F431904

General Info

Members Datasets Scaffolds Average Seq Length
391 226 389 347

Family's Representative Sequence

Representative Sequence 3300003316|rootH1_10030947|rootH1_100309472
Length 355
Sequence MTMILPKPAALLLEAPKKLAFEPLTLAPLGPEEVRIRTLHSGVSAGTELSQYRGTNPFMHVQWDAELRLFRKGEGPSWPYPVRNLGYEEVGEIIEVGSAVRTVRVGQRVFGTWGHRTHHIAPQDYAHDRLIPDSADPRIGIFSHIGAVALNGVHDAAIRIGDLVVVFGLGVPGQIVAQAARASGATVIGVDPIRERRDTALKLGADRVLDPTTTPIAETLKTETGGRGADVCIEVSGAAPALSEAIRTVAYASRVVAMGFFQGEVKGLQLGEEFHHNRIELICSQISGVAPAASHRWSKLRLWQTAIRLQHEGRLNLTPLITDNIPFEDAPKLFARLDQGDPAILQSMLTFGAAP

Samples

Sample ID Description Type Environment
1 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
2 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
10 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
89 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
92 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
93 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
95 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
141 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
144 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
152 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
153 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
154 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
155 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
156 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
157 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
158 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
161 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
162 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
163 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
164 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
165 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
166 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
167 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
168 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
169 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
170 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
171 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
172 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
173 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
174 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
175 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
176 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
177 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
178 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
179 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
180 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
181 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
182 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
183 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
194 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
197 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
198 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
199 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
200 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
201 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
202 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
203 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
204 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
205 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
206 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
207 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
208 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
209 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
218 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
219 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
220 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
221 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
222 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
223 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
224 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.49
Metatranscriptomes 0
Isolates 0.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.86
Nodule 0
Rhizoplane 5.63
Rhizosphere 84.65
Stem 0
Stem Tuber 0
Unclassified 4.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000521 3300001979 Bacteria 16501
2 JGI24739J22299_10034330 3300001989 Bacteria 1729
3 JGI25151J46595_10000667 3300003187 Bacteria 29187
4 rootH1_10030947 3300003316 Unclassified 2498
5 rootH1_10341186 3300003323 Bacteria 1211
6 JGI25160J50197_1001918 3300003354 Bacteria 9954
7 Ga0055536_1002105 3300003781 Bacteria 11326
8 Ga0055534_1003465 3300003784 Bacteria 4948
9 Ga0055530_10000005 3300003791 Bacteria 206625
10 Ga0055531_10001265 3300003794 Bacteria 19142
11 Ga0065165_1028822 3300005262 Bacteria 1787
12 Ga0070658_10026007 3300005327 Bacteria 4694
13 Ga0070658_10105096 3300005327 Unclassified 2336
14 Ga0070683_100007684 3300005329 Bacteria 9123
15 Ga0070683_100009905 3300005329 Bacteria 8169
16 Ga0070690_100000846 3300005330 Bacteria 15527
17 Ga0070670_100005356 3300005331 Bacteria 10825
18 Ga0070670_100254566 3300005331 Bacteria 1530
19 Ga0070666_10005934 3300005335 Bacteria 7499
20 Ga0070666_10009702 3300005335 Bacteria 6013
21 Ga0070666_10170923 3300005335 Bacteria 1522
22 Ga0070680_100007645 3300005336 Bacteria 8245
23 Ga0070682_100083413 3300005337 Bacteria 2074
24 Ga0070660_100016007 3300005339 Bacteria 5432
25 Ga0070660_100035236 3300005339 Bacteria 3787
26 Ga0070691_10001137 3300005341 Bacteria 11066
27 Ga0070661_100049739 3300005344 Bacteria 3069
28 Ga0070661_100090690 3300005344 Bacteria 2263
29 Ga0070661_100137663 3300005344 Bacteria 1838
30 Ga0070692_10017318 3300005345 Bacteria 3442
31 Ga0070668_100005699 3300005347 Bacteria 9232
32 Ga0070669_100003953 3300005353 Bacteria 10720
33 Ga0070671_100057666 3300005355 Bacteria 3232
34 Ga0070674_100014030 3300005356 Bacteria 4972
35 Ga0070673_100018736 3300005364 Bacteria 4955
36 Ga0070659_100005853 3300005366 Bacteria 8859
37 Ga0070659_100036864 3300005366 Bacteria 3812
38 Ga0070659_100067195 3300005366 Bacteria 2842
39 Ga0070659_100074376 3300005366 Bacteria 2706
40 Ga0070659_100128023 3300005366 Unclassified 2061
41 Ga0070659_100161763 3300005366 Bacteria 1831
42 Ga0070667_100003803 3300005367 Bacteria 12834
43 Ga0070667_100035275 3300005367 Unclassified 4189
44 Ga0070667_100038882 3300005367 Unclassified 3988
45 Ga0070667_100099915 3300005367 Bacteria 2505
46 Ga0070694_100088163 3300005444 Bacteria 2172
47 Ga0070678_100015256 3300005456 Bacteria 4878
48 Ga0070678_100228412 3300005456 Bacteria 1550
49 Ga0070662_100002220 3300005457 Bacteria 11921
50 Ga0070662_100171641 3300005457 Unclassified 1703
51 Ga0070681_10221840 3300005458 Bacteria 1805
52 Ga0068867_100040404 3300005459 Bacteria 3404
53 Ga0070679_100177932 3300005530 Bacteria 2100
54 Ga0070684_100001337 3300005535 Bacteria 17647
55 Ga0068853_100014159 3300005539 Bacteria 6530
56 Ga0068853_100070252 3300005539 Bacteria 3047
57 Ga0070686_100008534 3300005544 Bacteria 5742
58 Ga0070665_100000021 3300005548 Bacteria 389668
59 Ga0070665_100015714 3300005548 Bacteria 7605
60 Ga0070665_100017054 3300005548 Bacteria 7284
61 Ga0070665_100069846 3300005548 Unclassified 3520
62 Ga0070665_100135811 3300005548 Unclassified 2462
63 Ga0068855_100118269 3300005563 Bacteria 3035
64 Ga0068855_100169526 3300005563 Unclassified 2473
65 Ga0070664_100003074 3300005564 Bacteria 13485
66 Ga0070664_100005518 3300005564 Bacteria 10154
67 Ga0070664_100084661 3300005564 Bacteria 2737
68 Ga0068857_100018738 3300005577 Bacteria 6074
69 Ga0068857_100141982 3300005577 Bacteria 2171
70 Ga0068854_100001320 3300005578 Bacteria 14976
71 Ga0068856_100000380 3300005614 Bacteria 48567
72 Ga0068852_100006828 3300005616 Bacteria 8291
73 Ga0068852_100012705 3300005616 Bacteria 6409
74 Ga0068852_100016905 3300005616 Bacteria 5707
75 Ga0068859_100004563 3300005617 Bacteria 14127
76 Ga0068859_100022493 3300005617 Bacteria 6321
77 Ga0068864_100012225 3300005618 Bacteria 7093
78 Ga0068861_100000112 3300005719 Bacteria 41046
79 Ga0068863_100007275 3300005841 Bacteria 10844
80 Ga0068863_100137507 3300005841 Bacteria 2334
81 Ga0068858_100006726 3300005842 Bacteria 11188
82 Ga0068858_100059408 3300005842 Bacteria 3534
83 Ga0068858_100244110 3300005842 Unclassified 1705
84 Ga0068862_100008268 3300005844 Bacteria 8609
85 Ga0097621_100003571 3300006237 Bacteria 10749
86 Ga0068871_100030909 3300006358 Bacteria 4220
87 Ga0075428_100016021 3300006844 Bacteria 8290
88 Ga0075428_100020610 3300006844 Bacteria 7301
89 Ga0075428_100131236 3300006844 Unclassified 2725
90 Ga0075430_100004231 3300006846 Bacteria 12118
91 Ga0075430_100310582 3300006846 Unclassified 1304
92 Ga0075431_100000131 3300006847 Bacteria 50132
93 Ga0075429_100007713 3300006880 Bacteria 9341
94 Ga0075429_100032042 3300006880 Bacteria 4569
95 Ga0068865_100007921 3300006881 Bacteria 6557
96 Ga0097620_100004563 3300006931 Bacteria 14127
97 Ga0097620_100022491 3300006931 Bacteria 6321
98 Ga0105240_10000301 3300009093 Bacteria 96340
99 Ga0105240_10016673 3300009093 Bacteria 9934
100 Ga0105240_10036540 3300009093 Bacteria 6316
101 Ga0105240_10326714 3300009093 Bacteria 1747
102 Ga0111539_10337763 3300009094 Unclassified 1753
103 Ga0105245_10009635 3300009098 Bacteria 8424
104 Ga0105247_10012106 3300009101 Bacteria 5185
105 Ga0114129_10008244 3300009147 Bacteria 14858
106 Ga0114129_10241948 3300009147 Bacteria 2425
107 Ga0105243_10333382 3300009148 Unclassified 1387
108 Ga0105241_10059473 3300009174 Bacteria 2938
109 Ga0105241_10073471 3300009174 Unclassified 2660
110 Ga0105248_10172580 3300009177 Unclassified 2437
111 Ga0105237_10008182 3300009545 Bacteria 11358
112 Ga0105238_10002841 3300009551 Bacteria 17278
113 Ga0105238_10007872 3300009551 Bacteria 10662
114 Ga0105238_10016657 3300009551 Bacteria 7446
115 Ga0105238_10045154 3300009551 Unclassified 4451
116 Ga0105238_10052415 3300009551 Unclassified 4101
117 Ga0105238_10151571 3300009551 Bacteria 2293
118 Ga0105239_10000589 3300010375 Bacteria 51686
119 Ga0105239_10048542 3300010375 Unclassified 4655
120 Ga0105246_10122316 3300011119 Bacteria 1931
121 Ga0157373_10023723 3300013100 Bacteria 4445
122 Ga0157371_10004910 3300013102 Bacteria 11488
123 Ga0157371_10160380 3300013102 Bacteria 1606
124 Ga0157370_10030939 3300013104 Bacteria 5242
125 Ga0157369_10002550 3300013105 Bacteria 21798
126 Ga0157369_10006376 3300013105 Bacteria 13686
127 Ga0157369_10017977 3300013105 Bacteria 7934
128 Ga0157369_10073718 3300013105 Bacteria 3662
129 Ga0157369_10094433 3300013105 Unclassified 3192
130 Ga0157374_10068704 3300013296 Bacteria 3334
131 Ga0157374_10138841 3300013296 Unclassified 2358
132 Ga0157378_10039460 3300013297 Bacteria 4188
133 Ga0163162_10040297 3300013306 Bacteria 4670
134 Ga0157372_10023580 3300013307 Bacteria 6674
135 Ga0157375_10011198 3300013308 Bacteria 7914
136 Ga0163163_10037855 3300014325 Bacteria 4694
137 Ga0163163_10070957 3300014325 Unclassified 3470
138 Ga0163163_10355165 3300014325 Bacteria 1522
139 Ga0157379_10018972 3300014968 Bacteria 6071
140 Ga0157379_10028151 3300014968 Bacteria 5003
141 Ga0163161_10065147 3300017792 Bacteria 2659
142 Ga0213873_10000006 3300021358 Bacteria 408723
143 Ga0213876_10000004 3300021384 Bacteria 943822
144 Ga0209130_1002327 3300025284 Bacteria 9673
145 Ga0209675_1000564 3300025291 Bacteria 26703
146 Ga0209676_1000132 3300025292 Bacteria 185063
147 Ga0209025_1000429 3300025294 Bacteria 83306
148 Ga0209025_1005557 3300025294 Bacteria 10219
149 Ga0209758_1001704 3300025297 Bacteria 24679
150 Ga0209050_1000139 3300025298 Bacteria 173691
151 Ga0207426_1000085 3300025302 Bacteria 293171
152 Ga0209257_1000164 3300025304 Bacteria 173339
153 Ga0209257_1000761 3300025304 Bacteria 48293
154 Ga0209257_1002228 3300025304 Bacteria 19921
155 Ga0207642_10058059 3300025899 Bacteria 1784
156 Ga0207710_10023932 3300025900 Unclassified 2627
157 Ga0207680_10040671 3300025903 Bacteria 2707
158 Ga0207680_10176519 3300025903 Bacteria 1442
159 Ga0207647_10001861 3300025904 Bacteria 16166
160 Ga0207647_10121567 3300025904 Bacteria 1539
161 Ga0207645_10046485 3300025907 Bacteria 2773
162 Ga0207643_10026442 3300025908 Bacteria 3213
163 Ga0207705_10007724 3300025909 Bacteria 7905
164 Ga0207705_10126078 3300025909 Bacteria 1903
165 Ga0207654_10019954 3300025911 Unclassified 3545
166 Ga0207695_10000399 3300025913 Bacteria 97109
167 Ga0207695_10028765 3300025913 Bacteria 6154
168 Ga0207695_10091983 3300025913 Unclassified 3045
169 Ga0207695_10108357 3300025913 Bacteria 2762
170 Ga0207671_10164582 3300025914 Bacteria 1719
171 Ga0207657_10003465 3300025919 Bacteria 16835
172 Ga0207657_10046772 3300025919 Bacteria 3788
173 Ga0207657_10090167 3300025919 Bacteria 2559
174 Ga0207649_10048330 3300025920 Bacteria 2624
175 Ga0207649_10062824 3300025920 Bacteria 2342
176 Ga0207649_10139159 3300025920 Bacteria 1659
177 Ga0207652_10184179 3300025921 Bacteria 1877
178 Ga0207681_10029221 3300025923 Bacteria 3578
179 Ga0207694_10013761 3300025924 Bacteria 6098
180 Ga0207694_10026518 3300025924 Bacteria 4409
181 Ga0207694_10044511 3300025924 Unclassified 3427
182 Ga0207694_10308849 3300025924 Unclassified 1303
183 Ga0207650_10052761 3300025925 Bacteria 3012
184 Ga0207650_10083712 3300025925 Bacteria 2423
185 Ga0207650_10089437 3300025925 Bacteria 2350
186 Ga0207650_10244742 3300025925 Unclassified 1450
187 Ga0207644_10000287 3300025931 Bacteria 33209
188 Ga0207644_10052136 3300025931 Bacteria 2939
189 Ga0207644_10163768 3300025931 Unclassified 1731
190 Ga0207690_10001588 3300025932 Bacteria 14195
191 Ga0207706_10001384 3300025933 Bacteria 24192
192 Ga0207706_10010765 3300025933 Bacteria 8350
193 Ga0207706_10014049 3300025933 Bacteria 7261
194 Ga0207706_10268638 3300025933 Bacteria 1488
195 Ga0207709_10226214 3300025935 Unclassified 1352
196 Ga0207704_10020877 3300025938 Bacteria 3475
197 Ga0207691_10001279 3300025940 Bacteria 25144
198 Ga0207691_10108299 3300025940 Unclassified 2473
199 Ga0207711_10023752 3300025941 Bacteria 5132
200 Ga0207661_10002918 3300025944 Bacteria 11816
201 Ga0207679_10009156 3300025945 Bacteria 6331
202 Ga0207679_10058609 3300025945 Bacteria 2854
203 Ga0207667_10004831 3300025949 Bacteria 16480
204 Ga0207667_10017593 3300025949 Bacteria 8038
205 Ga0207667_10109860 3300025949 Bacteria 2844
206 Ga0207651_10021439 3300025960 Bacteria 3927
207 Ga0207712_10041222 3300025961 Bacteria 3172
208 Ga0207640_10002380 3300025981 Bacteria 10064
209 Ga0207703_10027724 3300026035 Bacteria 4460
210 Ga0207703_10086168 3300026035 Unclassified 2630
211 Ga0207703_10270055 3300026035 Bacteria 1540
212 Ga0207639_10105560 3300026041 Bacteria 2286
213 Ga0207678_10171897 3300026067 Bacteria 1850
214 Ga0207678_10187994 3300026067 Bacteria 1765
215 Ga0207702_10000544 3300026078 Bacteria 42110
216 Ga0207702_10002636 3300026078 Bacteria 16847
217 Ga0207702_10140228 3300026078 Bacteria 2186
218 Ga0207641_10044683 3300026088 Unclassified 3726
219 Ga0207648_10002272 3300026089 Bacteria 20792
220 Ga0207676_10024636 3300026095 Bacteria 4456
221 Ga0207676_10026340 3300026095 Bacteria 4325
222 Ga0207674_10004717 3300026116 Bacteria 16342
223 Ga0207674_10005724 3300026116 Bacteria 14735
224 Ga0207674_10012778 3300026116 Bacteria 9378
225 Ga0207674_10340461 3300026116 Bacteria 1450
226 Ga0207675_100000046 3300026118 Bacteria 87216
227 Ga0207683_10001183 3300026121 Bacteria 23626
228 Ga0207683_10013731 3300026121 Bacteria 6904
229 Ga0207698_10004615 3300026142 Bacteria 8417
230 Ga0207428_10044287 3300027907 Bacteria 3591
231 Ga0268266_10000015 3300028379 Bacteria 630629
232 Ga0268266_10005791 3300028379 Bacteria 11440
233 Ga0268266_10018519 3300028379 Bacteria 5934
234 Ga0268266_10053808 3300028379 Unclassified 3459
235 Ga0268266_10060659 3300028379 Unclassified 3261
236 Ga0268266_10196782 3300028379 Unclassified 1843
237 Ga0268265_10003101 3300028380 Bacteria 12126
238 Ga0268265_10045324 3300028380 Bacteria 3280
239 Ga0268264_10007321 3300028381 Bacteria 9225
240 Ga0268264_10493097 3300028381 Bacteria 1193
241 Ga0307517_10012059 3300028786 Bacteria 11917
242 Ga0307515_10108350 3300028794 Bacteria 3273
243 Ga0307408_100028598 3300031548 Bacteria 3853
244 Ga0307408_100068004 3300031548 Bacteria 2622
245 Ga0307408_100295994 3300031548 Bacteria 1354
246 Ga0307405_10031829 3300031731 Bacteria 3110
247 Ga0307405_10035625 3300031731 Bacteria 2974
248 Ga0307413_10011833 3300031824 Bacteria 4311
249 Ga0307413_10033695 3300031824 Bacteria 2920
250 Ga0307413_10051570 3300031824 Unclassified 2480
251 Ga0307410_10000420 3300031852 Bacteria 16843
252 Ga0307410_10005068 3300031852 Bacteria 6922
253 Ga0307406_10016124 3300031901 Bacteria 4335
254 Ga0307406_10047760 3300031901 Bacteria 2699
255 Ga0307412_10018385 3300031911 Bacteria 4205
256 Ga0307412_10097261 3300031911 Bacteria 2074
257 Ga0307412_10132978 3300031911 Bacteria 1810
258 Ga0307412_10220239 3300031911 Unclassified 1454
259 Ga0307409_100001686 3300031995 Bacteria 11132
260 Ga0307409_100008144 3300031995 Bacteria 6333
261 Ga0307409_100201074 3300031995 Bacteria 1782
262 Ga0307416_100009160 3300032002 Bacteria 6456
263 Ga0307416_100011151 3300032002 Bacteria 5978
264 Ga0307416_100061660 3300032002 Bacteria 3062
265 Ga0307416_100121682 3300032002 Bacteria 2327
266 Ga0307416_100634609 3300032002 Bacteria 1151
267 Ga0307414_10002625 3300032004 Bacteria 9458
268 Ga0307414_10069709 3300032004 Bacteria 2529
269 Ga0307414_10092578 3300032004 Bacteria 2250
270 Ga0307411_10001935 3300032005 Bacteria 8862
271 Ga0307411_10037612 3300032005 Bacteria 3044
272 Ga0307411_10158411 3300032005 Unclassified 1692
273 Ga0307415_100010337 3300032126 Bacteria 5281
274 Ga0307415_100115162 3300032126 Bacteria 2003
275 Ga0307415_100162036 3300032126 Bacteria 1735
276 Ga0307415_100268547 3300032126 Unclassified 1396
277 Ga0307510_10000005 3300033180 Bacteria 633068
278 Ga0373962_0049833 3300035242 Unclassified 1205
279 Ga0395899_0000901 3300037312 Bacteria 27970
280 Ga0395899_0001170 3300037312 Bacteria 23165
281 Ga0395899_0060106 3300037312 Bacteria 2800
282 Ga0395900_0000111 3300037418 Bacteria 145390
283 Ga0395900_0004296 3300037418 Bacteria 15108
284 Ga0395900_0049429 3300037418 Bacteria 4333
285 Ga0395900_0080565 3300037418 Bacteria 3346
286 Ga0395900_0172710 3300037418 Bacteria 2199
287 Ga0395900_0306565 3300037418 Bacteria 1572
288 Ga0395898_0004965 3300037466 Bacteria 14441
289 Ga0395898_0115462 3300037466 Bacteria 2572
290 Ga0395898_0125697 3300037466 Bacteria 2457
291 Ga0395898_0147385 3300037466 Bacteria 2253
292 Ga0395898_0184576 3300037466 Bacteria 1993
293 Ga0395898_0281535 3300037466 Bacteria 1586
294 Ga0395898_0512560 3300037466 Bacteria 1140
295 Ga0395905_0001342 3300037471 Bacteria 29960
296 Ga0395905_0001923 3300037471 Bacteria 23843
297 Ga0395905_0015514 3300037471 Bacteria 7242
298 Ga0395905_0015753 3300037471 Bacteria 7182
299 Ga0395905_0033186 3300037471 Bacteria 4850
300 Ga0395905_0047648 3300037471 Bacteria 4015
301 Ga0395905_0051523 3300037471 Bacteria 3856
302 Ga0395905_0202194 3300037471 Unclassified 1862
303 Ga0395905_0289947 3300037471 Bacteria 1523
304 Ga0395905_0300541 3300037471 Bacteria 1492
305 Ga0395901_0000032 3300038443 Bacteria 235172
306 Ga0395901_0004525 3300038443 Bacteria 14022
307 Ga0395901_0014857 3300038443 Bacteria 7910
308 Ga0395901_0038789 3300038443 Bacteria 4927
309 Ga0395901_0052904 3300038443 Bacteria 4221
310 Ga0395901_0080845 3300038443 Bacteria 3394
311 Ga0395901_0093893 3300038443 Bacteria 3142
312 Ga0395901_0112703 3300038443 Bacteria 2856
313 Ga0436365_0970858 3300039437 Bacteria 175279
314 Ga0436362_0554113 3300039453 Bacteria 162652
315 Ga0439432_010996 3300042006 Bacteria 3120
316 Ga0439449_0014512 3300042007 Bacteria 2961
317 Ga0466958_0029071 3300045836 Bacteria 3279
318 Ga0495585_0074592 3300046492 Bacteria 1846
319 Ga0495583_0003202 3300046506 Bacteria 12821
320 Ga0495606_0002477 3300046507 Bacteria 21363
321 Ga0495606_0034682 3300046507 Bacteria 3461
322 Ga0495610_0038866 3300046512 Bacteria 2411
323 Ga0495631_0026171 3300046518 Bacteria 2682
324 Ga0495632_0014955 3300046519 Bacteria 4370
325 Ga0495643_0000570 3300046522 Bacteria 45556
326 Ga0495648_0000743 3300046524 Bacteria 34808
327 Ga0495663_0004903 3300046525 Bacteria 3741
328 Ga0495633_0001210 3300046558 Bacteria 20774
329 Ga0495668_0000109 3300046616 Bacteria 132453
330 Ga0495611_0105477 3300046648 Bacteria 1311
331 Ga0495625_0045791 3300046660 Bacteria 3160
332 Ga0495649_0035482 3300046694 Bacteria 2743
333 Ga0495660_0063945 3300046810 Bacteria 1968
334 Ga0495683_0004164 3300047323 Bacteria 8280
335 Ga0495681_0017900 3300047470 Unclassified 3921
336 Ga0495686_0017570 3300047472 Bacteria 4813
337 Ga0496100_0001084 3300048903 Bacteria 13136
338 Ga0496101_0009144 3300048904 Bacteria 6503
339 Ga0496102_0000208 3300048905 Bacteria 78662
340 Ga0496103_0000308 3300048906 Bacteria 45133
341 Ga0496104_0034647 3300048907 Bacteria 4710
342 Ga0496105_0236427 3300048908 Unclassified 1483
343 Ga0496106_0056499 3300048909 Bacteria 2967
344 Ga0496108_0001513 3300048911 Bacteria 18409
345 Ga0496108_0025880 3300048911 Bacteria 4839
346 Ga0496109_0002942 3300048912 Bacteria 14252
347 Ga0496110_0000252 3300048913 Bacteria 34772
348 Ga0496110_0032625 3300048913 Bacteria 4500
349 Ga0496111_0000419 3300048914 Bacteria 21416
350 Ga0496111_0004531 3300048914 Bacteria 8792
351 Ga0496111_0077407 3300048914 Bacteria 2425
352 Ga0496112_0003309 3300048915 Bacteria 13299
353 Ga0496112_0037401 3300048915 Bacteria 4738
354 Ga0496112_0384469 3300048915 Bacteria 1344
355 Ga0496113_0004400 3300048916 Bacteria 8645
356 Ga0496113_0048594 3300048916 Bacteria 3157
357 Ga0496114_0017535 3300048917 Bacteria 5781
358 Ga0496115_0000094 3300048918 Bacteria 83055
359 Ga0496116_0001767 3300048919 Bacteria 23559
360 Ga0496117_0000812 3300048920 Bacteria 48380
361 Ga0496118_0000091 3300048921 Bacteria 173092
362 Ga0496119_0006553 3300048922 Bacteria 10739
363 Ga0496120_0004495 3300048923 Bacteria 11671
364 Ga0496121_0001745 3300048924 Bacteria 35537
365 Ga0496122_0025819 3300048925 Bacteria 5086
366 Ga0496123_0003691 3300048926 Bacteria 16863
367 Ga0496124_0000298 3300048927 Bacteria 92116
368 Ga0496125_0008259 3300048928 Bacteria 10932
369 Ga0496126_0000449 3300048929 Bacteria 82077
370 Ga0501031_0010801 3300049568 Bacteria 5947
371 Ga0501032_0083752 3300049569 Bacteria 2120
372 Ga0501034_0172064 3300049571 Bacteria 2133
373 Ga0501034_0283490 3300049571 Bacteria 1596
374 Ga0501036_0087421 3300049572 Bacteria 2634
375 Ga0501037_0049451 3300049573 Bacteria 3078
376 Ga0501038_0061661 3300049574 Bacteria 3206
377 Ga0501043_0077043 3300049579 Bacteria 2619
378 Ga0501047_0050834 3300049581 Bacteria 4002
379 Ga0501068_0047764 3300049584 Bacteria 2583
380 Ga0501268_001741 3300049765 Bacteria 2765
381 Ga0501045_0120288 3300049824 Bacteria 1950
382 nmdc:mga07m45_147576_c1 3300050496 Bacteria 1363
383 nmdc:mga05p37_160086_c1 3300050507 Bacteria 2750
384 nmdc:mga09592_3330_c1 3300050508 Bacteria 12996
385 nmdc:mga0qj67_13336_c1 3300050509 Bacteria 6203
386 nmdc:mga0qj67_80720_c1 3300050509 Unclassified 2606
387 nmdc:mga06r32_59_c1 3300050510 Bacteria 70317
388 nmdc:mga08y16_87167_c1 3300050511 Bacteria 3253
389 Ga0530510_0028000 3300061734 Bacteria 4040

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046648 Ga0495611_0105477 Ga0495611_0105477_17_904 293
2 3300037466 Ga0395898_0125697 Ga0395898_0125697_288_1175 295
3 3300037466 Ga0395898_0512560 Ga0395898_0512560_13_906 295
4 3300037471 Ga0395905_0202194 Ga0395905_0202194_109_996 295
5 3300038443 Ga0395901_0014857 Ga0395901_0014857_4106_4993 295
6 3300048914 Ga0496111_0077407 Ga0496111_0077407_17_910 295
7 3300049571 Ga0501034_0283490 Ga0501034_0283490_567_1547 316
8 3300038443 Ga0395901_0038789 Ga0395901_0038789_3741_4814 320
9 3300026041 Ga0207639_10105560 Ga0207639_101055602 321
10 3300031548 Ga0307408_100068004 Ga0307408_1000680042 321
11 3300031911 Ga0307412_10132978 Ga0307412_101329782 321
12 3300032002 Ga0307416_100011151 Ga0307416_1000111513 321
13 3300032126 Ga0307415_100010337 Ga0307415_1000103374 321
14 3300037418 Ga0395900_0306565 Ga0395900_0306565_132_1205 324
15 3300037466 Ga0395898_0115462 Ga0395898_0115462_61_1134 324
16 3300009101 Ga0105247_10012106 Ga0105247_100121063 325
17 3300014968 Ga0157379_10028151 Ga0157379_100281512 325
18 iso_pu_bacteria 2854896431 2854900106 325
19 3300050496 nmdc:mga07m45_147576_c1 nmdc:mga07m45_147576_c1_205_1245 327
20 3300037418 Ga0395900_0080565 Ga0395900_0080565_2275_3327 329
21 3300037471 Ga0395905_0015514 Ga0395905_0015514_439_1491 329
22 3300038443 Ga0395901_0080845 Ga0395901_0080845_1065_2117 329
23 3300005366 Ga0070659_100005853 Ga0070659_1000058533 331
24 3300025919 Ga0207657_10090167 Ga0207657_100901672 331
25 3300028786 Ga0307517_10012059 Ga0307517_100120598 332
26 3300049824 Ga0501045_0120288 Ga0501045_0120288_109_1176 332
27 3300061734 Ga0530510_0028000 Ga0530510_0028000_924_1991 332
28 3300005329 Ga0070683_100007684 Ga0070683_1000076843 334
29 3300005535 Ga0070684_100001337 Ga0070684_1000013374 334
30 3300005564 Ga0070664_100084661 Ga0070664_1000846612 334
31 3300005614 Ga0068856_100000380 Ga0068856_10000038016 334
32 3300025944 Ga0207661_10002918 Ga0207661_1000291812 334
33 3300026078 Ga0207702_10000544 Ga0207702_100005444 334
34 3300048925 Ga0496122_0025819 Ga0496122_0025819_3121_4164 337
35 3300048926 Ga0496123_0003691 Ga0496123_0003691_9770_10813 337
36 3300048928 Ga0496125_0008259 Ga0496125_0008259_7188_8231 337
37 3300013105 Ga0157369_10006376 Ga0157369_100063766 340
38 3300031731 Ga0307405_10035625 Ga0307405_100356252 341
39 3300031824 Ga0307413_10011833 Ga0307413_100118333 341
40 3300031852 Ga0307410_10005068 Ga0307410_100050683 341
41 3300031901 Ga0307406_10047760 Ga0307406_100477602 341
42 3300031995 Ga0307409_100008144 Ga0307409_1000081445 341
43 3300032002 Ga0307416_100121682 Ga0307416_1001216822 341
44 3300032004 Ga0307414_10069709 Ga0307414_100697092 341
45 3300032126 Ga0307415_100115162 Ga0307415_1001151622 341
46 3300028794 Ga0307515_10108350 Ga0307515_101083502 342
47 3300042006 Ga0439432_010996 Ga0439432_010996_83_1117 342
48 3300042007 Ga0439449_0014512 Ga0439449_0014512_1641_2675 342
49 3300049571 Ga0501034_0172064 Ga0501034_0172064_560_1594 342
50 3300049765 Ga0501268_001741 Ga0501268_001741_354_1388 342
51 3300032002 Ga0307416_100634609 Ga0307416_1006346091 343
52 3300038443 Ga0395901_0052904 Ga0395901_0052904_3042_4076 344
53 iso_pu_bacteria 2928531327 2928534046 344
54 3300001989 JGI24739J22299_10034330 JGI24739J22299_100343301 345
55 3300003187 JGI25151J46595_10000667 JGI25151J46595_1000066710 345
56 3300003354 JGI25160J50197_1001918 JGI25160J50197_10019183 345
57 3300005262 Ga0065165_1028822 Ga0065165_10288222 345
58 3300005339 Ga0070660_100016007 Ga0070660_1000160077 345
59 3300005344 Ga0070661_100049739 Ga0070661_1000497392 345
60 3300005366 Ga0070659_100128023 Ga0070659_1001280232 345
61 3300005366 Ga0070659_100161763 Ga0070659_1001617632 345
62 3300005548 Ga0070665_100000021 Ga0070665_100000021184 345
63 3300005563 Ga0068855_100118269 Ga0068855_1001182693 345
64 3300005577 Ga0068857_100141982 Ga0068857_1001419822 345
65 3300005616 Ga0068852_100006828 Ga0068852_1000068289 345
66 3300009093 Ga0105240_10326714 Ga0105240_103267142 345
67 3300009174 Ga0105241_10059473 Ga0105241_100594733 345
68 3300009551 Ga0105238_10007872 Ga0105238_100078729 345
69 3300013102 Ga0157371_10004910 Ga0157371_100049105 345
70 3300013104 Ga0157370_10030939 Ga0157370_100309391 345
71 3300013105 Ga0157369_10073718 Ga0157369_100737183 345
72 3300017792 Ga0163161_10065147 Ga0163161_100651472 345
73 3300025284 Ga0209130_1002327 Ga0209130_10023275 345
74 3300025294 Ga0209025_1000429 Ga0209025_100042924 345
75 3300025297 Ga0209758_1001704 Ga0209758_100170413 345
76 3300025302 Ga0207426_1000085 Ga0207426_1000085133 345
77 3300025304 Ga0209257_1000761 Ga0209257_100076126 345
78 3300025904 Ga0207647_10121567 Ga0207647_101215672 345
79 3300025909 Ga0207705_10126078 Ga0207705_101260782 345
80 3300025920 Ga0207649_10048330 Ga0207649_100483302 345
81 3300025949 Ga0207667_10017593 Ga0207667_1001759310 345
82 3300026116 Ga0207674_10340461 Ga0207674_103404612 345
83 3300028379 Ga0268266_10000015 Ga0268266_10000015269 345
84 3300046492 Ga0495585_0074592 Ga0495585_0074592_682_1725 345
85 3300046506 Ga0495583_0003202 Ga0495583_0003202_2643_3686 345
86 3300046507 Ga0495606_0034682 Ga0495606_0034682_692_1735 345
87 3300046512 Ga0495610_0038866 Ga0495610_0038866_339_1382 345
88 3300046518 Ga0495631_0026171 Ga0495631_0026171_672_1715 345
89 3300046522 Ga0495643_0000570 Ga0495643_0000570_5531_6574 345
90 3300046524 Ga0495648_0000743 Ga0495648_0000743_23578_24621 345
91 3300046525 Ga0495663_0004903 Ga0495663_0004903_766_1809 345
92 3300046558 Ga0495633_0001210 Ga0495633_0001210_11915_12958 345
93 3300046616 Ga0495668_0000109 Ga0495668_0000109_82993_84036 345
94 3300046660 Ga0495625_0045791 Ga0495625_0045791_2013_3056 345
95 3300046694 Ga0495649_0035482 Ga0495649_0035482_43_1086 345
96 3300046810 Ga0495660_0063945 Ga0495660_0063945_87_1130 345
97 3300047323 Ga0495683_0004164 Ga0495683_0004164_5380_6423 345
98 3300047470 Ga0495681_0017900 Ga0495681_0017900_2720_3763 345
99 3300048905 Ga0496102_0000208 Ga0496102_0000208_26463_27506 345
100 3300048906 Ga0496103_0000308 Ga0496103_0000308_20088_21131 345
101 3300048913 Ga0496110_0032625 Ga0496110_0032625_3340_4383 345
102 3300048914 Ga0496111_0004531 Ga0496111_0004531_6200_7243 345
103 3300048917 Ga0496114_0017535 Ga0496114_0017535_2877_3920 345
104 3300048918 Ga0496115_0000094 Ga0496115_0000094_31060_32103 345
105 3300048919 Ga0496116_0001767 Ga0496116_0001767_16454_17497 345
106 3300048920 Ga0496117_0000812 Ga0496117_0000812_17194_18237 345
107 3300048921 Ga0496118_0000091 Ga0496118_0000091_29859_30902 345
108 3300048922 Ga0496119_0006553 Ga0496119_0006553_6593_7636 345
109 3300048923 Ga0496120_0004495 Ga0496120_0004495_10418_11461 345
110 3300048924 Ga0496121_0001745 Ga0496121_0001745_4664_5707 345
111 3300048927 Ga0496124_0000298 Ga0496124_0000298_30096_31139 345
112 3300048929 Ga0496126_0000449 Ga0496126_0000449_20073_21116 345
113 3300049568 Ga0501031_0010801 Ga0501031_0010801_4339_5385 345
114 3300049569 Ga0501032_0083752 Ga0501032_0083752_934_1980 345
115 3300049572 Ga0501036_0087421 Ga0501036_0087421_452_1498 345
116 3300049573 Ga0501037_0049451 Ga0501037_0049451_1382_2428 345
117 3300049574 Ga0501038_0061661 Ga0501038_0061661_228_1274 345
118 3300049579 Ga0501043_0077043 Ga0501043_0077043_51_1097 345
119 3300049581 Ga0501047_0050834 Ga0501047_0050834_2598_3644 345
120 3300049584 Ga0501068_0047764 Ga0501068_0047764_331_1377 345
121 3300005539 Ga0068853_100070252 Ga0068853_1000702523 346
122 3300006846 Ga0075430_100310582 Ga0075430_1003105822 346
123 3300006880 Ga0075429_100032042 Ga0075429_1000320422 346
124 3300009147 Ga0114129_10241948 Ga0114129_102419482 346
125 3300013105 Ga0157369_10002550 Ga0157369_1000255015 346
126 3300021358 Ga0213873_10000006 Ga0213873_1000000640 346
127 3300021384 Ga0213876_10000004 Ga0213876_10000004546 346
128 3300039437 Ga0436365_0970858 Ga0436365_0970858_88984_90030 346
129 3300039453 Ga0436362_0554113 Ga0436362_0554113_120212_121258 346
130 3300045836 Ga0466958_0029071 Ga0466958_0029071_1613_2656 346
131 3300050507 nmdc:mga05p37_160086_c1 nmdc:mga05p37_160086_c1_984_2033 346
132 3300050509 nmdc:mga0qj67_80720_c1 nmdc:mga0qj67_80720_c1_96_1145 346
133 3300003781 Ga0055536_1002105 Ga0055536_10021057 347
134 3300003784 Ga0055534_1003465 Ga0055534_10034654 347
135 3300003791 Ga0055530_10000005 Ga0055530_1000000580 347
136 3300003794 Ga0055531_10001265 Ga0055531_1000126510 347
137 3300005345 Ga0070692_10017318 Ga0070692_100173183 347
138 3300005347 Ga0070668_100005699 Ga0070668_1000056995 347
139 3300005353 Ga0070669_100003953 Ga0070669_1000039532 347
140 3300005444 Ga0070694_100088163 Ga0070694_1000881631 347
141 3300005457 Ga0070662_100002220 Ga0070662_1000022206 347
142 3300005458 Ga0070681_10221840 Ga0070681_102218402 347
143 3300005530 Ga0070679_100177932 Ga0070679_1001779322 347
144 3300005548 Ga0070665_100017054 Ga0070665_1000170545 347
145 3300005563 Ga0068855_100169526 Ga0068855_1001695262 347
146 3300005719 Ga0068861_100000112 Ga0068861_10000011214 347
147 3300006844 Ga0075428_100016021 Ga0075428_1000160216 347
148 3300006844 Ga0075428_100020610 Ga0075428_1000206103 347
149 3300006844 Ga0075428_100131236 Ga0075428_1001312363 347
150 3300006846 Ga0075430_100004231 Ga0075430_1000042314 347
151 3300006847 Ga0075431_100000131 Ga0075431_10000013115 347
152 3300006880 Ga0075429_100007713 Ga0075429_1000077135 347
153 3300009093 Ga0105240_10000301 Ga0105240_1000030116 347
154 3300009094 Ga0111539_10337763 Ga0111539_103377632 347
155 3300009147 Ga0114129_10008244 Ga0114129_100082443 347
156 3300009551 Ga0105238_10151571 Ga0105238_101515712 347
157 3300010375 Ga0105239_10000589 Ga0105239_1000058916 347
158 3300011119 Ga0105246_10122316 Ga0105246_101223162 347
159 3300025291 Ga0209675_1000564 Ga0209675_10005642 347
160 3300025292 Ga0209676_1000132 Ga0209676_100013257 347
161 3300025294 Ga0209025_1005557 Ga0209025_10055575 347
162 3300025298 Ga0209050_1000139 Ga0209050_100013958 347
163 3300025304 Ga0209257_1000164 Ga0209257_1000164128 347
164 3300025304 Ga0209257_1002228 Ga0209257_100222816 347
165 3300025907 Ga0207645_10046485 Ga0207645_100464853 347
166 3300025908 Ga0207643_10026442 Ga0207643_100264423 347
167 3300025913 Ga0207695_10000399 Ga0207695_1000039915 347
168 3300025921 Ga0207652_10184179 Ga0207652_101841791 347
169 3300025925 Ga0207650_10089437 Ga0207650_100894371 347
170 3300025933 Ga0207706_10014049 Ga0207706_100140492 347
171 3300025949 Ga0207667_10109860 Ga0207667_101098602 347
172 3300025961 Ga0207712_10041222 Ga0207712_100412222 347
173 3300026116 Ga0207674_10012778 Ga0207674_100127786 347
174 3300026118 Ga0207675_100000046 Ga0207675_10000004644 347
175 3300027907 Ga0207428_10044287 Ga0207428_100442873 347
176 3300028379 Ga0268266_10018519 Ga0268266_100185195 347
177 3300028380 Ga0268265_10045324 Ga0268265_100453242 347
178 3300031548 Ga0307408_100295994 Ga0307408_1002959941 347
179 3300031824 Ga0307413_10051570 Ga0307413_100515702 347
180 3300031901 Ga0307406_10016124 Ga0307406_100161243 347
181 3300031911 Ga0307412_10097261 Ga0307412_100972612 347
182 3300031911 Ga0307412_10220239 Ga0307412_102202391 347
183 3300032002 Ga0307416_100061660 Ga0307416_1000616602 347
184 3300032005 Ga0307411_10158411 Ga0307411_101584112 347
185 3300032126 Ga0307415_100268547 Ga0307415_1002685472 347
186 3300037312 Ga0395899_0000901 Ga0395899_0000901_11881_12933 347
187 3300037418 Ga0395900_0000111 Ga0395900_0000111_102491_103543 347
188 3300037418 Ga0395900_0049429 Ga0395900_0049429_131_1177 347
189 3300037466 Ga0395898_0281535 Ga0395898_0281535_114_1160 347
190 3300037471 Ga0395905_0015753 Ga0395905_0015753_5397_6449 347
191 3300037471 Ga0395905_0289947 Ga0395905_0289947_190_1236 347
192 3300038443 Ga0395901_0000032 Ga0395901_0000032_120335_121387 347
193 3300050508 nmdc:mga09592_3330_c1 nmdc:mga09592_3330_c1_1111_2166 347
194 3300050509 nmdc:mga0qj67_13336_c1 nmdc:mga0qj67_13336_c1_375_1430 347
195 3300050510 nmdc:mga06r32_59_c1 nmdc:mga06r32_59_c1_33552_34607 347
196 3300050511 nmdc:mga08y16_87167_c1 nmdc:mga08y16_87167_c1_221_1276 347
197 3300005327 Ga0070658_10026007 Ga0070658_100260074 348
198 3300005330 Ga0070690_100000846 Ga0070690_1000008469 348
199 3300005331 Ga0070670_100254566 Ga0070670_1002545662 348
200 3300005335 Ga0070666_10005934 Ga0070666_100059347 348
201 3300005335 Ga0070666_10170923 Ga0070666_101709232 348
202 3300005339 Ga0070660_100035236 Ga0070660_1000352362 348
203 3300005344 Ga0070661_100090690 Ga0070661_1000906902 348
204 3300005355 Ga0070671_100057666 Ga0070671_1000576663 348
205 3300005356 Ga0070674_100014030 Ga0070674_1000140304 348
206 3300005364 Ga0070673_100018736 Ga0070673_1000187364 348
207 3300005366 Ga0070659_100067195 Ga0070659_1000671952 348
208 3300005367 Ga0070667_100003803 Ga0070667_1000038036 348
209 3300005367 Ga0070667_100099915 Ga0070667_1000999152 348
210 3300005456 Ga0070678_100015256 Ga0070678_1000152562 348
211 3300005459 Ga0068867_100040404 Ga0068867_1000404043 348
212 3300005544 Ga0070686_100008534 Ga0070686_1000085343 348
213 3300005577 Ga0068857_100018738 Ga0068857_1000187385 348
214 3300005616 Ga0068852_100012705 Ga0068852_1000127052 348
215 3300005617 Ga0068859_100022493 Ga0068859_1000224937 348
216 3300005841 Ga0068863_100007275 Ga0068863_1000072756 348
217 3300005842 Ga0068858_100006726 Ga0068858_1000067268 348
218 3300005842 Ga0068858_100059408 Ga0068858_1000594083 348
219 3300006237 Ga0097621_100003571 Ga0097621_1000035718 348
220 3300006358 Ga0068871_100030909 Ga0068871_1000309092 348
221 3300006881 Ga0068865_100007921 Ga0068865_1000079213 348
222 3300006931 Ga0097620_100022491 Ga0097620_1000224912 348
223 3300009098 Ga0105245_10009635 Ga0105245_100096352 348
224 3300009148 Ga0105243_10333382 Ga0105243_103333822 348
225 3300009551 Ga0105238_10016657 Ga0105238_100166577 348
226 3300013102 Ga0157371_10160380 Ga0157371_101603802 348
227 3300013105 Ga0157369_10017977 Ga0157369_100179773 348
228 3300013296 Ga0157374_10068704 Ga0157374_100687043 348
229 3300013297 Ga0157378_10039460 Ga0157378_100394603 348
230 3300013306 Ga0163162_10040297 Ga0163162_100402973 348
231 3300013308 Ga0157375_10011198 Ga0157375_100111985 348
232 3300014325 Ga0163163_10037855 Ga0163163_100378552 348
233 3300025899 Ga0207642_10058059 Ga0207642_100580592 348
234 3300025903 Ga0207680_10040671 Ga0207680_100406712 348
235 3300025903 Ga0207680_10176519 Ga0207680_101765192 348
236 3300025919 Ga0207657_10046772 Ga0207657_100467722 348
237 3300025920 Ga0207649_10139159 Ga0207649_101391592 348
238 3300025924 Ga0207694_10026518 Ga0207694_100265183 348
239 3300025925 Ga0207650_10052761 Ga0207650_100527613 348
240 3300025925 Ga0207650_10244742 Ga0207650_102447422 348
241 3300025931 Ga0207644_10000287 Ga0207644_1000028722 348
242 3300025933 Ga0207706_10001384 Ga0207706_1000138418 348
243 3300025935 Ga0207709_10226214 Ga0207709_102262142 348
244 3300025938 Ga0207704_10020877 Ga0207704_100208771 348
245 3300025940 Ga0207691_10001279 Ga0207691_100012799 348
246 3300025960 Ga0207651_10021439 Ga0207651_100214393 348
247 3300026035 Ga0207703_10027724 Ga0207703_100277243 348
248 3300026035 Ga0207703_10270055 Ga0207703_102700552 348
249 3300026067 Ga0207678_10171897 Ga0207678_101718972 348
250 3300026078 Ga0207702_10140228 Ga0207702_101402283 348
251 3300026089 Ga0207648_10002272 Ga0207648_1000227217 348
252 3300026095 Ga0207676_10026340 Ga0207676_100263403 348
253 3300026116 Ga0207674_10005724 Ga0207674_100057245 348
254 3300026121 Ga0207683_10001183 Ga0207683_1000118310 348
255 3300028381 Ga0268264_10493097 Ga0268264_104930972 348
256 3300035242 Ga0373962_0049833 Ga0373962_0049833_36_1082 348
257 3300037312 Ga0395899_0060106 Ga0395899_0060106_1286_2338 348
258 3300037418 Ga0395900_0004296 Ga0395900_0004296_9250_10296 348
259 3300037466 Ga0395898_0184576 Ga0395898_0184576_431_1483 348
260 3300037471 Ga0395905_0001342 Ga0395905_0001342_19653_20699 348
261 3300037471 Ga0395905_0051523 Ga0395905_0051523_2338_3384 348
262 3300037471 Ga0395905_0300541 Ga0395905_0300541_122_1174 348
263 3300047472 Ga0495686_0017570 Ga0495686_0017570_1668_2720 348
264 3300048903 Ga0496100_0001084 Ga0496100_0001084_7895_8941 348
265 3300048904 Ga0496101_0009144 Ga0496101_0009144_3893_4939 348
266 3300048907 Ga0496104_0034647 Ga0496104_0034647_2517_3563 348
267 3300048908 Ga0496105_0236427 Ga0496105_0236427_164_1210 348
268 3300048909 Ga0496106_0056499 Ga0496106_0056499_1711_2757 348
269 3300048911 Ga0496108_0001513 Ga0496108_0001513_14099_15145 348
270 3300048912 Ga0496109_0002942 Ga0496109_0002942_5689_6735 348
271 3300048913 Ga0496110_0000252 Ga0496110_0000252_16903_17949 348
272 3300048914 Ga0496111_0000419 Ga0496111_0000419_12981_14027 348
273 3300048915 Ga0496112_0003309 Ga0496112_0003309_9011_10057 348
274 3300048915 Ga0496112_0384469 Ga0496112_0384469_35_1087 348
275 3300048916 Ga0496113_0004400 Ga0496113_0004400_7518_8564 348
276 3300001979 JGI24740J21852_10000521 JGI24740J21852_100005215 349
277 3300003316 rootH1_10030947 rootH1_100309472 349
278 3300003323 rootH1_10341186 rootH1_103411861 349
279 3300005327 Ga0070658_10105096 Ga0070658_101050962 349
280 3300005329 Ga0070683_100009905 Ga0070683_1000099054 349
281 3300005331 Ga0070670_100005356 Ga0070670_1000053564 349
282 3300005335 Ga0070666_10009702 Ga0070666_100097022 349
283 3300005336 Ga0070680_100007645 Ga0070680_1000076454 349
284 3300005337 Ga0070682_100083413 Ga0070682_1000834132 349
285 3300005341 Ga0070691_10001137 Ga0070691_100011373 349
286 3300005344 Ga0070661_100137663 Ga0070661_1001376632 349
287 3300005366 Ga0070659_100036864 Ga0070659_1000368643 349
288 3300005366 Ga0070659_100074376 Ga0070659_1000743762 349
289 3300005367 Ga0070667_100035275 Ga0070667_1000352753 349
290 3300005367 Ga0070667_100038882 Ga0070667_1000388822 349
291 3300005456 Ga0070678_100228412 Ga0070678_1002284122 349
292 3300005457 Ga0070662_100171641 Ga0070662_1001716412 349
293 3300005539 Ga0068853_100014159 Ga0068853_1000141594 349
294 3300005548 Ga0070665_100015714 Ga0070665_1000157145 349
295 3300005548 Ga0070665_100069846 Ga0070665_1000698462 349
296 3300005548 Ga0070665_100135811 Ga0070665_1001358112 349
297 3300005564 Ga0070664_100003074 Ga0070664_10000307411 349
298 3300005564 Ga0070664_100005518 Ga0070664_1000055186 349
299 3300005578 Ga0068854_100001320 Ga0068854_10000132010 349
300 3300005616 Ga0068852_100016905 Ga0068852_1000169053 349
301 3300005617 Ga0068859_100004563 Ga0068859_1000045638 349
302 3300005618 Ga0068864_100012225 Ga0068864_1000122256 349
303 3300005841 Ga0068863_100137507 Ga0068863_1001375072 349
304 3300005842 Ga0068858_100244110 Ga0068858_1002441102 349
305 3300005844 Ga0068862_100008268 Ga0068862_1000082684 349
306 3300006931 Ga0097620_100004563 Ga0097620_1000045633 349
307 3300009093 Ga0105240_10016673 Ga0105240_100166733 349
308 3300009093 Ga0105240_10036540 Ga0105240_100365403 349
309 3300009174 Ga0105241_10073471 Ga0105241_100734712 349
310 3300009177 Ga0105248_10172580 Ga0105248_101725802 349
311 3300009545 Ga0105237_10008182 Ga0105237_100081824 349
312 3300009551 Ga0105238_10002841 Ga0105238_100028416 349
313 3300009551 Ga0105238_10045154 Ga0105238_100451543 349
314 3300009551 Ga0105238_10052415 Ga0105238_100524153 349
315 3300010375 Ga0105239_10048542 Ga0105239_100485423 349
316 3300013100 Ga0157373_10023723 Ga0157373_100237232 349
317 3300013105 Ga0157369_10094433 Ga0157369_100944332 349
318 3300013296 Ga0157374_10138841 Ga0157374_101388412 349
319 3300013307 Ga0157372_10023580 Ga0157372_100235804 349
320 3300014325 Ga0163163_10070957 Ga0163163_100709572 349
321 3300014325 Ga0163163_10355165 Ga0163163_103551652 349
322 3300014968 Ga0157379_10018972 Ga0157379_100189723 349
323 3300025900 Ga0207710_10023932 Ga0207710_100239322 349
324 3300025904 Ga0207647_10001861 Ga0207647_100018613 349
325 3300025909 Ga0207705_10007724 Ga0207705_100077243 349
326 3300025911 Ga0207654_10019954 Ga0207654_100199543 349
327 3300025913 Ga0207695_10028765 Ga0207695_100287653 349
328 3300025913 Ga0207695_10091983 Ga0207695_100919831 349
329 3300025913 Ga0207695_10108357 Ga0207695_101083572 349
330 3300025914 Ga0207671_10164582 Ga0207671_101645821 349
331 3300025919 Ga0207657_10003465 Ga0207657_100034655 349
332 3300025920 Ga0207649_10062824 Ga0207649_100628241 349
333 3300025923 Ga0207681_10029221 Ga0207681_100292212 349
334 3300025924 Ga0207694_10013761 Ga0207694_100137613 349
335 3300025924 Ga0207694_10044511 Ga0207694_100445114 349
336 3300025924 Ga0207694_10308849 Ga0207694_103088492 349
337 3300025925 Ga0207650_10083712 Ga0207650_100837122 349
338 3300025931 Ga0207644_10052136 Ga0207644_100521362 349
339 3300025931 Ga0207644_10163768 Ga0207644_101637682 349
340 3300025932 Ga0207690_10001588 Ga0207690_100015882 349
341 3300025933 Ga0207706_10010765 Ga0207706_100107655 349
342 3300025933 Ga0207706_10268638 Ga0207706_102686382 349
343 3300025940 Ga0207691_10108299 Ga0207691_101082992 349
344 3300025941 Ga0207711_10023752 Ga0207711_100237523 349
345 3300025945 Ga0207679_10009156 Ga0207679_100091562 349
346 3300025945 Ga0207679_10058609 Ga0207679_100586092 349
347 3300025949 Ga0207667_10004831 Ga0207667_100048315 349
348 3300025981 Ga0207640_10002380 Ga0207640_100023803 349
349 3300026035 Ga0207703_10086168 Ga0207703_100861683 349
350 3300026067 Ga0207678_10187994 Ga0207678_101879942 349
351 3300026078 Ga0207702_10002636 Ga0207702_1000263611 349
352 3300026088 Ga0207641_10044683 Ga0207641_100446833 349
353 3300026095 Ga0207676_10024636 Ga0207676_100246363 349
354 3300026116 Ga0207674_10004717 Ga0207674_1000471710 349
355 3300026121 Ga0207683_10013731 Ga0207683_100137313 349
356 3300026142 Ga0207698_10004615 Ga0207698_100046155 349
357 3300028379 Ga0268266_10005791 Ga0268266_100057915 349
358 3300028379 Ga0268266_10053808 Ga0268266_100538083 349
359 3300028379 Ga0268266_10060659 Ga0268266_100606592 349
360 3300028379 Ga0268266_10196782 Ga0268266_101967822 349
361 3300028380 Ga0268265_10003101 Ga0268265_100031019 349
362 3300028381 Ga0268264_10007321 Ga0268264_100073214 349
363 3300031548 Ga0307408_100028598 Ga0307408_1000285982 349
364 3300031731 Ga0307405_10031829 Ga0307405_100318292 349
365 3300031824 Ga0307413_10033695 Ga0307413_100336953 349
366 3300031852 Ga0307410_10000420 Ga0307410_100004204 349
367 3300031911 Ga0307412_10018385 Ga0307412_100183852 349
368 3300031995 Ga0307409_100001686 Ga0307409_1000016865 349
369 3300031995 Ga0307409_100201074 Ga0307409_1002010742 349
370 3300032002 Ga0307416_100009160 Ga0307416_1000091603 349
371 3300032004 Ga0307414_10002625 Ga0307414_100026257 349
372 3300032004 Ga0307414_10092578 Ga0307414_100925782 349
373 3300032005 Ga0307411_10001935 Ga0307411_100019353 349
374 3300032005 Ga0307411_10037612 Ga0307411_100376122 349
375 3300032126 Ga0307415_100162036 Ga0307415_1001620362 349
376 3300033180 Ga0307510_10000005 Ga0307510_10000005343 349
377 3300037312 Ga0395899_0001170 Ga0395899_0001170_2884_3933 349
378 3300037418 Ga0395900_0172710 Ga0395900_0172710_1097_2146 349
379 3300037466 Ga0395898_0004965 Ga0395898_0004965_3671_4720 349
380 3300037466 Ga0395898_0147385 Ga0395898_0147385_942_1991 349
381 3300037471 Ga0395905_0001923 Ga0395905_0001923_3671_4720 349
382 3300037471 Ga0395905_0033186 Ga0395905_0033186_3542_4597 349
383 3300037471 Ga0395905_0047648 Ga0395905_0047648_2718_3767 349
384 3300038443 Ga0395901_0004525 Ga0395901_0004525_8338_9387 349
385 3300038443 Ga0395901_0093893 Ga0395901_0093893_1967_3016 349
386 3300038443 Ga0395901_0112703 Ga0395901_0112703_685_1734 349
387 3300046507 Ga0495606_0002477 Ga0495606_0002477_6186_7244 349
388 3300046519 Ga0495632_0014955 Ga0495632_0014955_1110_2177 349
389 3300048911 Ga0496108_0025880 Ga0496108_0025880_157_1212 349
390 3300048915 Ga0496112_0037401 Ga0496112_0037401_3243_4298 349
391 3300048916 Ga0496113_0048594 Ga0496113_0048594_479_1534 349

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

172

303

0.87

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

30

149

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
8b27-assembly1.cif.gz_A dihydroprecondylocarpine acetate synthase from catharanthus roseus 0.8061 3 346
1q1r-assembly1.cif.gz_A crystal structure of putidaredoxin reductase from pseudomonas putida 0.8029 153 205
8b27-assembly1.cif.gz_B dihydroprecondylocarpine acetate synthase from catharanthus roseus 0.7905 3 343
3g0o-assembly1.cif.gz_A crystal structure of 3-hydroxyisobutyrate dehydrogenase (ygbj) from salmonella typhimurium 0.7904 158 252
8b27-assembly1.cif.gz_A dihydroprecondylocarpine acetate synthase from catharanthus roseus 0.7878 3 346
ID Description Score Start End Superfamily
4gkvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8895 142 278 3.40.50.720
af_Q0D7W4_71_358_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8894 157 190 3.50.50.60
af_B4G1G0_229_356_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8883 152 274 3.40.50.720
1lluA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8882 141 278 3.40.50.720
4cpdB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8844 148 278 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A839TP28-F1-model_v4 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase 0.9423 4 344
AF-A0A2P9ILM5-F1-model_v4 deleted 0.9357 87 343
AF-A0A839TP28-F1-model_v4 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase 0.9266 4 344
AF-A0A539DTY6-F1-model_v4 Alcohol dehydrogenase 0.9258 132 346 GO:0016020
AF-A0A6L3II11-F1-model_v4 Zinc-binding dehydrogenase 0.9225 123 257 GO:0016491

Feature Viewer

pLDDT pTM Quality
91.83 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map