661_100598621 3300005344 Bacteria 891
26 Ga0070692_10870816 3300005345 Unclassified 620
27 Ga0070692_11116205 3300005345 Bacteria 557
28 Ga0070668_100004535 3300005347 Bacteria 10306
29 Ga0070668_100171157 3300005347 Unclassified 1768
30 Ga0070668_100480060 3300005347 Bacteria 1073
31 Ga0070669_100052439 3300005353 Bacteria 2984
32 Ga0070669_100131800 3300005353 Unclassified 1919
33 Ga0070675_100028804 3300005354 Unclassified 4473
34 Ga0070675_100033817 3300005354 Bacteria 4146
35 Ga0070675_100069717 3300005354 Bacteria 2913
36 Ga0070675_100235463 3300005354 Bacteria 1599
37 Ga0070675_101102682 3300005354 Bacteria 730
38 Ga0070674_100046562 3300005356 Bacteria 2968
39 Ga0070674_100085706 3300005356 Bacteria 2261
40 Ga0070674_100100149 3300005356 Bacteria 2109
41 Ga0070674_100157674 3300005356 Unclassified 1719
42 Ga0070673_100118734 3300005364 Unclassified 2202
43 Ga0070673_100846452 3300005364 Bacteria 846
44 Ga0070688_100855094 3300005365 Unclassified 715
45 Ga0070659_101206000 3300005366 Bacteria 669
46 Ga0070667_100456756 3300005367 Bacteria 1168
47 Ga0070667_101473158 3300005367 Unclassified 639
48 Ga0070701_10007084 3300005438 Bacteria 4763
49 Ga0070701_10037342 3300005438 Bacteria 2452
50 Ga0070701_10165610 3300005438 Unclassified 1284
51 Ga0070705_100020122 3300005440 Bacteria 3526
52 Ga0070705_100326347 3300005440 Unclassified 1110
53 Ga0070700_100107138 3300005441 Bacteria 1852
54 Ga0070700_100191988 3300005441 Bacteria 1429
55 Ga0070700_100821629 3300005441 Bacteria 750
56 Ga0070700_101090769 3300005441 Bacteria 661
57 Ga0070694_100016769 3300005444 Bacteria 4615
58 Ga0070694_100449295 3300005444 Bacteria 1017
59 Ga0070663_100314641 3300005455 Bacteria 1257
60 Ga0070663_100865071 3300005455 Bacteria 779
61 Ga0070678_100036640 3300005456 Bacteria 3435
62 Ga0070678_100068044 3300005456 Bacteria 2653
63 Ga0070678_100388365 3300005456 Bacteria 1209
64 Ga0070678_101402560 3300005456 Bacteria 652
65 Ga0070662_100011612 3300005457 Bacteria 5813
66 Ga0070662_100139032 3300005457 Bacteria 1880
67 Ga0070662_100722873 3300005457 Bacteria 843
68 Ga0070681_10822652 3300005458 Bacteria 846
69 Ga0068867_100259341 3300005459 Unclassified 1416
70 Ga0068867_100351564 3300005459 Bacteria 1230
71 Ga0068867_100626487 3300005459 Bacteria 941
72 Ga0070685_10071912 3300005466 Bacteria 2052
73 Ga0070685_10115057 3300005466 Bacteria 1663
74 Ga0070679_100199381 3300005530 Bacteria 1968
75 Ga0068853_100323055 3300005539 Bacteria 1431
76 Ga0068853_100961722 3300005539 Bacteria 821
77 Ga0070672_100160204 3300005543 Bacteria 1866
78 Ga0070672_100253265 3300005543 Bacteria 1483
79 Ga0070672_100308613 3300005543 Bacteria 1342
80 Ga0070672_100358754 3300005543 Bacteria 1244
81 Ga0070686_100015477 3300005544 Bacteria 4420
82 Ga0070686_100261708 3300005544 Bacteria 1268
83 Ga0070686_101189374 3300005544 Unclassified 633
84 Ga0070695_100208846 3300005545 Bacteria 1400
85 Ga0070665_100003593 3300005548 Bacteria 16420
86 Ga0070665_100108373 3300005548 Bacteria 2780
87 Ga0070664_100021629 3300005564 Bacteria 5303
88 Ga0070664_101218864 3300005564 Bacteria 710
89 Ga0068857_100136705 3300005577 Bacteria 2213
90 Ga0068854_100390463 3300005578 Bacteria 1149
91 Ga0070702_100029381 3300005615 Bacteria 2989
92 Ga0070702_100636089 3300005615 Unclassified 805
93 Ga0068852_101472659 3300005616 Unclassified 703
94 Ga0068859_100013256 3300005617 Bacteria 8272
95 Ga0068859_100761064 3300005617 Unclassified 1057
96 Ga0068859_100985279 3300005617 Bacteria 925
97 Ga0068859_101107044 3300005617 Bacteria 871
98 Ga0068859_101122458 3300005617 Bacteria 865
99 Ga0068864_100006517 3300005618 Bacteria 9568
100 Ga0068864_100410163 3300005618 Bacteria 1289
101 Ga0068864_101263840 3300005618 Bacteria 738
102 Ga0068866_10146791 3300005718 Bacteria 1361
103 Ga0068866_10233797 3300005718 Bacteria 1116
104 Ga0068866_10323607 3300005718 Bacteria 971
105 Ga0068861_100001565 3300005719 Bacteria 14552
106 Ga0068861_100006543 3300005719 Bacteria 7949
107 Ga0068861_100056424 3300005719 Bacteria 2998
108 Ga0068861_100073713 3300005719 Bacteria 2653
109 Ga0068861_100108999 3300005719 Bacteria 2216
110 Ga0068861_100385384 3300005719 Unclassified 1240
111 Ga0068861_101240171 3300005719 Bacteria 723
112 Ga0068870_10007045 3300005840 Bacteria 4992
113 Ga0068870_10266848 3300005840 Unclassified 1068
114 Ga0068870_10974721 3300005840 Unclassified 603
115 Ga0068863_100043443 3300005841 Bacteria 4267
116 Ga0068863_100520126 3300005841 Unclassified 1173
117 Ga0068863_102147467 3300005841 Bacteria 568
118 Ga0068860_100075808 3300005843 Bacteria 3199
119 Ga0068860_100771316 3300005843 Bacteria 974
120 Ga0068862_100001280 3300005844 Bacteria 23568
121 Ga0068862_100011762 3300005844 Bacteria 7223
122 Ga0068862_100037705 3300005844 Bacteria 4097
123 Ga0068862_100168584 3300005844 Bacteria 1959
124 Ga0068862_100284660 3300005844 Bacteria 1516
125 Ga0068862_100300508 3300005844 Unclassified 1477
126 Ga0068862_100450246 3300005844 Bacteria 1214
127 Ga0097621_100076689 3300006237 Bacteria 2773
128 Ga0068871_100121393 3300006358 Bacteria 2207
129 Ga0075428_100005815 3300006844 Bacteria 13699
130 Ga0075428_100012639 3300006844 Bacteria 9387
131 Ga0075428_100337454 3300006844 Unclassified 1619
132 Ga0075430_100002094 3300006846 Bacteria 16501
133 Ga0075431_100022603 3300006847 Bacteria 6429
134 Ga0075431_100149077 3300006847 Bacteria 2409
135 Ga0075431_100744718 3300006847 Unclassified 956
136 Ga0075429_100002981 3300006880 Bacteria 14365
137 Ga0075429_100312815 3300006880 Bacteria 1375
138 Ga0068865_100074412 3300006881 Bacteria 2419
139 Ga0068865_100172006 3300006881 Bacteria 1662
140 Ga0068865_100650814 3300006881 Bacteria 896
141 Ga0068865_101202073 3300006881 Bacteria 671
142 Ga0068865_101556501 3300006881 Unclassified 593
143 Ga0097620_100013256 3300006931 Bacteria 8272
144 Ga0097620_100761064 3300006931 Unclassified 1057
145 Ga0097620_100985317 3300006931 Bacteria 925
146 Ga0097620_101107266 3300006931 Bacteria 871
147 Ga0097620_101122391 3300006931 Bacteria 865
148 Ga0111539_10008347 3300009094 Bacteria 13180
149 Ga0111539_10095167 3300009094 Bacteria 3499
150 Ga0111539_10116684 3300009094 Bacteria 3130
151 Ga0111539_10956214 3300009094 Unclassified 996
152 Ga0111539_12196396 3300009094 Unclassified 640
153 Ga0114129_10004879 3300009147 Bacteria 18926
154 Ga0114129_10755097 3300009147 Bacteria 1245
155 Ga0105243_10052958 3300009148 Bacteria 3217
156 Ga0105241_10680843 3300009174 Bacteria 937
157 Ga0105242_12349468 3300009176 Bacteria 580
158 Ga0105248_10882682 3300009177 Unclassified 1010
159 Ga0105248_10948074 3300009177 Bacteria 972
160 Ga0105249_10015220 3300009553 Bacteria 6808
161 Ga0105249_10520577 3300009553 Unclassified 1237
162 Ga0105249_11665640 3300009553 Bacteria 710
163 Ga0105249_13036069 3300009553 Unclassified 539
164 Ga0105239_11385568 3300010375 Bacteria 812
165 Ga0105239_13623027 3300010375 Unclassified 502
166 Ga0105246_10049823 3300011119 Bacteria 2869
167 Ga0157373_10007721 3300013100 Bacteria 7995
168 Ga0163162_10232019 3300013306 Bacteria 1976
169 Ga0157375_10041708 3300013308 Bacteria 4434
170 Ga0157375_10774716 3300013308 Unclassified 1109
171 Ga0157375_12449310 3300013308 Bacteria 623
172 Ga0163163_10029794 3300014325 Bacteria 5252
173 Ga0163163_10988330 3300014325 Bacteria 905
174 Ga0157380_10006391 3300014326 Bacteria 8295
175 Ga0157380_10036038 3300014326 Bacteria 3825
176 Ga0157380_10307211 3300014326 Bacteria 1464
177 Ga0157380_11436847 3300014326 Bacteria 741
178 Ga0157377_10173914 3300014745 Unclassified 1349
179 Ga0157377_10682043 3300014745 Unclassified 744
180 Ga0157379_10330626 3300014968 Bacteria 1392
181 Ga0157376_10067742 3300014969 Bacteria 3020
182 Ga0157376_10454105 3300014969 Unclassified 1251
183 Ga0163161_10171417 3300017792 Unclassified 1660
184 Ga0163161_10823037 3300017792 Unclassified 782
185 Ga0209130_1041462 3300025284 Bacteria 886
186 Ga0207682_10015365 3300025893 Bacteria 2980
187 Ga0207682_10043786 3300025893 Bacteria 1833
188 Ga0207682_10491642 3300025893 Bacteria 581
189 Ga0207642_10492710 3300025899 Bacteria 749
190 Ga0207645_10042742 3300025907 Bacteria 2899
191 Ga0207645_10060132 3300025907 Bacteria 2426
192 Ga0207645_10401904 3300025907 Bacteria 921
193 Ga0207643_10032665 3300025908 Bacteria 2908
194 Ga0207643_10075171 3300025908 Bacteria 1949
195 Ga0207643_10247026 3300025908 Bacteria 1098
196 Ga0207654_10673555 3300025911 Bacteria 742
197 Ga0207707_10483602 3300025912 Unclassified 1057
198 Ga0207660_10083621 3300025917 Bacteria 2351
199 Ga0207662_10132174 3300025918 Bacteria 1575
200 Ga0207662_10319612 3300025918 Bacteria 1036
201 Ga0207649_10333705 3300025920 Unclassified 1118
202 Ga0207649_10819041 3300025920 Unclassified 727
203 Ga0207652_10365722 3300025921 Bacteria 1302
204 Ga0207681_10118333 3300025923 Bacteria 1939
205 Ga0207650_10050134 3300025925 Bacteria 3086
206 Ga0207659_10101196 3300025926 Bacteria 2173
207 Ga0207659_10143552 3300025926 Bacteria 1856
208 Ga0207659_10205462 3300025926 Bacteria 1576
209 Ga0207659_10591885 3300025926 Unclassified 945
210 Ga0207659_10947885 3300025926 Bacteria 740
211 Ga0207690_10045781 3300025932 Bacteria 2893
212 Ga0207706_10002877 3300025933 Bacteria 16672
213 Ga0207706_10552067 3300025933 Bacteria 992
214 Ga0207706_11300117 3300025933 Bacteria 601
215 Ga0207686_10135733 3300025934 Unclassified 1693
216 Ga0207686_10641130 3300025934 Bacteria 840
217 Ga0207709_10471011 3300025935 Bacteria 975
218 Ga0207670_10012094 3300025936 Bacteria 5035
219 Ga0207669_10087304 3300025937 Unclassified 2020
220 Ga0207669_10166575 3300025937 Bacteria 1563
221 Ga0207669_10367804 3300025937 Unclassified 1116
222 Ga0207669_11387365 3300025937 Archaea 598
223 Ga0207704_10258746 3300025938 Bacteria 1311
224 Ga0207704_11462110 3300025938 Unclassified 586
225 Ga0207691_10018839 3300025940 Bacteria 6537
226 Ga0207691_10066472 3300025940 Bacteria 3261
227 Ga0207691_10073695 3300025940 Bacteria 3079
228 Ga0207691_10923680 3300025940 Unclassified 730
229 Ga0207689_10067322 3300025942 Bacteria 2944
230 Ga0207689_10184479 3300025942 Bacteria 1721
231 Ga0207679_10158752 3300025945 Bacteria 1849
232 Ga0207679_11283994 3300025945 Bacteria 672
233 Ga0207651_10247955 3300025960 Bacteria 1455
234 Ga0207712_10024812 3300025961 Bacteria 3977
235 Ga0207712_10344909 3300025961 Unclassified 1236
236 Ga0207668_10008699 3300025972 Bacteria 6065
237 Ga0207668_10168615 3300025972 Bacteria 1715
238 Ga0207640_10480623 3300025981 Bacteria 1030
239 Ga0207658_10057086 3300025986 Unclassified 2900
240 Ga0207658_11404294 3300025986 Bacteria 639
241 Ga0207658_11449018 3300025986 Bacteria 628
242 Ga0207677_10191012 3300026023 Bacteria 1620
243 Ga0207677_10357589 3300026023 Bacteria 1225
244 Ga0207677_10931135 3300026023 Bacteria 785
245 Ga0207678_10339275 3300026067 Bacteria 1295
246 Ga0207678_11038105 3300026067 Bacteria 726
247 Ga0207708_10014868 3300026075 Bacteria 5827
248 Ga0207708_10064506 3300026075 Unclassified 2798
249 Ga0207708_10271556 3300026075 Bacteria 1372
250 Ga0207641_10096713 3300026088 Bacteria 2594
251 Ga0207641_10338785 3300026088 Bacteria 1430
252 Ga0207641_10916177 3300026088 Bacteria 871
253 Ga0207641_12390386 3300026088 Unclassified 527
254 Ga0207648_10041157 3300026089 Bacteria 4059
255 Ga0207648_10166254 3300026089 Unclassified 1949
256 Ga0207648_11094676 3300026089 Bacteria 747
257 Ga0207676_10009441 3300026095 Bacteria 6944
258 Ga0207676_10223444 3300026095 Bacteria 1679
259 Ga0207674_10341261 3300026116 Bacteria 1448
260 Ga0207674_10450077 3300026116 Unclassified 1245
261 Ga0207675_100001263 3300026118 Bacteria 25261
262 Ga0207675_100003324 3300026118 Bacteria 15743
263 Ga0207675_100004483 3300026118 Bacteria 13493
264 Ga0207675_100020516 3300026118 Bacteria 6160
265 Ga0207675_100064076 3300026118 Bacteria 3435
266 Ga0207675_100897887 3300026118 Bacteria 902
267 Ga0207675_102464384 3300026118 Bacteria 532
268 Ga0207683_10013037 3300026121 Bacteria 7094
269 Ga0207683_10070054 3300026121 Bacteria 3097
270 Ga0207683_10938209 3300026121 Bacteria 804
271 Ga0207683_11077699 3300026121 Unclassified 745
272 Ga0207428_10051752 3300027907 Bacteria 3282
273 Ga0268266_10016580 3300028379 Bacteria 6295
274 Ga0268265_10000839 3300028380 Bacteria 28924
275 Ga0268265_10035781 3300028380 Bacteria 3632
276 Ga0268265_10095252 3300028380 Bacteria 2390
277 Ga0268265_10976821 3300028380 Bacteria 835
278 Ga0268265_11701015 3300028380 Bacteria 637
279 Ga0268264_10181070 3300028381 Bacteria 1914
280 Ga0268264_10653342 3300028381 Unclassified 1041
281 Ga0307515_10266032 3300028794 Bacteria 1443
282 Ga0307513_10003057 3300031456 Bacteria 22809
283 Ga0307513_10006355 3300031456 Bacteria 15461
284 Ga0307513_10021477 3300031456 Bacteria 7621
285 Ga0307513_10208634 3300031456 Bacteria 1787
286 Ga0307509_10063796 3300031507 Unclassified 3878
287 Ga0307408_100009054 3300031548 Bacteria 6575
288 Ga0307408_100069500 3300031548 Bacteria 2597
289 Ga0307408_100136273 3300031548 Unclassified 1921
290 Ga0307408_100400891 3300031548 Bacteria 1178
291 Ga0307408_100560259 3300031548 Unclassified 1010
292 Ga0316576_10008520 3300031727 Bacteria 6549
293 Ga0307405_10099075 3300031731 Bacteria 1950
294 Ga0307405_10158408 3300031731 Bacteria 1601
295 Ga0307413_10047577 3300031824 Bacteria 2558
296 Ga0307413_10120489 3300031824 Bacteria 1776
297 Ga0307413_10472751 3300031824 Bacteria 1000
298 Ga0307410_10138493 3300031852 Bacteria 1797
299 Ga0307410_10714888 3300031852 Bacteria 845
300 Ga0307406_10011328 3300031901 Bacteria 5058
301 Ga0307407_10047577 3300031903 Unclassified 2435
302 Ga0307407_10354868 3300031903 Bacteria 1039
303 Ga0307407_10593270 3300031903 Bacteria 824
304 Ga0307412_10169512 3300031911 Unclassified 1631
305 Ga0307412_10643146 3300031911 Bacteria 904
306 Ga0307412_10703040 3300031911 Bacteria 868
307 Ga0307409_100034448 3300031995 Bacteria 3698
308 Ga0307409_100108331 3300031995 Bacteria 2323
309 Ga0307409_100243658 3300031995 Bacteria 1638
310 Ga0307416_100155086 3300032002 Unclassified 2107
311 Ga0307416_100252234 3300032002 Bacteria 1718
312 Ga0307414_10624298 3300032004 Bacteria 969
313 Ga0307411_10002813 3300032005 Bacteria 7843
314 Ga0307411_10023848 3300032005 Bacteria 3634
315 Ga0307415_100181991 3300032126 Bacteria 1650
316 Ga0307415_100247072 3300032126 Unclassified 1447
317 Ga0307415_101503291 3300032126 Unclassified 644
318 Ga0316574_0064135 3300035398 Bacteria 2311
319 Ga0373937_0505533 3300036401 Unclassified 1148
320 Ga0316581_0110957 3300037588 Bacteria 845
321 Ga0439436_0006466 3300041404 Bacteria 3597
322 Ga0439465_0000667 3300041413 Bacteria 10503
323 Ga0451787_430751 3300041441 Bacteria 779
324 Ga0451791_0819407 3300041451 Bacteria 644
325 Ga0451793_0724424 3300041452 Bacteria 2269
326 Ga0451797_0182726 3300041453 Unclassified 651
327 Ga0451797_0300790 3300041453 Bacteria 1244
328 Ga0451798_0624611 3300041458 Bacteria 1059
329 Ga0451800_1399494 3300041459 Bacteria 3541
330 Ga0451802_0177252 3300041460 Bacteria 796
331 Ga0451804_0926428 3300041463 Bacteria 749
332 Ga0451807_1138991 3300041486 Bacteria 883
333 Ga0451807_1448232 3300041486 Bacteria 5455
334 Ga0451807_2440399 3300041486 Bacteria 987
335 Ga0451833_0659281 3300041491 Unclassified 1222
336 Ga0451849_0638020 3300041505 Unclassified 524
337 Ga0451853_3941001 3300041512 Bacteria 767
338 Ga0439449_0000666 3300042007 Bacteria 13010
339 Ga0439464_0123237 3300042439 Bacteria 799
340 Ga0450916_009668 3300042530 Bacteria 1195
341 Ga0450916_022092 3300042530 Unclassified 880
342 Ga0450916_039572 3300042530 Bacteria 713
343 Ga0451577_0031833 3300042876 Bacteria 4757
344 Ga0451577_0045864 3300042876 Bacteria 3911
345 Ga0451577_0056174 3300042876 Bacteria 3511
346 Ga0451577_0403818 3300042876 Bacteria 1240
347 Ga0451577_0755259 3300042876 Bacteria 879
348 Ga0453683_0851664 3300044673 Unclassified 601
349 Ga0453684_0000049 3300044712 Bacteria 559289
350 Ga0453684_0039412 3300044712 Bacteria 6439
351 Ga0453684_0540865 3300044712 Bacteria 1284
352 Ga0453684_0799024 3300044712 Bacteria 1017
353 Ga0451576_0066799 3300045051 Bacteria 3743
354 Ga0495590_0000957 3300046457 Bacteria 12756
355 Ga0495638_0060100 3300046460 Bacteria 2351
356 Ga0495584_0255275 3300046491 Unclassified 891
357 Ga0495616_0040714 3300046513 Bacteria 2372
358 Ga0495616_0443372 3300046513 Bacteria 527
359 Ga0495632_0045504 3300046519 Bacteria 2186
360 Ga0495632_0056719 3300046519 Bacteria 1914
361 Ga0495654_0240910 3300046530 Unclassified 757
362 Ga0495598_0200995 3300046537 Unclassified 720
363 Ga0495656_0575024 3300046615 Bacteria 602
364 Ga0495656_0701473 3300046615 Unclassified 545
365 Ga0495625_0014889 3300046660 Bacteria 6185
366 Ga0495625_0024323 3300046660 Bacteria 4612
367 Ga0495625_0076824 3300046660 Bacteria 2334
368 Ga0495625_0314688 3300046660 Unclassified 998
369 Ga0495671_0208531 3300046692 Bacteria 947
370 Ga0495672_0092919 3300047320 Unclassified 1653
371 Ga0495680_0475254 3300047322 Unclassified 852
372 Ga0495615_0064258 3300048090 Unclassified 976
373 Ga0496110_0354445 3300048913 Bacteria 1337
374 Ga0501033_0396433 3300049570 Bacteria 963
375 Ga0501038_0043689 3300049574 Bacteria 3896
376 Ga0501042_0380696 3300049578 Unclassified 1022
377 Ga0501221_148297 3300049704 Unclassified 620
378 Ga0501080_0139399 3300049742 Unclassified 2243
379 nmdc:mga0yw44_323179_c1 3300050492 Bacteria 1036
380 nmdc:mga05p37_5522_c1 3300050507 Bacteria 14850
381 nmdc:mga09592_3178_c1 3300050508 Bacteria 13332
382 nmdc:mga09592_866786_c1 3300050508 Bacteria 761
383 nmdc:mga0qj67_144607_c1 3300050509 Unclassified 1928
384 nmdc:mga0qj67_2670_c1 3300050509 Bacteria 12766
385 nmdc:mga06r32_174858_c1 3300050510 Bacteria 2131
386 nmdc:mga06r32_1937_c1 3300050510 Bacteria 18461
387 nmdc:mga06r32_618973_c1 3300050510 Bacteria 1053
388 nmdc:mga08y16_1014569_c1 3300050511 Unclassified 809
389 nmdc:mga08y16_157841_c1 3300050511 Bacteria 2357
390 nmdc:mga08y16_490445_c1 3300050511 Unclassified 1249
391 Ga0501082_0766782 3300060353 Unclassified 844
392 Ga0070689_100000752
393 rootL2_10027230
394 rootL2_10030789
395 rootL2_10041458
396 rootH1_10033307
397 Ga0070676_10011401
398 Ga0070676_10377113
399 Ga0070676_10386966
400 Ga0070676_11067368
401 Ga0070690_100998869
402 Ga0070670_100080631
403 Ga0070670_100116765
404 Ga0070670_100531512
405 Ga0070670_101916625
406 Ga0070677_10002267
407 Ga0070677_10038911
408 Ga0070677_10397963
409 Ga0068869_100101258
410 Ga0070682_100243057
411 Ga0068868_100273525
412 Ga0068868_100440225
413 Ga0070691_10127786
414 Ga0070691_10475302
415 Ga0070687_100250441
416 Ga0070661_100598621
417 Ga0070692_10870816
418 Ga0070692_11116205
419 Ga0070668_100004535
420 Ga0070668_100171157
421 Ga0070668_100480060
422 Ga0070669_100052439
423 Ga0070669_100131800
424 Ga0070675_100028804
425 Ga0070675_100033817
426 Ga0070675_100069717
427 Ga0070675_100235463
428 Ga0070675_101102682
429 Ga0070674_100046562
430 Ga0070674_100085706
431 Ga0070674_100100149
432 Ga0070674_100157674
433 Ga0070673_100118734
434 Ga0070673_100846452
435 Ga0070688_100855094
436 Ga0070659_101206000
437 Ga0070667_100456756
438 Ga0070667_101473158
439 Ga0070701_10007084
440 Ga0070701_10037342
441 Ga0070701_10165610
442 Ga0070705_100020122
443 Ga0070705_100326347
444 Ga0070700_100107138
445 Ga0070700_100191988
446 Ga0070700_100821629
447 Ga0070700_101090769
448 Ga0070694_100016769
449 Ga0070694_100449295
450 Ga0070663_100314641
451 Ga0070663_100865071
452 Ga0070678_100036640
453 Ga0070678_100068044
454 Ga0070678_100388365
455 Ga0070678_101402560
456 Ga0070662_100011612
457 Ga0070662_100139032
458 Ga0070662_100722873
459 Ga0070681_10822652
460 Ga0068867_100259341
461 Ga0068867_100351564
462 Ga0068867_100626487
463 Ga0070685_10071912
464 Ga0070685_10115057
465 Ga0070679_100199381
466 Ga0068853_100323055
467 Ga0068853_100961722
468 Ga0070672_100160204
469 Ga0070672_100253265
470 Ga0070672_100308613
471 Ga0070672_100358754
472 Ga0070686_100015477
473 Ga0070686_100261708
474 Ga0070686_101189374
475 Ga0070695_100208846
476 Ga0070665_100003593
477 Ga0070665_100108373
478 Ga0070664_100021629
479 Ga0070664_101218864
480 Ga0068857_100136705
481 Ga0068854_100390463
482 Ga0070702_100029381
483 Ga0070702_100636089
484 Ga0068852_101472659
485 Ga0068859_100013256
486 Ga0068859_100761064
487 Ga0068859_100985279
488 Ga0068859_101107044
489 Ga0068859_101122458
490 Ga0068864_100006517
491 Ga0068864_100410163
492 Ga0068864_101263840
493 Ga0068866_10146791
494 Ga0068866_10233797
495 Ga0068866_10323607
496 Ga0068861_100001565
497 Ga0068861_100006543
498 Ga0068861_100056424
499 Ga0068861_100073713
500 Ga0068861_100108999
501 Ga0068861_100385384
502 Ga0068861_101240171
503 Ga0068870_10007045
504 Ga0068870_10266848
505 Ga0068870_10974721
506 Ga0068863_100043443
507 Ga0068863_100520126
508 Ga0068863_102147467
509 Ga0068860_100075808
510 Ga0068860_100771316
511 Ga0068862_100001280
512 Ga0068862_100011762
513 Ga0068862_100037705
514 Ga0068862_100168584
515 Ga0068862_100284660
516 Ga0068862_100300508
517 Ga0068862_100450246
518 Ga0097621_100076689
519 Ga0068871_100121393
520 Ga0075428_100005815
521 Ga0075428_100012639
522 Ga0075428_100337454
523 Ga0075430_100002094
524 Ga0075431_100022603
525 Ga0075431_100149077
526 Ga0075431_100744718
527 Ga0075429_100002981
528 Ga0075429_100312815
529 Ga0068865_100074412
530 Ga0068865_100172006
531 Ga0068865_100650814
532 Ga0068865_101202073
533 Ga0068865_101556501
534 Ga0097620_100013256
535 Ga0097620_100761064
536 Ga0097620_100985317
537 Ga0097620_101107266
538 Ga0097620_101122391
539 Ga0111539_10008347
540 Ga0111539_10095167
541 Ga0111539_10116684
542 Ga0111539_10956214
543 Ga0111539_12196396
544 Ga0114129_10004879
545 Ga0114129_10755097
546 Ga0105243_10052958
547 Ga0105241_10680843
548 Ga0105242_12349468
549 Ga0105248_10882682
550 Ga0105248_10948074
551 Ga0105249_10015220
552 Ga0105249_10520577
553 Ga0105249_11665640
554 Ga0105249_13036069
555 Ga0105239_11385568
556 Ga0105239_13623027
557 Ga0105246_10049823
558 Ga0157373_10007721
559 Ga0163162_10232019
560 Ga0157375_10041708
561 Ga0157375_10774716
562 Ga0157375_12449310
563 Ga0163163_10029794
564 Ga0163163_10988330
565 Ga0157380_10006391
566 Ga0157380_10036038
567 Ga0157380_10307211
568 Ga0157380_11436847
569 Ga0157377_10173914
570 Ga0157377_10682043
571 Ga0157379_10330626
572 Ga0157376_10067742
573 Ga0157376_10454105
574 Ga0163161_10171417
575 Ga0163161_10823037
576 Ga0209130_1041462
577 Ga0207682_10015365
578 Ga0207682_10043786
579 Ga0207682_10491642
580 Ga0207642_10492710
581 Ga0207645_10042742
582 Ga0207645_10060132
583 Ga0207645_10401904
584 Ga0207643_10032665
585 Ga0207643_10075171
586 Ga0207643_10247026
587 Ga0207654_10673555
588 Ga0207707_10483602
589 Ga0207660_10083621
590 Ga0207662_10132174
591 Ga0207662_10319612
592 Ga0207649_10333705
593 Ga0207649_10819041
594 Ga0207652_10365722
595 Ga0207681_10118333
596 Ga0207650_10050134
597 Ga0207659_10101196
598 Ga0207659_10143552
599 Ga0207659_10205462
600 Ga0207659_10591885
601 Ga0207659_10947885
602 Ga0207690_10045781
603 Ga0207706_10002877
604 Ga0207706_10552067
605 Ga0207706_11300117
606 Ga0207686_10135733
607 Ga0207686_10641130
608 Ga0207709_10471011
609 Ga0207670_10012094
610 Ga0207669_10087304
611 Ga0207669_10166575
612 Ga0207669_10367804
613 Ga0207669_11387365
614 Ga0207704_10258746
615 Ga0207704_11462110
616 Ga0207691_10018839
617 Ga0207691_10066472
618 Ga0207691_10073695
619 Ga0207691_10923680
620 Ga0207689_10067322
621 Ga0207689_10184479
622 Ga0207679_10158752
623 Ga0207679_11283994
624 Ga0207651_10247955
625 Ga0207712_10024812
626 Ga0207712_10344909
627 Ga0207668_10008699
628 Ga0207668_10168615
629 Ga0207640_10480623
630 Ga0207658_10057086
631 Ga0207658_11404294
632 Ga0207658_11449018
633 Ga0207677_10191012
634 Ga0207677_10357589
635 Ga0207677_10931135
636 Ga0207678_10339275
637 Ga0207678_11038105
638 Ga0207708_10014868
639 Ga0207708_10064506
640 Ga0207708_10271556
641 Ga0207641_10096713
642 Ga0207641_10338785
643 Ga0207641_10916177
644 Ga0207641_12390386
645 Ga0207648_10041157
646 Ga0207648_10166254
647 Ga0207648_11094676
648 Ga0207676_10009441
649 Ga0207676_10223444
650 Ga0207674_10341261
651 Ga0207674_10450077
652 Ga0207675_100001263
653 Ga0207675_100003324
654 Ga0207675_100004483
655 Ga0207675_100020516
656 Ga0207675_100064076
657 Ga0207675_100897887
658 Ga0207675_102464384
659 Ga0207683_10013037
660 Ga0207683_10070054
661 Ga0207683_10938209
662 Ga0207683_11077699
663 Ga0207428_10051752
664 Ga0268266_10016580
665 Ga0268265_10000839
666 Ga0268265_10035781
667 Ga0268265_10095252
668 Ga0268265_10976821
669 Ga0268265_11701015
670 Ga0268264_10181070
671 Ga0268264_10653342
672 Ga0307515_10266032
673 Ga0307513_10003057
674 Ga0307513_10006355
675 Ga0307513_10021477
676 Ga0307513_10208634
677 Ga0307509_10063796
678 Ga0307408_100009054
679 Ga0307408_100069500
680 Ga0307408_100136273
681 Ga0307408_100400891
682 Ga0307408_100560259
683 Ga0316576_10008520
684 Ga0307405_10099075
685 Ga0307405_10158408
686 Ga0307413_10047577
687 Ga0307413_10120489
688 Ga0307413_10472751
689 Ga0307410_10138493
690 Ga0307410_10714888
691 Ga0307406_10011328
692 Ga0307407_10047577
693 Ga0307407_10354868
694 Ga0307407_10593270
695 Ga0307412_10169512
696 Ga0307412_10643146
697 Ga0307412_10703040
698 Ga0307409_100034448
699 Ga0307409_100108331
700 Ga0307409_100243658
701 Ga0307416_100155086
702 Ga0307416_100252234
703 Ga0307414_10624298
704 Ga0307411_10002813
705 Ga0307411_10023848
706 Ga0307415_100181991
707 Ga0307415_100247072
708 Ga0307415_101503291
709 Ga0316574_0064135
710 Ga0373937_0505533
711 Ga0316581_0110957
712 Ga0439436_0006466
713 Ga0439465_0000667
714 Ga0451787_430751
715 Ga0451791_0819407
716 Ga0451793_0724424
717 Ga0451797_0182726
718 Ga0451797_0300790
719 Ga0451798_0624611
720 Ga0451800_1399494
721 Ga0451802_0177252
722 Ga0451804_0926428
723 Ga0451807_1138991
724 Ga0451807_1448232
725 Ga0451807_2440399
726 Ga0451833_0659281
727 Ga0451849_0638020
728 Ga0451853_3941001
729 Ga0439449_0000666
730 Ga0439464_0123237
731 Ga0450916_009668
732 Ga0450916_022092
733 Ga0450916_039572
734 Ga0451577_0031833
735 Ga0451577_0045864
736 Ga0451577_0056174
737 Ga0451577_0403818
738 Ga0451577_0755259
739 Ga0453683_0851664
740 Ga0453684_0000049
741 Ga0453684_0039412
742 Ga0453684_0540865
743 Ga0453684_0799024
744 Ga0451576_0066799
745 Ga0495590_0000957
746 Ga0495638_0060100
747 Ga0495584_0255275
748 Ga0495616_0040714
749 Ga0495616_0443372
750 Ga0495632_0045504
751 Ga0495632_0056719
752 Ga0495654_0240910
753 Ga0495598_0200995
754 Ga0495656_0575024
755 Ga0495656_0701473
756 Ga0495625_0014889
757 Ga0495625_0024323
758 Ga0495625_0076824
759 Ga0495625_0314688
760 Ga0495671_0208531
761 Ga0495672_0092919
762 Ga0495680_0475254
763 Ga0495615_0064258
764 Ga0496110_0354445
765 Ga0501033_0396433
766 Ga0501038_0043689
767 Ga0501042_0380696
768 Ga0501221_148297
769 Ga0501080_0139399
770 nmdc:mga0yw44_323179_c1
771 nmdc:mga05p37_5522_c1
772 nmdc:mga09592_3178_c1
773 nmdc:mga09592_866786_c1
774 nmdc:mga0qj67_144607_c1
775 nmdc:mga0qj67_2670_c1
776 nmdc:mga06r32_174858_c1
777 nmdc:mga06r32_1937_c1
778 nmdc:mga06r32_618973_c1
779 nmdc:mga08y16_1014569_c1
780 nmdc:mga08y16_157841_c1
781 nmdc:mga08y16_490445_c1
782 Ga0501082_0766782

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

4

131

0.95

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

6

120

0.86

PF13468

Glyoxalase_3

Glyoxalase-like domain

5

130

0.82

PF18029

Glyoxalase_6

Glyoxalase-like domain

7

132

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e5d-assembly1.cif.gz_A-2 crystal structure of a putative glyoxalase i (lmof2365_0426) from listeria monocytogenes str. 4b f2365 at 2.70 a resolution 0.9238 1 129
3e5d-assembly1.cif.gz_A-2 crystal structure of a putative glyoxalase i (lmof2365_0426) from listeria monocytogenes str. 4b f2365 at 2.70 a resolution 0.9167 1 129
2rk0-assembly1.cif.gz_B crystal structure of glyoxylase/bleomycin resistance protein/dioxygenase domain from frankia sp. ean1pec 0.8669 1 128
4nb2-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.89 angstrom resolution - apo structure 0.8585 1 127
2rk0-assembly1.cif.gz_A crystal structure of glyoxylase/bleomycin resistance protein/dioxygenase domain from frankia sp. ean1pec 0.858 1 128
ID Description Score Start End Superfamily
3e5dA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9209 2 129 3.10.180.10
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9149 75 129 3.30.720.110
3e5dA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9136 2 129 3.10.180.10
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8817 75 129 3.30.720.110
af_A0A1X7YDR8_31_97_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8784 1 57 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A3C0UMU2-F1-model_v4 Glyoxalase/bleomycin resistance/extradiol dioxygenase family protein 1.006 78 129 GO:0051213
AF-A0A837RF84-F1-model_v4 VOC domain-containing protein 0.9823 75 129
AF-A0A837RF84-F1-model_v4 VOC domain-containing protein 0.9651 75 129
AF-A0A2G6H1Q2-F1-model_v4 VOC domain-containing protein 0.9642 73 129
AF-A0A3C0UMU2-F1-model_v4 Glyoxalase/bleomycin resistance/extradiol dioxygenase family protein 0.9508 78 129 GO:0051213

Map